The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Sol g 3.0101

Sequence

Full FASTA alignment

Sequence name:
Query sequence:
DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYL
VCNYGPAGNVLGAKIYEIKK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Sol g 3.0101AAY32926Go!70141.81.3e-36
2Sol i 3P35778Go!234136.02.4e-34
3Sol r 3P35779Go!211126.81.3e-31
4Vesp c 5P35781Go!20276.91.3e-16
5Vesp m 5P81657Go!20276.41.9e-16
6Vesp c 5P35782Go!20275.53.3e-16
7Dol m 5.02P10737Go!21573.71.3e-15
8Ves m 5P35760Go!20473.11.8e-15
9Ves s 5P35786Go!20573.11.8e-15
10Ves g 5P35784Go!20472.33.2e-15
11Dol m 5.0101P10736Go!22772.43.4e-15
12Ves vi 5P35787Go!20672.03.9e-15
13Dol a 5Q05108Go!20371.84.6e-15
14Dol m 5.02AAA28302Go!21271.55.7e-15
15Ves f 5P35783Go!20470.79.8e-15
16Ves v 5Q05110Go!22770.71.0e-14
17Ves p 5P35785Go!20469.62.1e-14
18Poly s 5.0101Q7Z156Go!20769.13.0e-14
19Pol a 5Q05109Go!20967.49.5e-14
20Pol f 5P35780Go!20566.91.4e-13
21Pol g 5P83377Go!20666.12.4e-13
22Pol d 5P81656Go!20666.12.4e-13
23Pol e 5.0101P35759Go!20565.34.2e-13
24Pol e 5.0101AAT95009Go!22664.86.5e-13
25Cte f 2AAF65314Go!26445.93.6e-07
26Cyn d 24.0101AAU15051Go!15344.84.6e-07
27Glo m 5AAF82096Go!25931.86.2e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Sol g 3.0101, Sequence: AAY32926
Sequence identity: 100.00 (70/70)
Sequence 1 DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYL
           DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYL
Sequence 2 DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYL

Sequence 1 VCNYGPAGNVLGAKIYEIKK
           VCNYGPAGNVLGAKIYEIKK
Sequence 2 VCNYGPAGNVLGAKIYEIKK



Alignment 2
Sequence 1:
Sequence 2: Allergen Sol i 3, Sequence: P35778
Sequence identity: 94.29 (66/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MCLEYSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSSGKNKSTP

Sequence 1 --------------DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGR
           --------------DNRWISSFPSD-NILMK-GHYTQIVWAKT-KIGCGR
Sequence 2 NEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGR

Sequence 1 IMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIKK
           IMFKEPDNWTKHYLVCNYGPAGNVLGA-IYEIKK
Sequence 2 IMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK



Alignment 3
Sequence 1:
Sequence 2: Allergen Sol r 3, Sequence: P35779
Sequence identity: 90.00 (63/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEH

Sequence 1 ------------------------------------------DNRWISSF
           ------------------------------------------DNRWISSF
Sequence 2 DACRNVERFAVGQNIAATSSSGKNKSTLSDMILLWYNEVKDFDNRWISSF

Sequence 1 PSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAG
           PSD-NILM--GHYTQIVWAKT-KIGCGRIMFKE-DNW-KHYLVCNYGPAG
Sequence 2 PSDGNILMHVGHYTQIVWAKTKKIGCGRIMFKE-DNWNKHYLVCNYGPAG

Sequence 1 NVLGAKIYEIKK
           NVLGA-IYEIKK
Sequence 2 NVLGAQIYEIKK



Alignment 4
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35781
Sequence identity: 55.71 (39/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDN

Sequence 1 ----------------------------------DNRWISSFPSDPNILM
           ----------------------------------D--------S--N-L-
Sequence 2 CRNSAKYSVGQNIAEGSTTADNFGSVSNMVKMWEDEVKDYQYGSPKNKLN

Sequence 1 KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIY
           K-GHYTQ-VWAKT--IGCG-I---E---W--HYLVCNYGPAGNV----IY
Sequence 2 KVGHYTQMVWAKTKEIGCGSIKYIE-NGWHRHYLVCNYGPAGNVGNEPIY

Sequence 1 EIKK
           E-K-
Sequence 2 ERK-



Alignment 5
Sequence 1:
Sequence 2: Allergen Vesp m 5, Sequence: P81657
Sequence identity: 52.86 (37/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNYCKIKCRSGIHTLCKFGISTKPNCGKNVVKASGLTKAEKLEILKQHNE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FRQKVARGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYGHDV

Sequence 1 ----------------------------------DNRWISSFPSDPNILM
           ----------------------------------D--------S--N-L-
Sequence 2 CRNTAKYSVGQNIAENGSTAASFASVSNMVQMWADEVKNYQYGSTKNKLI

Sequence 1 KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIY
           --GHYTQ-VWAKT--IGCG-I---E---W--HYLVCNYGPAGN-----IY
Sequence 2 EVGHYTQMVWAKTKEIGCGSIKYIE-NGWHRHYLVCNYGPAGNIGNEPIY

Sequence 1 EIKK
           E-K-
Sequence 2 ERK-



Alignment 6
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35782
Sequence identity: 55.71 (39/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDN

Sequence 1 ----------------------------------DNRWISSFPSDPNILM
           ----------------------------------D--------S--N-L-
Sequence 2 CRNSAKYSVGQNIAEGSTSADNFVNVSNMVKMWEDEVKDYQYGSPKNKLN

Sequence 1 KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIY
           K-GHYTQ-VWAKT--IGCG-----E-D-W--HYLVCNYGPAGNV----IY
Sequence 2 KVGHYTQMVWAKTKEIGCGSEDYIE-DGWHRHYLVCNYGPAGNVGNEPIY

Sequence 1 EIKK
           E-K-
Sequence 2 ERK-



Alignment 7
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: P10737
Sequence identity: 48.57 (34/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PIINLSFGEANNYCKIKCSRGIHTLCKFGTSMKPNCGSKLVKVHGVSNDE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTW

Sequence 1 -----------------------------------------------DNR
           --------------------------------------------------
Sequence 2 ANQCSFGHDQCRNTEKYQVGQNVAIASTTGNSYATMSKLIEMWENEVKDF

Sequence 1 WISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCN
           ---------N---K-GHYTQ-VW-KT--IGCG-----E--NW--HYLVCN
Sequence 2 NPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE-NNWHTHYLVCN

Sequence 1 YGPAGNVLGAKIYEIKK
           YGPAGN-----IYE-K-
Sequence 2 YGPAGNYMDQPIYERK-



Alignment 8
Sequence 1:
Sequence 2: Allergen Ves m 5, Sequence: P35760
Sequence identity: 45.71 (32/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHND

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDT

Sequence 1 ------------------------------------DNRWISSFPSDPNI
           ------------------------------------------------N-
Sequence 2 CRDVAKYQVGQNVALTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENN

Sequence 1 LMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAK
           --KIGHYTQ-VWA-T---GCG-I------NW-KHYLVCNYGP-GN-----
Sequence 2 FLKIGHYTQMVWANTKEVGCGSIKYIQ-ENWHKHYLVCNYGPSGNFQNEE

Sequence 1 IYEIKK
           -Y--K-
Sequence 2 LYQTK-



Alignment 9
Sequence 1:
Sequence 2: Allergen Ves s 5, Sequence: P35786
Sequence identity: 50.00 (35/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VDYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHD

Sequence 1 -------------------------------------DNRWISSFPSDPN
           -------------------------------------------------N
Sequence 2 TCKDTTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQN

Sequence 1 ILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGA
           ---KIGHYTQ-VWAKT--IGCG-I------NW--HYLVCNYGPAGN----
Sequence 2 EFKKIGHYTQMVWAKTKEIGCGSIKYVD-NNWYTHYLVCNYGPAGNFGNQ

Sequence 1 KIYEIKK
           --YE-K-
Sequence 2 EVYERK-



Alignment 10
Sequence 1:
Sequence 2: Allergen Ves g 5, Sequence: P35784
Sequence identity: 45.71 (32/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNYCKIKCLKGGVHTACKYESLKPNCANKKVVAYGLTKQEKQDILKEHND

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDT

Sequence 1 ------------------------------------DNRWISSFPSDPNI
           ------------------------------------------------N-
Sequence 2 CRDVAKYPVGQNVALTGSTAAKYDNPVKLVKMWEDEVKDYNPKKKFSENN

Sequence 1 LMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAK
           --KIGHYTQ-VWA-T---GCG-I-----D-W-KHYLVCNYGP-GN-----
Sequence 2 FLKIGHYTQMVWANTKEVGCGSIKYIQ-DKWHKHYLVCNYGPSGNFGNEE

Sequence 1 IYEIKK
           -Y--K-
Sequence 2 LYQTK-



Alignment 11
Sequence 1:
Sequence 2: Allergen Dol m 5.0101, Sequence: P10736
Sequence identity: 48.57 (34/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTATQFDRPS

Sequence 1 ---------DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKE
           -------------------------K-GHYTQ-VW-KT--IGCG-I---E
Sequence 2 KLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIE

Sequence 1 PDNWTKHYLVCNYGPAGNVLGAKIYEIKK
           -DNW--HYLVCNYGP-GN-----IYE-K-
Sequence 2 -DNWYTHYLVCNYGPGGNDFNQPIYERK-



Alignment 12
Sequence 1:
Sequence 2: Allergen Ves vi 5, Sequence: P35787
Sequence identity: 48.57 (34/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KVNYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGH

Sequence 1 --------------------------------------DNRWISSFPSDP
           --------------------------------------------------
Sequence 2 DTCKDTEKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSK

Sequence 1 NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLG
           N-L-K-GHYTQ-VWAKT--IGCG-------D-W--HYLVCNYGP-GN---
Sequence 2 NNLKKTGHYTQMVWAKTKEIGCGSVKYVK-DEWYTHYLVCNYGPSGNFRN

Sequence 1 AKIYEIKK
           -K-YE-K-
Sequence 2 EKLYEKK-



Alignment 13
Sequence 1:
Sequence 2: Allergen Dol a 5, Sequence: Q05108
Sequence identity: 45.71 (32/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNYCKICPKGTHTLCKYGTSMKPNCGGKIVKSYGVTNDEKNEIVKRHNEF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RQKVAQGLETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFGHDQC

Sequence 1 -----------------------------------DNRWISSFPSDPNIL
           -----------------------------------------------N--
Sequence 2 RNTAKYPVGQNVAIASTTGNSYQTMSYLIKMWEDEVKDYNPHKDLMHNNF

Sequence 1 MKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKI
           -K-GHYTQ-VW-KT--IGCG-----E---W--HYLVCNYGPAGN------
Sequence 2 SKVGHYTQMVWGKTKEIGCGSVKYIE-NKWHTHYLVCNYGPAGNYMNQPV

Sequence 1 YEIKK
           YE-K-
Sequence 2 YERK-



Alignment 14
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: AAA28302
Sequence identity: 45.71 (32/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PIINLSFGEANNYCKIKCSRGIHTLCKFGTSMKPNCGSKLVKVHGVSNDE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTW

Sequence 1 -----------------------------------------------DNR
           --------------------------------------------------
Sequence 2 ANQCSFGHDQCRNTEKYQVGQNVAIASTTGNSYATMSKLIEMWENEVKDF

Sequence 1 WISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCN
           ---------N---K-GHYTQ-VW-KT--IGCG-----E--NW--HYLVCN
Sequence 2 NPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE-NNWHTHYLVCN

Sequence 1 YGPAGNVLGAKIYEIKK
           YGPAGN-----IY----
Sequence 2 YGPAGNYMDQPIY----



Alignment 15
Sequence 1:
Sequence 2: Allergen Ves f 5, Sequence: P35783
Sequence identity: 44.29 (31/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNYCKIKCLKGGVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEHND

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDT

Sequence 1 ------------------------------------DNRWISSFPSDPNI
           ------------------------------------------------N-
Sequence 2 CRDIAKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNN

Sequence 1 LMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAK
           --K-GHYTQ-VWA-T---GCG-I-F-----W-KHYLVCNYGP-GN-----
Sequence 2 FLKTGHYTQMVWANTKEVGCGSIKFIQ-EKWHKHYLVCNYGPSGNFQNEE

Sequence 1 IYEIKK
           -Y--K-
Sequence 2 LYQTK-



Alignment 16
Sequence 1:
Sequence 2: Allergen Ves v 5, Sequence: Q05110
Sequence identity: 42.86 (30/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MEISGLVYLIIIVTIIDLPYGKANNYCKIKCLKGGVHTACKYGSLKPNCG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NKVVVSYGLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VWNDELAYVAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTAAKYDDPV

Sequence 1 ---------DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKE
           ---------------------N---K-GHYTQ-VWA-T---GCG-I----
Sequence 2 KLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYIQ

Sequence 1 PDNWTKHYLVCNYGPAGNVLGAKIYEIKK
           ---W-KHYLVCNYGP-GN------Y--K-
Sequence 2 -EKWHKHYLVCNYGPSGNFMNEELYQTK-



Alignment 17
Sequence 1:
Sequence 2: Allergen Ves p 5, Sequence: P35785
Sequence identity: 45.71 (32/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNYCKIKCLKGGVHTACKYGSLKPNCGNKIVVSYGLTKEEKQDILKEHND

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDT

Sequence 1 ------------------------------------DNRWISSFPSDPNI
           ------------------------------------------------N-
Sequence 2 CRDVAKYPVGQNVALTGSTADKYDNPVKLVKMWEDEVKDYNPKKKFSENN

Sequence 1 LMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAK
           --KIGHYTQ-VWA-T--IGCG-I-------W-KHYLVCNYGP-GN-----
Sequence 2 FNKIGHYTQMVWANTKEIGCGSIKYIQ-NEWHKHYLVCNYGPSGNFGNEE

Sequence 1 IYEIKK
           -Y--K-
Sequence 2 LYQTK-



Alignment 18
Sequence 1:
Sequence 2: Allergen Poly s 5.0101, Sequence: Q7Z156
Sequence identity: 47.14 (33/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF

Sequence 1 ---------------------------------------DNRWISSFPSD
           ---------------------------------------------S----
Sequence 2 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT

Sequence 1 PNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVL
           -----K-GHYTQ-VWAKT---GCG-I---E------HYLVCNYGPAGN--
Sequence 2 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEK-GMKSHYLVCNYGPAGNYM

Sequence 1 GAKIYEIKK
           G--IY--K-
Sequence 2 GQPIYTKK-



Alignment 19
Sequence 1:
Sequence 2: Allergen Pol a 5, Sequence: Q05109
Sequence identity: 45.71 (32/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SSQGVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC

Sequence 1 -----------------------------------------DNRWISSFP
           --------------------------------------------------
Sequence 2 QFLVHDKCRNTAKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTG

Sequence 1 SDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGN
           -------KIGHYTQ-VW-KT--IGCG-----E--N---HYL-CNYGPAGN
Sequence 2 ITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME-NNMQNHYLICNYGPAGN

Sequence 1 VLGAKIYEIKK
           -LG---Y--K-
Sequence 2 YLGQLPYTKK-



Alignment 20
Sequence 1:
Sequence 2: Allergen Pol f 5, Sequence: P35780
Sequence identity: 42.86 (30/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILV

Sequence 1 -------------------------------------DNRWISSFPSDPN
           --------------------------------------------------
Sequence 2 HDKCRNTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQ

Sequence 1 ILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGA
           ---K-GHYTQ--WAKT--IGCG--------N---HYL-CNYGPAGN-LG-
Sequence 2 NFGKVGHYTQMIWAKTKEIGCGSLKYMK-NNMQHHYLICNYGPAGNYLGQ

Sequence 1 KIYEIKK
           --Y--K-
Sequence 2 LPYTKK-



Alignment 21
Sequence 1:
Sequence 2: Allergen Pol g 5, Sequence: P83377
Sequence identity: 42.86 (30/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILV

Sequence 1 --------------------------------------DNRWISSFPSDP
           --------------------------------------------------
Sequence 2 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN

Sequence 1 NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLG
           ----K-GHYTQ-VW--T---GCG-----E--N---HYL-CNYGPAGN-LG
Sequence 2 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEK-NMKIHYLICNYGPAGNYLG

Sequence 1 AKIYEIKK
           --IY--K-
Sequence 2 QPIYTKK-



Alignment 22
Sequence 1:
Sequence 2: Allergen Pol d 5, Sequence: P81656
Sequence identity: 42.86 (30/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV

Sequence 1 --------------------------------------DNRWISSFPSDP
           --------------------------------------------------
Sequence 2 HDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITN

Sequence 1 NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLG
           ----K-GHYTQ-VW--T---GCG-----E--N---HYL-CNYGPAGN-LG
Sequence 2 KNFGKVGHYTQMVWGNTKEVGCGSLKYVEK-NMQIHYLICNYGPAGNYLG

Sequence 1 AKIYEIKK
           --IY--K-
Sequence 2 QPIYTKK-



Alignment 23
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: P35759
Sequence identity: 44.29 (31/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLV

Sequence 1 -------------------------------------DNRWISSFPSDPN
           --------------------------------------------------
Sequence 2 HDKCRNTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQ

Sequence 1 ILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGA
           ---KIGHYTQ-VW-KT--IGCG-----E------HYL-CNYGPAGN-LG-
Sequence 2 NFAKIGHYTQMVWGKTKEIGCGSLKYIE-NKMQNHYLICNYGPAGNYLGQ

Sequence 1 KIYEIKK
           --Y--K-
Sequence 2 LPYTKK-



Alignment 24
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: AAT95009
Sequence identity: 42.86 (30/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MEIGGLVYLVIVVAIIHSSQGVDYCKIRCPSGIHTVCQYGESTKPSKNCA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGGSKLPDVVS

Sequence 1 --------DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEP
           ------------------------KIGHYTQ-VW-KT--IGCG-----E-
Sequence 2 LIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME-

Sequence 1 DNWTKHYLVCNYGPAGNVLGAKIYEIKK
           -----HYL-CNYGPAGN-LG------K-
Sequence 2 NKMQNHYLICNYGPAGNYLGQLPNTKK-



Alignment 25
Sequence 1:
Sequence 2: Allergen Cte f 2, Sequence: AAF65314
Sequence identity: 32.86 (23/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MNSLLSSIIIVVFSVWLSVIFAVNVKPKPNQDDYCNLNCTNGPNVGCTKP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DVPRDCQNFKLVNITERMKKAFLNAHNRKRRLVAAGKGLLKDGVHTPIAA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KMPNLTWNIALAKLAEYNVKQCEMKHDCAKTRHGHTGQNLFFYGTTLSPI

Sequence 1 --------------------DNRWISSFPSDPNILMKIGHYTQIVWAKTV
           ------------------------I------------IGHYTQ--W--T-
Sequence 2 KNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYPNGKPIGHYTQLIWGNTT

Sequence 1 KIGCGRIMFKEPDN---WTKHYLVCNYGPAGNVLGAKIYEIKK-------
           K-GC-----K---N----------CNY---GN-L----Y-IK--------
Sequence 2 KVGCAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIKDAKNPKSK

Sequence 1 ---------------
           ---------------
Sequence 2 NQTKNNKKPKQKMPK



Alignment 26
Sequence 1:
Sequence 2: Allergen Cyn d 24.0101, Sequence: AAU15051
Sequence identity: 27.14 (19/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDY

Sequence 1 ----------------------------------------DNRWISSFPS
           --------------------------------------------------
Sequence 2 AESKLKKDCKMVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSN

Sequence 1 DPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV
           --------GHYT--VW--T---GCGR------D--------C-Y-P-GN-
Sequence 2 TCDQGKMCGHYTAVVWKDTTSVGCGRVLC---DDKKDTMIMCSYWPPGNY

Sequence 1 LGAKIYEIKK
           ---K-Y----
Sequence 2 ENQKPY----



Alignment 27
Sequence 1:
Sequence 2: Allergen Glo m 5, Sequence: AAF82096
Sequence identity: 22.86 (16/70)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MNFVLATLSLLILGSAAVGGDYCGLCDNHDACVMQNVFQSGCPSGAKMID

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LNKYQSALLDAHNKKRNHVAGGGESKLKRACQMATMKWDSELAKLAEYNV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KQCQMNHDRCRNTVKFKYAGQNLAELGRSGGPPPDYRKLIEKAVDKWYEE

Sequence 1 ----DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWT
           --------I-S-P--------IGH-T--V-------GC------------
Sequence 2 VKDCNQGYIDSYPMNYRG-PAIGHFTVMVAERNTHVGCAASEYTKSNGFQ

Sequence 1 KHYLVCNYGPAGNVLGAKIYEIKK--------------------------
           -----CNY----N-----IY------------------------------
Sequence 2 YFLMACNYATT-NMMEFPIYKSCGSSAQDCKSGKNSKYPNLCSPNEKYEV

Sequence 1 -----------
           -----------
Sequence 2 NKWIKNGVEYH


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.