The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Amb a 2

Sequence P27762

Full FASTA alignment

Sequence name:
Query sequence:
MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
YGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIHV
TGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGASD
THFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAIGG
SSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWRTQNDVLENG
AIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Amb a 2P27762Go!397602.49.4e-174
2Amb a 1P27760Go!398431.42.7e-122
3Amb a 1AAA32669Go!397422.01.9e-119
4Amb a 1P27761Go!397422.01.9e-119
5Amb a 1P27759Go!396394.04.9e-111
6Amb a 1P28744Go!392364.34.3e-102
7Art v 6.0101AY904433Go!396356.87.7e-100
8Cha o 1Q96385Go!375246.51.2e-66
9Cry j 1.0101P18632Go!374241.83.1e-65
10Cry j 1.0103BAB86287Go!374241.05.6e-65
11Cry j 1.0102BAA05543Go!374238.43.3e-64
12Jun a 1.010101P81294Go!367236.01.7e-63
13Jun v 1.0101Q9LLT1Go!367234.84.1e-63
14Cup s 1.0102AAF72626Go!367233.59.9e-63
15Cup a 1CAC37790Go!367233.31.1e-62
16Jun v 1.0102AAF80164Go!367233.01.3e-62
17Cup s 1.0104AAF72628Go!367233.01.3e-62
18Cup s 1.0105AAF72629Go!367232.81.5e-62
19Cup s 1.0101AAF72625Go!367232.42.1e-62
20Cup s 1.0103AAF72627Go!367232.22.4e-62
21Jun o 1CAC48400Go!367230.57.9e-62
22Cup a 1Q9SCG9Go!346229.41.6e-61
23Pen c 32.0101ABM60783Go!29060.41.0e-10

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Amb a 2, Sequence: P27762
Sequence identity: 100.00 (397/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
Sequence 2 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
Sequence 2 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
Sequence 2 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV

Sequence 1 YGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIHV
           YGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIHV
Sequence 2 YGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIHV

Sequence 1 TGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGASD
           TGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGASD
Sequence 2 TGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGASD

Sequence 1 THFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAIGG
           THFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAIGG
Sequence 2 THFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAIGG

Sequence 1 SSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWRTQNDVLENG
           SSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWRTQNDVLENG
Sequence 2 SSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWRTQNDVLENG

Sequence 1 AIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC
           AIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC
Sequence 2 AIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC



Alignment 2
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: P27760
Sequence identity: 70.78 (281/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVD-ILPSPNDTRRSLQGCEAHN
           MGIKHCCYILYFTLALVTL-Q--R--E-V---LPS-N-TRRSL--CEAHN
Sequence 2 MGIKHCCYILYFTLALVTLLQPVRSAEDVEEFLPSANETRRSLKACEAHN

Sequence 1 IIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVV
           IIDKCWRCK-DWA-NRQAL--CAQGF-K-T-GGK-GD-Y-VTSD-DDDV-
Sequence 2 IIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVA

Sequence 1 NPKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVEL
           NPKEGTLRF-A-Q-RPLWIIF-R-M-I-L-QE-VV-SDKTIDGRG-KV--
Sequence 2 NPKEGTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNI

Sequence 1 VYGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIH
           V--G-TLMNVKN-IIHNI-IHD--V-PGG-IKSN-GP-I-R-QSDGDAI-
Sequence 2 VNAGLTLMNVKNIIIHNINIHDIKVCPGGMIKSNDGPPILRQQSDGDAIN

Sequence 1 VTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGAS
           V-GSS-IWIDHC-LSK--DGL-D---GS--VT-SNCKFT-H----LLGA-
Sequence 2 VAGSSQIWIDHCSLSKASDGLLDITLGSSHVTVSNCKFTQHQFVLLLGAD

Sequence 1 DTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAIG
           DTH-QD--M--T-A-N-FT--V--RMPRCRFGFFQ-VNN-YDRW--YAIG
Sequence 2 DTHYQDKGMLATVAFNMFTDHVDQRMPRCRFGFFQVVNNNYDRWGTYAIG

Sequence 1 GSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWRTQNDVLEN
           GSS-PTILSQGN-F-APD-I-KKNV--RTG----E-M-WNWRT--D-LEN
Sequence 2 GSSAPTILSQGNRFFAPDDIIKKNVLARTGTGNAESMSWNWRTDRDLLEN

Sequence 1 GAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC
           GAIF--SGSDPVLT-EQ-AGM--AEPG--V--LT--AGVL-C--GAPC
Sequence 2 GAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLSCHQGAPC



Alignment 3
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: AAA32669
Sequence identity: 70.78 (281/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEV-DILPSPNDTRRSLQGCEAHN
           MGIK-CCYILYFTLALV-L-Q--R--E-V--ILPS-N-TR-SLQ-CEA-N
Sequence 2 MGIKQCCYILYFTLALVALLQPVRSAEGVGEILPSVNETR-SLQACEALN

Sequence 1 IIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVV
           IIDKCWR-K-DW--NRQAL--CAQGF-K-T-GGKWGD-Y-VTS--DDDV-
Sequence 2 IIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVA

Sequence 1 NPKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVEL
           NPKEGTLRF-A-Q-RPLWIIF--DM-I-L-QE-VV-SDKTIDGRG-KVE-
Sequence 2 NPKEGTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEI

Sequence 1 VYGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIH
           --GG-TLMNVKN-IIHNI-IHDV-VLPGG-IKSN-GP-I-R--SDGD-I-
Sequence 2 INGGLTLMNVKNIIIHNINIHDVKVLPGGMIKSNDGPPILRQASDGDTIN

Sequence 1 VTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGAS
           V-GSS-IWIDHC-LSKSFDGLVDV--GST-VTISNCKFT---KA-LLGA-
Sequence 2 VAGSSQIWIDHCSLSKSFDGLVDVTLGSTHVTISNCKFTQQSKAILLGAD

Sequence 1 DTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAIG
           DTH-QD--M--T-A-N-FT--V--RMPRCRFGFFQ-VNN-YDRW--YAIG
Sequence 2 DTHVQDKGMLATVAFNMFTDNVDQRMPRCRFGFFQVVNNNYDRWGTYAIG

Sequence 1 GSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWRTQNDVLEN
           GSS-PTIL-QGN-F-APD---KKNV--RTG----E-M-WNWR---D-LEN
Sequence 2 GSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMAWNWRSDKDLLEN

Sequence 1 GAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC
           GAIFV-SGSDPVLT--Q-AGM--AEPG-----LT--AGV--C-PGAPC
Sequence 2 GAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFSCRPGAPC



Alignment 4
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: P27761
Sequence identity: 70.78 (281/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEV-DILPSPNDTRRSLQGCEAHN
           MGIK-CCYILYFTLALV-L-Q--R--E-V--ILPS-N-TR-SLQ-CEA-N
Sequence 2 MGIKQCCYILYFTLALVALLQPVRSAEGVGEILPSVNETR-SLQACEALN

Sequence 1 IIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVV
           IIDKCWR-K-DW--NRQAL--CAQGF-K-T-GGKWGD-Y-VTS--DDDV-
Sequence 2 IIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVA

Sequence 1 NPKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVEL
           NPKEGTLRF-A-Q-RPLWIIF--DM-I-L-QE-VV-SDKTIDGRG-KVE-
Sequence 2 NPKEGTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEI

Sequence 1 VYGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIH
           --GG-TLMNVKN-IIHNI-IHDV-VLPGG-IKSN-GP-I-R--SDGD-I-
Sequence 2 INGGLTLMNVKNIIIHNINIHDVKVLPGGMIKSNDGPPILRQASDGDTIN

Sequence 1 VTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGAS
           V-GSS-IWIDHC-LSKSFDGLVDV--GST-VTISNCKFT---KA-LLGA-
Sequence 2 VAGSSQIWIDHCSLSKSFDGLVDVTLGSTHVTISNCKFTQQSKAILLGAD

Sequence 1 DTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAIG
           DTH-QD--M--T-A-N-FT--V--RMPRCRFGFFQ-VNN-YDRW--YAIG
Sequence 2 DTHVQDKGMLATVAFNMFTDNVDQRMPRCRFGFFQVVNNNYDRWGTYAIG

Sequence 1 GSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWRTQNDVLEN
           GSS-PTIL-QGN-F-APD---KKNV--RTG----E-M-WNWR---D-LEN
Sequence 2 GSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMAWNWRSDKDLLEN

Sequence 1 GAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC
           GAIFV-SGSDPVLT--Q-AGM--AEPG-----LT--AGV--C-PGAPC
Sequence 2 GAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFSCHPGAPC



Alignment 5
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: P27759
Sequence identity: 67.51 (268/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEV-DILPSPNDTRRSLQGCEAHN
           MGIKHCCYILYFTLALVTL-Q--R--E----ILP--N-TRR-L----A-N
Sequence 2 MGIKHCCYILYFTLALVTLLQPVRSAEDLQEILPV-NETRR-LTTSGAYN

Sequence 1 IIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVV
           IID-CWR-K-DWAENR-AL--CAQGFGK-T-GGK-GDIY-VTS--DDDV-
Sequence 2 IIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVA

Sequence 1 NPKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVEL
           NPKEGTLRFGA-Q-RPLWIIF-RDM-I-L--EMVV-SDKTIDGRGAKVE-
Sequence 2 NPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEI

Sequence 1 VYGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIH
           ---G-TL--VKNVIIHNI--HDV-V-PGG-IKSN-GPA-PR--SDGDAI-
Sequence 2 INAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAIS

Sequence 1 VTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGAS
           --GSS-IWIDHC-LSKS-DGLVD---G-T--T-SN--FT-H----L-GA-
Sequence 2 ISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAG

Sequence 1 DTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAIG
           D----D--M--T-A-N-FT--V--RMPRCR-GFFQ-VNN-YD-W--YAIG
Sequence 2 DENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAIG

Sequence 1 GSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWRTQNDVLEN
           GS--PTILSQGN-F-APD---KKNV--R-G----E-M-WNWRT--DVLEN
Sequence 2 GSASPTILSQGNRFCAPDERSKKNVLGRHGEAAAESMKWNWRTNKDVLEN

Sequence 1 GAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC
           GAIFVASG-DPVLT-EQ-AGM--AEPG-----LT--AGVL-C-PGAPC
Sequence 2 GAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC



Alignment 6
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: P28744
Sequence identity: 62.22 (247/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVD-ILPSPNDTRRSLQGCEAHN
           MGIKHCCYILYFTLALVTL-Q--R--E----ILPS-N-TR-SL--C---N
Sequence 2 MGIKHCCYILYFTLALVTLLQPVRSAEDLQQILPSANETR-SLTTCGTYN

Sequence 1 IIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVV
           IID-CWR-K-DWAENR-AL--CAQGF-K-T-GGK-GDIY-VTS--DDDV-
Sequence 2 IIDGCWRGKADWAENRKALADCAQGFAKGTIGGKDGDIYTVTSELDDDVA

Sequence 1 NPKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVEL
           NPKEGTLRFGA-Q-RPLWIIF-RDM-I-L--E-----DKTIDGRGAKVE-
Sequence 2 NPKEGTLRFGAAQNRPLWIIFARDMVIRLDRELAINNDKTIDGRGAKVEI

Sequence 1 VYGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIH
           ---G----NVKN-IIHNI--HD--V-PGG-IKS--GP--PR--SDGDAI-
Sequence 2 INAGFAIYNVKNIIIHNIIMHDIVVNPGGLIKSHDGPPVPRKGSDGDAIG

Sequence 1 VTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGAS
           --G-S-IWIDHC-LSK--DGL-D---GST--T-SNC-FT-H----L----
Sequence 2 ISGGSQIWIDHCSLSKAVDGLIDAKHGSTHFTVSNCLFTQHQYLLLFW--

Sequence 1 DTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAIG
           ---F----M--T-A-N-FT--V--RMP--R-GF-Q-VNN-Y-RW--YA-G
Sequence 2 --DFDERGMLCTVAFNKFTDNVDQRMPNLRHGFVQVVNNNYERWGSYALG

Sequence 1 GSSNPTILSQGNKFVAPDFIYKKNVCLRTG-AQEPEWMTWNWRTQNDVLE
           GS--PTILSQGN-F-A-D---KK-V--R-G-----E---WNWR---DV-E
Sequence 2 GSAGPTILSQGNRFLASDI--KKEVVGRYGESAMSESINWNWRSYMDVFE

Sequence 1 NGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC
           NGAIFV-SG-DPVLT-EQNAGM--AEPG--V--LT--AGVL-C-PGAPC
Sequence 2 NGAIFVPSGVDPVLTPEQNAGMIPAEPGEAVLRLTSSAGVLSCQPGAPC



Alignment 7
Sequence 1:
Sequence 2: Allergen Art v 6.0101, Sequence: AY904433
Sequence identity: 59.95 (238/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGR--LGEEVDILPSPNDTRRSLQGCEAH
           ---KH------FT-A-V----A-R---G-E-------N-TRR-L--C-AH
Sequence 2 -MEKHY-FVILFTAAFVFVGAAARADIGDELEA-AQFNSTRRGLHECAAH

Sequence 1 NIIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDV
           NIIDKCWRCK-DW--NRQAL--CAQGF-K-T-GG--G-IY-VT---DD--
Sequence 2 NIIDKCWRCKADWEKNRQALAKCAQGFAKGTTGGLGGEIYVVTDCSDDNA

Sequence 1 VNPKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVE
           -NPK-GTLR-G-TQD-PLWIIF--DM-I-L--E-V---DKTIDGRGA-VE
Sequence 2 ANPKPGTLRCGVTQDKPLWIIFKKDMVIKLKHELVINKDKTIDGRGANVE

Sequence 1 LVYGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAI
           ---GG-T--NV-NVIIHNI-IHD--V--GG-IK--------RH-SDGD-I
Sequence 2 ITCGGLTIHNVCNVIIHNIHIHDIKVTEGGIIKATDAKPGHRHKSDGDGI

Sequence 1 HVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLGA
           -V-GSS-IWIDHCTLS---DGL-DV--GST-VTISNCKF-HH-K--LLGA
Sequence 2 CVAGSSKIWIDHCTLSHGPDGLIDVTLGSTAVTISNCKFSHHQKILLLGA

Sequence 1 SDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYAI
           ---H--D-KMHVT-A-N-F------RMPRCRFGFFQ-VNN-Y--W--YAI
Sequence 2 DNSHVDDKKMHVTVAFNRFAEACDQRMPRCRFGFFQVVNNDYTSWGTYAI

Sequence 1 GGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWRTQNDVLE
           GGS-NPTILSQGN-F-AP----KKNV--R--A---E-M-WNWR---D-LE
Sequence 2 GGSANPTILSQGNRFHAPNDPMKKNVLVRADAPHTESMKWNWRSEKDLLE

Sequence 1 NGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC
           NGAIFVASG-DP-LT-EQ------AEPG--V-QLT--AG-L-C-PG-PC
Sequence 2 NGAIFVASGCDPHLTPEQKSHLIPAEPGSAVLQLTSCAGTLKCVPGKPC



Alignment 8
Sequence 1:
Sequence 2: Allergen Cha o 1, Sequence: Q96385
Sequence identity: 43.07 (171/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MASCTLLAVLVFLCAIVSCFSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--CA-GFG----GGK-G--Y-VTS--DDD-VN
Sequence 2 IDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSS-DDDPVN

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT--R-LWIIF-----I-L---------KTIDGRGA-V---
Sequence 2 PAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIG

Sequence 1 YGG--ITLMNVKNVIIHNIDIHDVRV-LPGGRIKSNGGPAIPRHQSDGDA
           -GG-------V--VI-H---IH-------G----S------P-H--DGDA
Sequence 2 NGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDA

Sequence 1 IHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLG
           I------D-WIDH--LS-S-DGLVDV---STGVTISN--F--H-K--LLG
Sequence 2 ITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLG

Sequence 1 ASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYA
           -SD----D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--YA
Sequence 2 HSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYA

Sequence 1 IGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQNDV
           IGGSSNPTILS-GN-F-AP----KK-V--R-G---P-----W-WR---D-
Sequence 2 IGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDS

Sequence 1 LENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAP
           --NGA-FV-SG---------N------E-G---PQLT-NAGVLTC----P
Sequence 2 FNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKP

Sequence 1 C-
           C-
Sequence 2 CS



Alignment 9
Sequence 1:
Sequence 2: Allergen Cry j 1.0101, Sequence: P18632
Sequence identity: 43.32 (172/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MDSPCLVALLVLSFVIGSCFSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----WA-NR--L--CA-GFG--T-GGK-GD-Y-VT---DDD-VN
Sequence 2 IDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVT-NSDDDPVN

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT-DRPLWIIF---M-I-L---M-----KT-DGRGA-V---
Sequence 2 PAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIG

Sequence 1 YGG--ITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAI-PRHQSDGDA
           -GG-------V-NVIIH------------G----N------P-H--DGDA
Sequence 2 NGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDA

Sequence 1 IHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLG
           --------IWIDH---S-S-DGLVDV---STGVTISN--F--H-K--LLG
Sequence 2 LTLRTATNIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLG

Sequence 1 ASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYA
           --D----D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--YA
Sequence 2 HDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHVANNNYDPWTIYA

Sequence 1 IGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMT-WNWRTQNDV
           IGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-W----DV
Sequence 2 IGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQDV

Sequence 1 LENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAP
           --NGA-FV-SG----------------E-G---PQLT-NAGVLTCS----
Sequence 2 FYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKR

Sequence 1 C
           C
Sequence 2 C



Alignment 10
Sequence 1:
Sequence 2: Allergen Cry j 1.0103, Sequence: BAB86287
Sequence identity: 43.32 (172/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MDSPCLVALLVFSFVIGSCFSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----WA-NR--L--CA-GFG--T-GGK-GD-Y-VT---DDD-VN
Sequence 2 IDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVT-NSDDDPVN

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT-DRPLWIIF---M-I-L---M-----KT-DGRGA-V---
Sequence 2 PAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIG

Sequence 1 YGG--ITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAI-PRHQSDGDA
           -GG-------V-NVIIH------------G----N------P-H--DGDA
Sequence 2 NGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDA

Sequence 1 IHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLG
           --------IWIDH---S-S-DGLVDV---STGVTISN--F--H-K--LLG
Sequence 2 LTLRTATNIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLG

Sequence 1 ASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYA
           --D----D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--YA
Sequence 2 HDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHVANNNYDPWTIYA

Sequence 1 IGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMT-WNWRTQNDV
           IGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-W----DV
Sequence 2 IGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQDV

Sequence 1 LENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAP
           --NGA-FV-SG----------------E-G---PQLT-NAGVLTCS----
Sequence 2 FYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKR

Sequence 1 C
           C
Sequence 2 C



Alignment 11
Sequence 1:
Sequence 2: Allergen Cry j 1.0102, Sequence: BAA05543
Sequence identity: 42.82 (170/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MDSPCLVALLVFSFVIGSCFSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----WA-NR--L--CA-GFG--T-GGK-GD-Y-VT---DDD-VN
Sequence 2 IDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVT-NSDDDPVN

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT-DRPLWIIF---M-I-L---M-----KT-DGRGA-V---
Sequence 2 PAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIG

Sequence 1 YGG--ITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAI-PRHQSDGDA
           -GG-------V-NVIIH------------G----N------P-H--DGDA
Sequence 2 NGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDA

Sequence 1 IHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLLG
           --------IWIDH---S-S-DGLVDV---STGVTISN--F--H-K---LG
Sequence 2 LTLRTATNIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMSLG

Sequence 1 ASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKYA
           --D----D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--YA
Sequence 2 HDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHVANNNYDPWTIYA

Sequence 1 IGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMT-WNWRTQNDV
           IGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-W----DV
Sequence 2 IGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQDV

Sequence 1 LENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAP
           --NGA-FV-SG----------------E-G---P-LT-NAGVLTCS----
Sequence 2 FYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPHLTQNAGVLTCSLSKR

Sequence 1 C
           C
Sequence 2 C



Alignment 12
Sequence 1:
Sequence 2: Allergen Jun a 1.010101, Sequence: P81294
Sequence identity: 42.57 (169/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MASPCLIAVLVFLCAIVSCYSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--CA-GFG--T-GGK-GD-Y-VTS--DD--VN
Sequence 2 IDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTST-DDNPVN

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG-------V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKVSHVILHSLHIHGCNTSVL-GDVLVSESIGVEPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV--GSTG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---P-----W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-T-----
Sequence 2 AFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVVT-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 13
Sequence 1:
Sequence 2: Allergen Jun v 1.0101, Sequence: Q9LLT1
Sequence identity: 42.07 (167/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MASPCLIAFLVFLCAIVSCCSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--CA-GFG--T-GGK-GD-Y-VTS--DD--VN
Sequence 2 IDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTS-ADDNPVN

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG-------V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKVSHVILHGLHIHGCNTSVL-GDVLVSESIGVVPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV--GSTG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-------
Sequence 2 AFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVA-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 14
Sequence 1:
Sequence 2: Allergen Cup s 1.0102, Sequence: AAF72626
Sequence identity: 41.81 (166/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MDSPCLIAVLVFLCAIVSCYSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--CA-GFG--T-GGK-GDIY-VTS--D--V-N
Sequence 2 IDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTVTSAEDNPV-N

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKALWIIFSQNMNIKLEMPLYVAGHKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG-------V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKVSHVILHGLHIHGCNTSVL-GDVLVSESIGVEPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV---STG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-------
Sequence 2 AFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLTKNAGVVA-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 15
Sequence 1:
Sequence 2: Allergen Cup a 1, Sequence: CAC37790
Sequence identity: 42.07 (167/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MASPCLVAVLVFLCAIVSCYSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--C--GFG--T-GGK-G-IY-VTS--DD--VN
Sequence 2 IDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSS-DDNPVN

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-LQ----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG----------VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRTASHVILHGLHIHGCNTSVL-GDVLVSESIGVEPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV--GSTG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDISMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRFTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-T-----
Sequence 2 AFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVVT-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 16
Sequence 1:
Sequence 2: Allergen Jun v 1.0102, Sequence: AAF80164
Sequence identity: 41.81 (166/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MASPCLIAFLVFLCAIVSCCSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--CA-GFG--T-GGK-GD-Y-VTS--DD--VN
Sequence 2 IDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTS-ADDNPVN

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG-------V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKVSHVILHGLHIHGCNTSVL-GDVLVSESIGVVPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV--GSTG-TI-N--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITIFNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-------
Sequence 2 AFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVA-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 17
Sequence 1:
Sequence 2: Allergen Cup s 1.0104, Sequence: AAF72628
Sequence identity: 41.81 (166/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MDSPCLIAVLVFLCAIVSCYSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--CA-GFG--T-GGK-GDIY-VTS--D--V-N
Sequence 2 IDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTVTSAEDNPV-N

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG-------V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKVSHVILHGLHIHGCNTSVL-GNVLVSESIGVEPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV---STG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTG-AQEPEWMTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFAAPNENYKKEVTKRIGCVSTSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-------
Sequence 2 AFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLTKNAGVVA-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 18
Sequence 1:
Sequence 2: Allergen Cup s 1.0105, Sequence: AAF72629
Sequence identity: 41.81 (166/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MDSPCLIAVLVFLCAIVSCYSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--CA-GFG--T-GGK-GDIY-VTS--D--V-N
Sequence 2 IDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTVTSAEDNPV-N

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG-------V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKVSHVILHGLHIHGCNTSVL-GNVLVSESIGVEPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV---STG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTG-AQEPEWMTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFAAPNENYKKEVTKRIGCVSTSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-------
Sequence 2 AFSNGAYFVSSGKTEETNIYTSNEAFKVENGNLAPQLTKNAGVVA-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 19
Sequence 1:
Sequence 2: Allergen Cup s 1.0101, Sequence: AAF72625
Sequence identity: 41.56 (165/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MDSPCLIAVLVFLCAIVSCYSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--CA-GFG--T-GGK-GDIY--TS--D--V-N
Sequence 2 IDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTATSAEDNPV-N

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG-------V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKVSHVILHGLHIHGCNTSVL-GDVLVSESIGVEPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV---STG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFAAPNENYKKEVTKRIGCESTSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-------
Sequence 2 AFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLTKNAGVVA-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 20
Sequence 1:
Sequence 2: Allergen Cup s 1.0103, Sequence: AAF72627
Sequence identity: 41.56 (165/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MDSPCLIAVLVFLCAIVSCYSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--CA-GFG--T-GGK-GDIY-VTS--D--V-N
Sequence 2 IDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTVTSAEDNPV-N

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG-------V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKVSHVILHGLHIHSCNTSVL-GDVLVSESIGVEPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--L----DGL-DV---STG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLPDCSDGLIDVTLSSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-------
Sequence 2 AFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLTKNAGVVA-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 21
Sequence 1:
Sequence 2: Allergen Jun o 1, Sequence: CAC48400
Sequence identity: 41.56 (165/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           -------------------------------L------------C---N-
Sequence 2 --------------------------MASPCLRAVLVFLCAIVSCYSDNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--C--GFG--T-GGK-G--Y-VTS--D--V-N
Sequence 2 IDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGEFYTVTSAEDNPV-N

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG

Sequence 1 YGG--ITLMNVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG-------V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKVSHVILHGLHIHGCNTSVL-GDVLVSESIGVEPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV--GSTG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDNDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-T-----
Sequence 2 AFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVT-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 22
Sequence 1:
Sequence 2: Allergen Cup a 1, Sequence: Q9SCG9
Sequence identity: 41.56 (165/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           ------------------------------------------------N-
Sequence 2 -----------------------------------------------DNP

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           ID-CWR----W--NR--L--C--GFG--T-GGK-G-IY-VTS--D--V-N
Sequence 2 IDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPV-N

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           P--GTLR-GAT----LWIIF---M-I-LQ----V---KTIDGRGA-V-L-
Sequence 2 PTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLG

Sequence 1 YGGITLMNVK--NVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD
           -GG--L---K---VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 NGGPCLFMRKASHVILHGLHIHGCNTSVL-GDVLVSESIGVEPVHAQDGD

Sequence 1 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL
           AI--------WIDH--LS---DGL-DV--GSTG-TISN--F--H-K--LL
Sequence 2 AITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLL

Sequence 1 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIY

Sequence 1 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRD

Sequence 1 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-------
Sequence 2 AFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA-----

Sequence 1 PC
           --
Sequence 2 --



Alignment 23
Sequence 1:
Sequence 2: Allergen Pen c 32.0101, Sequence: ABM60783
Sequence identity: 15.87 (63/397)
Sequence 1 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN
           -------------------------------G--------T---------
Sequence 2 -------------------------VGDVATGYASENGGTTGGSGGTTTT

Sequence 1 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV
           ---------A---------F----I--------V-S---I-G------L-
Sequence 2 VSSYAAFTEAVSGDDAKVVFVSGKISKTADQARVGSNTSIIGKDSNAILS

Sequence 1 YGGITLMNVKNVIIHNIDIHDVRVLPGGRIKSNGGPAIPRHQSDGDAIHV
           --G-------NVII-N-------VL-------------------GDAI--
Sequence 2 GFGVLVKEASNVIIRNLGVE--KVLA----------------DNGDAIGI

Sequence 1 TGSSDIWIDHCTLSKS-------FDGLVDVNWGSTGVTISNCKFTHHEKA
           --S---W-DHC--S----------DGL-D-------VT-SN-----H-KA
Sequence 2 QKSNNVWVDHCDVSSDRDHDKDYYDGLIDITHAADYVTVSNTSIHDHWKA

Sequence 1 VLLGASDTHFQDLK--MHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYD
           -L-G-SD------K---HVTL--N---N----R-P--RFG-----N--Y-
Sequence 2 CLIGHSDSNGDEDKGHLHVTLNNNYWYN-INSRGPSFRFGTGHVYNSYYL

Sequence 1 RWDKYAIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMTWNWR
           ----------------------------Y------------------N--
Sequence 2 DMSDGINTRQGAQHLVESNTFSGSKKPLYSTDDGYAVANDNDFGDGENNA

Sequence 1 TQNDVLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTC
           ---------------GS--V--A---------------------------
Sequence 2 EKGTLTSVPYSYDLVGSGKVKDAVVGTAGQTLTF----------------

Sequence 1 SPGAPC
           ------
Sequence 2 ------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.