The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ory s 1

Sequence 11346546

Full FASTA alignment

Sequence name:
Query sequence:
VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
DVIPLNWTPNTFYRSFVQYSS

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ory s 1AAF72989Go!271401.11.7e-113
2Ory s 1AAF72985Go!286277.52.9e-76
3Ory s 1AAF72987Go!275271.91.3e-74
4Ory s 1AAF72984Go!268261.02.6e-71
5Ory s 1AAF72988Go!327251.42.5e-68
6Ory s 1AAB61710Go!261234.82.0e-63
7Tri a ps93AAD10496Go!271215.01.8e-57
8Ory s 1AAF72990Go!269214.62.4e-57
9Zea m 1P58738Go!269213.35.8e-57
10Pas n 1.0101ACA23876Go!265207.33.6e-55
11Ory s 1AAF72991Go!267207.33.6e-55
12Ory s 1AAF72983Go!267200.93.1e-53
13Phl p 1P43213Go!263193.55.2e-51
14Phl p 1.0101CAA81613Go!263191.61.9e-50
15Poa p aCAA10520Go!263191.42.2e-50
16Hol l 1CAA10140Go!263191.22.5e-50
17Lol p 1.0103CAB63699Go!263190.06.0e-50
18Lol p 1.0102AAA63278Go!252189.67.7e-50
19Hol l 1.0102CAA93121Go!248188.91.2e-49
20Lol p 1.0101AAA63279Go!263188.71.4e-49
21Hol l 1P43216Go!265188.71.4e-49
22Lol p 1P14946Go!263187.53.3e-49
23Pha a 1Q41260Go!269187.14.5e-49
24Cyn d 1.0204AAF80379Go!244185.01.7e-48
25Cyn d 1.0201AAK96255Go!244184.82.0e-48
26Cyn d 1.0203AAL14079Go!262184.82.1e-48
27Cyn d 1.0202AAL14077Go!262184.82.1e-48
28Cyn d 1AAL14078Go!262184.62.5e-48
29Cyn d 1O04701Go!246179.86.3e-47
30Sor h 1.0101ABC58726Go!239178.41.7e-46
31Gly m 2AAA50175Go!277177.43.8e-46
32Ory s 1AAF72986Go!275173.55.7e-45
33Zea m 1Q07154Go!191170.23.8e-44
34Ory s 1Q40638Go!263167.53.5e-43
35Ara t expansinCAB37496Go!26598.12.7e-22
36Ory s 1AAG13596Go!27585.22.2e-18
37Ory s 1BAA85432Go!28485.02.6e-18
38Cyn d 2CAA10346Go!12254.51.7e-09
39Dac g 2CAA10345Go!12254.12.2e-09
40Poa p 2CAA10348Go!12254.12.2e-09
41Phl p 2P43214Go!12254.12.2e-09
42Lol p 2P14947Go!9748.21.0e-07
43Dac g 3P93124Go!9644.91.0e-06
44Lol p 2CAA51775Go!8844.31.5e-06
45Phl p 3.01012JNZ_AGo!10843.53.0e-06
46Cyn d 15AAP80171Go!11242.56.4e-06
47Lol p 3P14948Go!9739.34.9e-05
48Tri a 3CAA90746Go!11836.93.1e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72989
Sequence identity: 100.00 (271/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
Sequence 2 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
Sequence 2 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
Sequence 2 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
Sequence 2 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
Sequence 2 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           DVIPLNWTPNTFYRSFVQYSS
Sequence 2 DVIPLNWTPNTFYRSFVQYSS



Alignment 2
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72985
Sequence identity: 65.31 (177/271)
Sequence 1 ------------VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIG
           -------------------------------------G-G---N-S-A--
Sequence 2 MGSLSSLAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAV

Sequence 1 GAAAWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLY
           ----W--A-ATWYGQPNGAG--DNGGACGFK--NQYPFM-MTSCGNQPL-
Sequence 2 YWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLF

Sequence 1 KGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFG
           K-GKGCGSCY--RC-----CSG---TV-ITDMNY-P----HFDLSG-AFG
Sequence 2 KDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFG

Sequence 1 RLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLV
           RLAKPG--D-LR--GIID--F-RVPCEFPGLK-GFHVEE-S-PVY-AVLV
Sequence 2 RLAKPGLNDKLRHSGIIDIEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLV

Sequence 1 EYENGDGDVAQVDLKEA----GAGGGRWTPMRESWGSVWRLDSNHRLRAP
           EYE-GDGDV-QVDL-E-----G---G-WTPMRESWGS-WRLD-NHRL-AP
Sequence 2 EYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRLDTNHRLQAP

Sequence 1 FSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS
           FSIRIR--SGKTLVA--VIP-NW-PNTFYRSFVQYS-
Sequence 2 FSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS-



Alignment 3
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72987
Sequence identity: 65.68 (178/271)
Sequence 1 -------VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAW
           ---------------L-VLVV---CKG----------YN-S-A------W
Sequence 2 MAARMGSKVAAILAILSVLVVHGSCKGHPVN------YNVSDASAYGSGW

Sequence 1 GNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKG
           --A-ATWYG-P-GAG--DNGGACGFK-VNQYPF--MTSCGN-P--K-GKG
Sequence 2 LPARATWYGAPTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKG

Sequence 1 CGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKP
           CGSCY--RCN--P-CSGN--TV-ITDMNY-P---YHFDLSG-AFG--AKP
Sequence 2 CGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKP

Sequence 1 GRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENG
           G--D-LR--GIID-QF-RVPC--PGLK--FHVEEGS-PVY-AVLVEYE--
Sequence 2 GLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYFAVLVEYEDL

Sequence 1 DGDVAQVDLKEA----GAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRI
           DGDV-QVDL-E-----G---G-WTPMRESWGS-WRLDSNHRL-APFS-RI
Sequence 2 DGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRI

Sequence 1 RSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS
           RSDSGKTLVA--VIP-NW-PN--YRS-VQ-S-
Sequence 2 RSDSGKTLVANNVIPANWSPNSNYRSIVQFS-



Alignment 4
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72984
Sequence identity: 61.99 (168/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           -----------------------V-G----------------W--A-ATW
Sequence 2 -MAFSISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPNWEVARATW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--D-GGACGFK--NQYPF--MTSCGN-P--K-GKGCGSCY--
Sequence 2 YGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           RC---PACSGN--TV-ITDMNY-P-S-YHFDLSG-AFG--AKPG--D-LR
Sequence 2 RCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLR

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           -AGIID-QF-RVPC-FPGLKV-FHVEEGS-PVY-AVLVEYE-GDGDV-QV
Sequence 2 HAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           DL-EA------WTPMRESWGS-WRLDSNHRL-APFS-RI---SGK-LVA-
Sequence 2 DLMEANSQS--WTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVAS

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           -VIP-NW-P---YRSFVQYSS
Sequence 2 QVIPANWAPMAVYRSFVQYSS



Alignment 5
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72988
Sequence identity: 60.15 (163/271)
Sequence 1 -------------------------------------------------V
           --------------------------------------------------
Sequence 2 MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSS

Sequence 1 GVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWY
           -----------V--------------G---------GG---W-NA-ATWY
Sequence 2 SNSSTPSIPPPVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWY

Sequence 1 GQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVR
           G-PNGAG--DNGGACGFK-VN--PF--MTSCGN-PL-K-GKGCGSCY--R
Sequence 2 GAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIR

Sequence 1 CNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRR
           C---PACSG---TV-ITDMNY-P-S-YHFDLSG-AFG--AK--R-D-LR-
Sequence 2 CVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRH

Sequence 1 AGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVD
           AGIID-QF-RVPC--PGL-V-FHVE-GS-PVY-A-LVEYENGDGDV-QVD
Sequence 2 AGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVD

Sequence 1 LKEA--GAGG------GRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDS
           L-E-----GG------G-WTPMRESWGS-WRLD-NH-L--PFS-RI---S
Sequence 2 LMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES

Sequence 1 GKTLVAPDVIPLNWTPNTFYRSFVQYSS
           GKTL-A--VIP--W-PNT-Y-S-VQ---
Sequence 2 GKTLIADQVIPADWQPNTVYSSIVQFD-



Alignment 6
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAB61710
Sequence identity: 56.09 (152/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ------------------K-----------Y-----------W--AKATW
Sequence 2 ------------MAGASAKVVAMLLSVLATYGFAAGVVYTNDWLPAKATW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YGQPNGAG--DNGGACGFK--NQYPFM-MTSCGN-PL---GKGCG-CY--
Sequence 2 YGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           RC--NP-CSG---TV-ITDMNY-P---YHFDLSG-AFG--A-PG--D-LR
Sequence 2 RCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLR

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           -AGIID-QF-RVPC---GL-V-FHVE-GS-PVYLAVLVE--N-DG-V-Q-
Sequence 2 HAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQL

Sequence 1 DLKEAGAGGG--R-WTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTL
           D--E----G---R-WTPMR-SWGS-WRLD-NHRL--P-S-R--S-SG-T-
Sequence 2 DVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTV

Sequence 1 VAPDVIPLNWTPNTFYRSFVQYSS
           -A--VIP-NW--NT-Y-S-VQ---
Sequence 2 IAHQVIPANWRANTNYGSKVQFR-



Alignment 7
Sequence 1:
Sequence 2: Allergen Tri a ps93, Sequence: AAD10496
Sequence identity: 51.29 (139/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------V---------------Y----A------W--AKATW
Sequence 2 ---MAGVSSNAIALVALLSMLFTSVRSAVNYDTAVARSYTSGWLPAKATW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-PNGAG--DNGGACGFK-VNQYP---M--CGN-P---GG-GCG-CY--
Sequence 2 YGAPNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEI

Sequence 1 RC--NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADD
           -C----NP-CSG------ITDMNY-P---YH-DLSG-AFG--AK-G--D-
Sequence 2 KCEYSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDR

Sequence 1 LRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVA
           LR-AGIID-QF-RVPC-FPG-KV-FHV--GS-P-YLAVLVEY-N-DG-V-
Sequence 2 LRHAGIIDMQFRRVPCNFPGMKVTFHVQRGSNPNYLAVLVEYVNVDGTVV

Sequence 1 QVDLKEAGAG--GGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKT
           ---L-----G---G-W--MR-SWGSVWR-D-N-----PFSIRI-SD-GKT
Sequence 2 RMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKT

Sequence 1 LVAPDVIPLNWTPNTFYRSFVQYSS
           LVA---IP--W-----Y-S--Q---
Sequence 2 LVANNAIPAYWQQDHAYWSNLQFY-



Alignment 8
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72990
Sequence identity: 52.03 (141/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           -G-------L---VV----G--------------------A-W--A-ATW
Sequence 2 MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YGQP-G-G--DNGGACG-K-VN--P--GM-SCGN-P--K-G-GCGSCY-V
Sequence 2 YGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEV

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C----ACS----TV-ITDMNY-P-S-YHFD-SG-AFG--A-PG----LR
Sequence 2 KCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELR

Sequence 1 RAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AGIID-QF-RV-C--PG--KV-FHVE-GS-P-YLAVLV-----DGDV-Q
Sequence 2 KAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQ

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           -DL-EAG-----W-PM--SWG--WR-D----L-APFSIR----SGK-L-A
Sequence 2 MDLQEAGLPA--WRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP-NW-P---Y-S-VQ---
Sequence 2 KDVIPVNWMPDAIYVSNVQFY-



Alignment 9
Sequence 1:
Sequence 2: Allergen Zea m 1, Sequence: P58738
Sequence identity: 52.03 (141/271)
Sequence 1 ------VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWG
           ---------VV---L--LV----C-------G-----N------G---W-
Sequence 2 MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGP----NITTNYNGK--WL

Sequence 1 NAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGC
           -A-ATWYGQPNGAGA-DNGGACG-K-VN--P--GMT-CGN-P--K-GKGC
Sequence 2 TARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGC

Sequence 1 GSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPG
           GSCY-VRC---P-CSGN--TV-ITDMNY-P---YHFDLSG-AFG-LAKPG
Sequence 2 GSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPG

Sequence 1 RADDLRRAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENG
           --D--R--GI-DV-F-RV-C--P-G-K--FH-E-G--P-YLAVLV-Y---
Sequence 2 LNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVAD

Sequence 1 DGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDS
           DGD---------------W-PM--SWG--WR-D----L--PFSIR--S-S
Sequence 2 DGDIVLMEIQDKLSA--EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSES

Sequence 1 GKTLVAPDVIPLNWTPNTFYRSFVQYSS
           GK---A-DVIP-NW-P---Y-S-VQ---
Sequence 2 GKKVIAKDVIPANWRPDAVYTSNVQFY-



Alignment 10
Sequence 1:
Sequence 2: Allergen Pas n 1.0101, Sequence: ACA23876
Sequence identity: 52.03 (141/271)
Sequence 1 -----VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGN
           -------V-V---L--LV----C-------G-----N------G---W--
Sequence 2 MGSLAKIVAVAAVLAALVAGGSCGPPKVPPGP----NITTNYNGK--WLP

Sequence 1 AKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCG
           AKATWYGQPNGAG--DNGGACG-K-VN--P--G-T-CGN-P--K-GKGCG
Sequence 2 AKATWYGQPNGAGPDDNGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCG

Sequence 1 SCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGR
           SCY--RCN--P-CSG---TV-ITDMNY-P---YHFDLSG-AFG--AKPG-
Sequence 2 SCYEIRCNK-PECSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAMAKPGL

Sequence 1 ADDLRRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGD
           -D-LR--GI-D--F-RV-C---G--K--FHVE-GS-P-YLA-LV-----D
Sequence 2 NDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADD

Sequence 1 GDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSG
           GD-----LKE-------W-PM--SWG--WR-D----L--PFSIR--S-SG
Sequence 2 GDIVLMELKEKSSD---WKPMKLSWGAIWRMDTPKALVPPFSIRLTSESG

Sequence 1 KTLVAPDVIPLNWTPNTFYRSFVQYSS
           K---A-DVIP-NW-P-T-Y-S-VQ---
Sequence 2 KKVIAQDVIPVNWKPDTVYNSNVQF--



Alignment 11
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72991
Sequence identity: 48.34 (131/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           -------LLL--VV----------------------------W--A--TW
Sequence 2 --MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-----PF-GM-SCGN-P--K-GKGCGSC--V
Sequence 2 YGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEV

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C----ACS-------ITDMN--P---YHFDLSG-AFG--AK-G----LR
Sequence 2 KCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELR

Sequence 1 RAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AGIID-QF-RV-C--PG--KV-FHVE-GS-P-Y-AVLV-Y--GDGDV--
Sequence 2 KAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVK

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           V-LKE-G-----W-P--ESWG--WR-D----L--PFS-R----S---LVA
Sequence 2 VELKEKGSE--EWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP-NW--N--Y-S--Q---
Sequence 2 NDVIPDNWKANALYKSEIQVD-



Alignment 12
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72983
Sequence identity: 45.39 (123/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           -------LLL--VVV---------------------------W--AKATW
Sequence 2 --MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GM-SCGN-P--K-GKGCGSC---
Sequence 2 YGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C----ACS--------TDMN--P---YHFDLSG-AFG--AK-G----LR
Sequence 2 KCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELR

Sequence 1 RAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AGIID-QF-RV-C--P---K--FH-E--S-P-YLA-LV-Y--GDGDV--
Sequence 2 KAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVE

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           V--KE-G-----W----ESWG--WR-D----L--PFS-R-----G----A
Sequence 2 VEIKEKGSE--EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -D-IP--W-----Y-S-VQ---
Sequence 2 EDAIPDGWKADSVYKSNVQAK-



Alignment 13
Sequence 1:
Sequence 2: Allergen Phl p 1, Sequence: P43213
Sequence identity: 45.76 (124/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------L--VV-------SA-------------------W--AK-TW
Sequence 2 --MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C----ACSG----V-ITD-N--P---YHFDLSG-AFG--AK-G----LR
Sequence 2 KCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLR

Sequence 1 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG----QF-RV-C--P-G-KV-FHVE-GS-P-YLA-LV-Y-NGDGDV--
Sequence 2 SAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----W----ESWG--WR-D----L--PF--R-----G----A
Sequence 2 VDIKEKGKD--KWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y-S------
Sequence 2 EDVIPEGWKADTSYESK-----



Alignment 14
Sequence 1:
Sequence 2: Allergen Phl p 1.0101, Sequence: CAA81613
Sequence identity: 44.65 (121/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------L--V--------SA-------------------W--AK-TW
Sequence 2 --MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P--AG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C----ACSG----V-ITD-N--P---YHFDLSGIAFG--AK-G----LR
Sequence 2 KCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLR

Sequence 1 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG----QF-RV-C--P-G-KV-FHVE-GS-P-YLA-LV----GDGDV--
Sequence 2 SAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----W----ESWG--WR-D----L--PF--R-----G----A
Sequence 2 VDIKEKGKD--KWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y-S------
Sequence 2 KDVIPEGWKADTAYESK-----



Alignment 15
Sequence 1:
Sequence 2: Allergen Poa p a, Sequence: CAA10520
Sequence identity: 44.65 (121/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------L--V---------A-------------------W--AK-TW
Sequence 2 --MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C-----CSG----V-ITD-N--P---YHFDLSG-AFG--AK-G----LR
Sequence 2 KCTKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKLR

Sequence 1 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG-----F-RV-CE-P-G-KV-FHVE-GS-P-YLA-LV-Y--GDGDV--
Sequence 2 SAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----W----ESWGS-WR-D----L--PF--R-----G----A
Sequence 2 VDIKEKGKD--KWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y-S------
Sequence 2 EDVIPEGWKADTAYASK-----



Alignment 16
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: CAA10140
Sequence identity: 44.65 (121/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           -------L-L--V---------A-------------------W--AK-TW
Sequence 2 --MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C-----CSG----V-ITD-N--P---YH-DLSG-AFG--AK-G----LR
Sequence 2 KCTKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLR

Sequence 1 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG-----F-RV-CE-P-G-KV-FHVE-GS-P-YLA-LV-Y--GDGDV--
Sequence 2 SAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----W----ESWG-VWR-D----L--PF--R-----G----A
Sequence 2 VDIKEKGKD--KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y-S------
Sequence 2 EDVIPEGWKADTAYESK-----



Alignment 17
Sequence 1:
Sequence 2: Allergen Lol p 1.0103, Sequence: CAB63699
Sequence identity: 44.28 (120/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------L--V--------SA-------------------W--AK-TW
Sequence 2 --MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C-----CSG-A-TV-ITD-N--P---YHFDLSG-AFG--AK-G----LR
Sequence 2 KCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLR

Sequence 1 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG----QF-RV-C--P-G-K--FHVE--S-P-YLA-LV-Y--GDGDV--
Sequence 2 SAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----W----ESWG-VWR-D----L--PF--R-----G-----
Sequence 2 VDIKEKGKD--KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEV

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y--------
Sequence 2 EDVIPEGWKADTSYSAK-----



Alignment 18
Sequence 1:
Sequence 2: Allergen Lol p 1.0102, Sequence: AAA63278
Sequence identity: 43.17 (117/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------------------SA-------------------W--AK-TW
Sequence 2 -------------ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C-----CSG-A-TV-ITD-N--P---YHFDLSG-AFG--AK-G-----R
Sequence 2 KCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVR

Sequence 1 RAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG----QF-RV-C--P---K--FHVE-GS-P-YLA-LV-Y--GDGDV--
Sequence 2 SAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----W----ESWG-VWR-D----L--PF--R-----G-----
Sequence 2 VDIKEKGKD--KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEV

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y--------
Sequence 2 EDVIPEGWKADTSYSAK-----



Alignment 19
Sequence 1:
Sequence 2: Allergen Hol l 1.0102, Sequence: CAA93121
Sequence identity: 43.54 (118/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------------------SA-------------------W--AK-TW
Sequence 2 -----------------VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C-----CSG---TV-ITD-N--P---YHFDLSG-AFG--AK-G----LR
Sequence 2 KCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLR

Sequence 1 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG-----F-RV-C--P-G-K--FHVE-GS-P-YLA-LV-Y--GDGDV--
Sequence 2 SAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----W----ESWG-VWR-D----L--PF--R-----G----A
Sequence 2 VDIKEKGKD--KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y--------
Sequence 2 EDVIPEGWKADTAYEAK-----



Alignment 20
Sequence 1:
Sequence 2: Allergen Lol p 1.0101, Sequence: AAA63279
Sequence identity: 43.91 (119/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------L--V--------SA-------------------W--AK-TW
Sequence 2 --MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C-----CSG-A-TV-ITD-N--P---YHFDLSG-AFG--AK-G-----R
Sequence 2 KCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVR

Sequence 1 RAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG----QF-RV-C--P---K--FHVE--S-P-YLA-LV-Y--GDGDV--
Sequence 2 SAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----WT---ESWG-VWR-D----L--PF--R-----G-----
Sequence 2 VDIKEKGKD--KWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEF

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y--------
Sequence 2 EDVIPEGWKADTSYSAK-----



Alignment 21
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: P43216
Sequence identity: 44.28 (120/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------LL-----------SA-------------------W--AK-TW
Sequence 2 MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C-----CSG---TV-ITD-N--P---YHFDLSG-AFG--AK-G----LR
Sequence 2 KCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLR

Sequence 1 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG-----F-RV-C--P-G-K--FHVE-GS-P-YLA-LV-Y--GDGDV--
Sequence 2 SAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----W----ESWG-VWR-D----L--PF--R-----G----A
Sequence 2 VDIKEKGKD--KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y--------
Sequence 2 EDVIPEGWKADTAYEAK-----



Alignment 22
Sequence 1:
Sequence 2: Allergen Lol p 1, Sequence: P14946
Sequence identity: 43.54 (118/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------L--V--------SA-------------------W--AK-TW
Sequence 2 --MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGSC---
Sequence 2 YGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C-----CSG-A-TV-ITD-N--P---YHFDLSG-AFG--AK-G-----R
Sequence 2 KCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVR

Sequence 1 RAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AG----QF-RV-C--P---K--FHVE--S-P-YLA-LV-Y--GDGDV--
Sequence 2 SAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVA

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           VD-KE-G-----W----ESWG-VWR-D----L--PF--R-----G-----
Sequence 2 VDIKEKGKD--KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEF

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DVIP--W---T-Y--------
Sequence 2 EDVIPEGWKADTSYSAK-----



Alignment 23
Sequence 1:
Sequence 2: Allergen Pha a 1, Sequence: Q41260
Sequence identity: 44.28 (120/271)
Sequence 1 ----VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNA
           ----V-------LLV----------SA-------------------W--A
Sequence 2 MMKMVCSSSSSSLLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDA

Sequence 1 KATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGS
           K-TWYG-P-GAG--DNGGACG-K-V---PF-GMT-CGN-P--K-G-GCGS
Sequence 2 KSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGS

Sequence 1 CYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRA
           C----C-----CSG---TV-ITD-N--P---YHFDLSG-AFG--AK-G--
Sequence 2 CFELKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEE

Sequence 1 DDLRRAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDG
           ---R-AG----QF-RV-C--P-G-K--FHVE-GS-P-YLA-LV-Y--GDG
Sequence 2 ENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDG

Sequence 1 DVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGK
           DV--VD-KE-G-----W----ESWG--WR-D----L--PF--R-----G-
Sequence 2 DVVAVDIKEKGKD--KWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGT

Sequence 1 TLVAPDVIPLNWTPNTFYRSFVQYSS
           -----DVIP--W---T---S------
Sequence 2 KAEFEDVIPEGWKADTHDASK-----



Alignment 24
Sequence 1:
Sequence 2: Allergen Cyn d 1.0204, Sequence: AAF80379
Sequence identity: 43.17 (117/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------------------------G--------------W--AKAT-
Sequence 2 -------------------------AMGDKPGPNITATYGDKWLDAKATF

Sequence 1 YGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYR
           YG--P-GA---D-GGACG-K-V---PF-GMT-CGN-P--K-G--CGSCY-
Sequence 2 YGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYE

Sequence 1 VRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDL
           --C-----CSG------ITD-NY-----YHFDLSG-AFG--AK-G--D-L
Sequence 2 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL

Sequence 1 RRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVA
           R-AG----QF-RV-CE-P---K--FHVE-GSSP-YLA-LV-Y--GDG---
Sequence 2 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV

Sequence 1 QVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLV
           -VD-K--G-------PM--SWG--WR-D----L--PF-IR--S-SG----
Sequence 2 GVDIKPKGSD--EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVE

Sequence 1 APDVIPLNWTPNTFYRSFVQYSS
           --DVIP--W-P-T-Y-S--Q---
Sequence 2 QDDVIPEDWKPDTVYKSKIQF--



Alignment 25
Sequence 1:
Sequence 2: Allergen Cyn d 1.0201, Sequence: AAK96255
Sequence identity: 43.17 (117/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------------------------G--------------W--AKAT-
Sequence 2 -------------------------AMGDKPGPNITATYGDKWLDAKATF

Sequence 1 YGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYR
           YG--P-GA---D-GGACG-K-V---PF-GMT-CGN-P--K-G--CGSCY-
Sequence 2 YGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYE

Sequence 1 VRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDL
           --C-----CSG------ITD-NY-----YHFDLSG-AFG--AK-G--D-L
Sequence 2 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL

Sequence 1 RRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVA
           R-AG----QF-RV-CE-P---K--FHVE-GSSP-YLA-LV-Y--GDG---
Sequence 2 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV

Sequence 1 QVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLV
           -VD-K--G-------PM--SWG--WR-D----L--PF-IR--S-SG----
Sequence 2 GVDIKPKGSD--EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE

Sequence 1 APDVIPLNWTPNTFYRSFVQYSS
           --DVIP--W-P-T-Y-S--Q---
Sequence 2 QDDVIPEDWKPDTVYKSKIQF--



Alignment 26
Sequence 1:
Sequence 2: Allergen Cyn d 1.0203, Sequence: AAL14079
Sequence identity: 44.28 (120/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ------------V------G-----G-----N-----G----W--AKAT-
Sequence 2 -----MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDK--WLDAKATF

Sequence 1 YGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYR
           YG--P-GA---D-GGACG-K-V---PF--MT-CGN-P--K-G-GCGSCY-
Sequence 2 YGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYE

Sequence 1 VRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDL
           --C-----CSG------ITD-NY-----YHFDLSG-AFG--AK-G--D-L
Sequence 2 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL

Sequence 1 RRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVA
           R-AG----QF-RV-CE-P---K--FHVE-GS-P-YLA-LV-Y--GDG---
Sequence 2 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIV

Sequence 1 QVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLV
           -VD-K--G-------PM--SWG--WR-D----L--PF-IR--S-SG----
Sequence 2 SVDIKSKGSD--EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE

Sequence 1 APDVIPLNWTPNTFYRSFVQYSS
           --DVIP--W-P-T-Y-S--Q---
Sequence 2 QEDVIPEDWKPDTVYKSKIQF--



Alignment 27
Sequence 1:
Sequence 2: Allergen Cyn d 1.0202, Sequence: AAL14077
Sequence identity: 44.28 (120/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ------------V------G-----G-----N-----G----W--AKAT-
Sequence 2 -----MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDK--WLDAKATF

Sequence 1 YGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYR
           YG--P-GA---D-GGACG-K-V---PF-GMT-CGN-P--K-G--CGSCY-
Sequence 2 YGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYE

Sequence 1 VRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDL
           --C-----CSG------ITD-NY-----YHFDLSG-AFG--AK-G--D-L
Sequence 2 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL

Sequence 1 RRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVA
           R-AG----QF-RV-CE-P---K--FHVE-GS-P-YLA-LV-Y--GDG---
Sequence 2 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIV

Sequence 1 QVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLV
           -VD-K--G-------PM--SWG--WR-D----L--PF-IR--S-SG----
Sequence 2 SVDIKSKGSD--EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE

Sequence 1 APDVIPLNWTPNTFYRSFVQYSS
           --DVIP--W-P-T-Y-S--Q---
Sequence 2 QEDVIPEDWKPDTVYKSKIQF--



Alignment 28
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: AAL14078
Sequence identity: 45.02 (122/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------L----VV-------A----G--------------W--AKAT-
Sequence 2 -------MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATF

Sequence 1 YGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYR
           YG--P-GA---D-GGACG-K-V---PF-GMT-CGN-P--K-G-GCGSCY-
Sequence 2 YGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYE

Sequence 1 VRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDL
           --C-----CSG------ITD-NY-----YHFDLSG-AFG--AK-G--D-L
Sequence 2 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL

Sequence 1 RRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVA
           R-AG----QF-RV-CE-P---K--FHVE-GSSP-YLA-LV-Y--GDG---
Sequence 2 RKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIV

Sequence 1 QVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLV
           -VD-K--G-------PM--SWG--WR-D----L--PF-IR--S-SG----
Sequence 2 GVDIKPKGSD--VFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVE

Sequence 1 APDVIPLNWTPNTFYRSFVQYSS
           --DVIP--W-P-T-Y-S--Q---
Sequence 2 QEDVIPEDWKPDTVYKSKIQF--



Alignment 29
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: O04701
Sequence identity: 42.44 (115/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------------------------G--------------W--A-AT-
Sequence 2 -------------------------AIGDKPGPNITATYGSKWLEARATF

Sequence 1 YGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYR
           YG--P-GA---D-GGACG-K-V---PF-GMT-CGN-P--K-G-GC--CY-
Sequence 2 YGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCRACYE

Sequence 1 VRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDL
           --C-----CSG----V-ITD-NY-----YHFDLSG-AFG--AK-G--D-L
Sequence 2 IKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL

Sequence 1 RRAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVA
           R-AG----QF-RV-C--P-G-K--FH-E-GS---YLA-LV-Y--GDG---
Sequence 2 RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIV

Sequence 1 QVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLV
           -VD-K----------PM--SWG--WR-D----L--PFSIR--S--G--LV
Sequence 2 AVDIKPRDSD--EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLV

Sequence 1 APDVIPLNWTPNTFYRSFVQYSS
           --DVIP-NW-P-T-Y-S--Q---
Sequence 2 QDDVIPANWKPDTVYTSKLQFGA



Alignment 30
Sequence 1:
Sequence 2: Allergen Sor h 1.0101, Sequence: ABC58726
Sequence identity: 43.17 (117/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           -------------------------------N--E--G----W---KATW
Sequence 2 -----------------------PPKVAKGKNITETYG--SDWLERKATW

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           YG-P-GAG--DNGGACG-K-VN--PF--M--CGN-P--K-G--CGSC---
Sequence 2 YGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKDGL-CGSCFEI

Sequence 1 RCNR-NPA-CSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADD
           -C----PA-CSG-A--V-ITDMNY-----YHFDL-G-AFG--AK-G----
Sequence 2 KCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEK

Sequence 1 LRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVA
           L--AGIID--F-RV-C---G-KV-FHVE-GS-P-YLA-LV-Y--GDGD--
Sequence 2 LAKAGIIDMKFRRVKCKY-GEKVTFHVEKGSNPNYLALLVKYVDGDGDIV

Sequence 1 QVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLV
           -VD-KE-G--G----P---SWG--WR-DS------P----I----G----
Sequence 2 GVDIKEKG--GDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTA

Sequence 1 APDVIPLNWTPNTFYRSFVQYSS
           --DVIP--W---T-Y--------
Sequence 2 YDDVIPEGWKADTTYTAK-----



Alignment 31
Sequence 1:
Sequence 2: Allergen Gly m 2, Sequence: AAA50175
Sequence identity: 45.76 (124/271)
Sequence 1 -----VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGN
           ------------L-L-----------S--------YN-S--------W--
Sequence 2 MALTLQRALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSP

Sequence 1 AKATWYGQPNGAGAADNGGACGF-KKVNQYPFMGMTSCGNQPLYKGGKGC
           A-ATWYG--NG-G----GGACG----V-Q-PF----S-G----Y--GKGC
Sequence 2 AVATWYGPANGDGS--EGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGC

Sequence 1 GSCYRVRCNRNPACSGNAQTVAITD--MNYFPLSQYHFDLSGIAFGRLAK
           GSCY-V-C--N-ACSGN---V-ITD---------QYHFDLSG-AFG--A-
Sequence 2 GSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAI

Sequence 1 PGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYEN
           -G----LR-AG-I--Q--R--C--PG----FHV--GS---Y-A-LVEYE-
Sequence 2 SGQDENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYED

Sequence 1 GDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRS-
           GDGD-A-V-LKEA----G-W--M--SWG-VW--D----LRAPFSI-----
Sequence 2 GDGDLAKVELKEA-LDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTL

Sequence 1 DSGKTLVAPDVIPLNWTPNTFYRSFVQYSS
           -SG-T-VA--VIP--WTP---YRS-V----
Sequence 2 ESGQTIVANNVIPAGWTPGQTYRSIVNFAT



Alignment 32
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72986
Sequence identity: 46.49 (126/271)
Sequence 1 ---VGVVVYYLLLVLVVVQ-GCKGSSAVQGEGRWYNESEAIGGAAAWGNA
           ----G--V---L--L--------G-------GR--------G----W---
Sequence 2 MVSRGTFVFAVLVALPILSLPVSGYEQNYTAGR--RSTMSLGRGYGWSSG

Sequence 1 KATWYGQPNGAGAADNGGACGFKK-VNQYPFMGMTSCGNQPLYKGGKGCG
           -ATWYG-P-G-G----GGACG----V-Q-PF--M---G---L-K-GKGCG
Sequence 2 GATWYGGPQGDGS--EGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCG

Sequence 1 SCYRVRCNRNPACSGNAQTVAITDM--NYFPLSQY-HFDLSGIAFGRLAK
           SCY---C--N-ACSG---TV-ITD-------L----HFD-SG-AFG--A-
Sequence 2 SCYQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMAN

Sequence 1 PGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYEN
           -G--D-LR-AG----Q--RVPC-F----V-F-V--GS-P-YLA-LV-Y-N
Sequence 2 RGMGDRLRSAGVLKIQYKRVPCRF-AMNVAFKVDAGSNPYYLAILVQYAN

Sequence 1 GDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSN--HRLRAPFSIRIR
           GDGD-A-V----A--GGG-W--M--SWG--WRL-SN----L--PFSIR--
Sequence 2 GDGDLAAVHIMKARGGGG-WKAMQQSWGATWRLNSNTGKPLSPPFSIRLT

Sequence 1 SDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS
           S-SGK-LVA--VIP--W-----YRS-V-Y--
Sequence 2 SGSGKVLVANNVIPSGWQAGLTYRSTVNYAA



Alignment 33
Sequence 1:
Sequence 2: Allergen Zea m 1, Sequence: Q07154
Sequence identity: 38.38 (104/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           ----------------------------MT-CGN-P--K-GKGCGSCY-V
Sequence 2 ----------------------------MTACGNVPIFKDGKGCGSCYEV

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           RC---P-CSGN--TV-ITDMNY-P---YHFDLSG-AFG-LAKPG--D-LR
Sequence 2 RCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKLR

Sequence 1 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           --GI-DV-F-RV-C--P-G-K--FH-E-G--P-Y-AVLV-----DGD---
Sequence 2 HCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDIVL

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           ------------W-PM--SWG--WR-D----L--PFSIR--S-SGK---A
Sequence 2 MEIQDKLSA--EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -D-IP-NW-P---Y-S-VQ---
Sequence 2 KDIIPANWRPDAVYTSNVQFY-



Alignment 34
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: Q40638
Sequence identity: 39.48 (107/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           -------LLL--VVV------S--------------------W--A----
Sequence 2 --MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPG

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           ---P------DNGGACG-K-V---PF-GM-SCGN-P--K-GKGCGSC---
Sequence 2 MVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEI

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           -C----ACS--------TDMN--P---YHFDLSG-A----AK-G----LR
Sequence 2 KCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELR

Sequence 1 RAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQ
           -AGIID-QF-RV-C--P---K--FH-E--S-P-YLA-LV-Y--GDGDV--
Sequence 2 KAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVE

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           V--KE-G-----W----ESWG--WR-D----L--PFS-R----------A
Sequence 2 VEIKEKGSE--EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSA

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -D-IP-----------------
Sequence 2 EDAIPDPGRRQRVQVNVQAK--



Alignment 35
Sequence 1:
Sequence 2: Allergen Ara t expansin, Sequence: CAB37496
Sequence identity: 29.89 (81/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           ---------------------------------S-A----------KA--
Sequence 2 -----------------MLQGFLFLLSVVLLFSSSAAACDRCLHSSKAAY

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           ---------A---GAC---------F-G---------YK-G-GCG-C--V
Sequence 2 FS----SASALSSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQV

Sequence 1 RCNRNPA-CSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKP--GRAD
           RC--NP--CS----TV--TD-N-----Q----LS--AF---AKP--G---
Sequence 2 RC-KNPTLCSSKGTTVIVTDLN--KTNQTDLVLSSRAFRAMAKPVVGADR

Sequence 1 DLRRAGIIDVQFARVPCEFPGLKVGFHVEEGS-SPVYLAVLVEYENGDGD
           DL---GI-D----RVPC-----K----VEE-S--P-YLA----Y--G---
Sequence 2 DLLKQGIVDIEYRRVPCDYGNKKMNVRVEESSKNPNYLAIKLLYQGGQTE

Sequence 1 VAQVDLKEAGAGGGRWTPMRESWGSVWRLDS--NHRLRAPFSIRIRSDSG
           V-------A--G---W--M--S-G-VW--D---N--L---F------D-G
Sequence 2 VVAIYI--AQVGSSHWSYMTRSHGAVWVTDKVPNGALQFRFVVTAGYD-G

Sequence 1 KTLVAPDVIPLNWTPNTFYRSFVQYSS---------------
           K------V-P-NW-----Y---VQ------------------
Sequence 2 KMVWSQRVLPANWEAGKSYDAGVQITDIAQEGCDPCDDHIWN



Alignment 36
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAG13596
Sequence identity: 25.46 (69/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------V--C--------------------------------
Sequence 2 ------------MAVRCCSSMASASVVLFFVVVGMSASMVSGCDRCVRRS

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           ---------A-N-G-CG----------G--------L--GG-GCG-C--V
Sequence 2 KAGFRDSSIALNAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQV

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           RC-----CS-----V--TD------------LS--A----A-PG-A--LR
Sequence 2 RCKDGKLCSTAGAKVVVTDEAR-STNRTDLVLSAAAYAAMARPGMAAQLR

Sequence 1 RAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVY-LAVLVEYENGDGDVA
           -----DV---RVPCE---G------VEE-S-P---L-----Y--G--D--
Sequence 2 TRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPRELSIRFLYQGGQTDIV

Sequence 1 QVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSD---SGK
           -VD---A--G---W--M----G--W----------P---R--------GK
Sequence 2 AVDV--ATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVVTGGYDGK

Sequence 1 TLVAP-DVIPLNWTPNTFYRSFVQYSS---------------
           ---A---V-P--WT----Y---VQ------------------
Sequence 2 WVWADGEVLPRRWTAGRVYDAGVQIADVAQEGCYPCDTQEWK



Alignment 37
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: BAA85432
Sequence identity: 28.04 (76/271)
Sequence 1 ---------VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAA
           -----------------------V--------------------------
Sequence 2 MASSWNNPAIFLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTS

Sequence 1 AWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGM-TSCGNQPLYKG
           -W----AT-YG-P-G-G--D-GGACG-------------T-----PL---
Sequence 2 DWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLFAD

Sequence 1 GKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQY------------
           G-GCG-CY--RC---P-C------V-IT--N--P---Y------------
Sequence 2 GNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPP

Sequence 1 --HFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVE
           --HFD-----F--LA--------R-AGI--VQ--RVPC---G--V-F---
Sequence 2 RHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTG-GVRFCLQ

Sequence 1 EGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWR--
           -------L---V----G-GDV-----K--G-GGG-W------WG------
Sequence 2 --GNHYWLLLYVMNVGGAGDVSSLSVKTSG-GGGAWIQAAHNWGITYQVF

Sequence 1 --LDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS
           --LD----L---------S----T----D-I---W-----Y--------
Sequence 2 AALDNSDGLTVKLTTY--STPQQTIIVSDAISPWWITGLCYQGSNNFY-



Alignment 38
Sequence 1:
Sequence 2: Allergen Cyn d 2, Sequence: CAA10346
Sequence identity: 16.24 (44/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           ------------------------------------------------L-
Sequence 2 --------------------------------------MSMASSSSSGLL

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           --------FA---C--P--KV-F-VE-GS----LAVLV-YE-GD---A-V
Sequence 2 AMAVLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           -L-E-G-----W--M----G-VW--DS---L--PF--R-----G---V--
Sequence 2 ELREHGSD--EWVAMTKGEGGVWTFDSEEPLKGPFNFRFLTEKGMKNVFD

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           DV-P---T----Y--------
Sequence 2 DVVPEKYTIGATYAPEE----



Alignment 39
Sequence 1:
Sequence 2: Allergen Dac g 2, Sequence: CAA10345
Sequence identity: 16.24 (44/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           ------------------------------------------------L-
Sequence 2 --------------------------------------MSMASSSSSGLL

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           --------FA---C--P--KV-F-VE-GS----LAVLV-YE-GD---A-V
Sequence 2 AMAVLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           -L-E-G-----W--M----G-VW--DS---L--PF--R-----G---V--
Sequence 2 ELREHGSD--EWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFD

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           DV-P---T----Y--------
Sequence 2 DVVPEKYTIGATYAPEE----



Alignment 40
Sequence 1:
Sequence 2: Allergen Poa p 2, Sequence: CAA10348
Sequence identity: 16.24 (44/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           ------------------------------------------------L-
Sequence 2 --------------------------------------MSMASSSSSSLL

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           --------FA---C--P--KV-F-VE-GS----LAVLV-YE-GD---A-V
Sequence 2 AMAVLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           -L-E-G-----W--M----G-VW--DS---L--PF--R-----G---V--
Sequence 2 ELREHGSD--EWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFD

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           DV-P---T----Y--------
Sequence 2 DVVPEKYTIGATYAPEE----



Alignment 41
Sequence 1:
Sequence 2: Allergen Phl p 2, Sequence: P43214
Sequence identity: 16.24 (44/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           ------------------------------------------------L-
Sequence 2 --------------------------------------MSMASSSSSSLL

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           --------FA---C--P--KV-F-VE-GS----LAVLV-YE-GD---A-V
Sequence 2 AMAVLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           -L-E-G-----W--M----G-VW--DS---L--PF--R-----G---V--
Sequence 2 ELREHGSD--EWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFD

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           DV-P---T----Y--------
Sequence 2 DVVPEKYTIGATYAPEE----



Alignment 42
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: P14947
Sequence identity: 12.55 (34/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGD-VAQ
           --------------------V-F-VE-GS----LA----Y-N--GD--A-
Sequence 2 -----------------AAPVEFTVEKGSDEKNLALSIKY-NKEGDSMAE

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           V-LKE-G-----W---------VW---S---L--PF--R--S--G---V-
Sequence 2 VELKEHGSN--EWLALKKNGDGVWEIKSDKPLKGPFNFRFVSEKGMRNVF

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DV-P------T-Y--------
Sequence 2 DDVVPADFKVGTTYKPE-----



Alignment 43
Sequence 1:
Sequence 2: Allergen Dac g 3, Sequence: P93124
Sequence identity: 11.44 (31/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           -------------------KV-F-VE-GS-P--L-----Y-------A-V
Sequence 2 ------------------VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           -L---G-----W-P-----G--W---S---L--PF--R--S--G---V--
Sequence 2 ELRQHGSE--EWEPLTKK-GNLWEVKSSKPLTGPFNFRFMSKGGMRNVFD

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           -VIP------T-Y--------
Sequence 2 EVIPTAFKIGTTYTPEE----



Alignment 44
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: CAA51775
Sequence identity: 11.44 (31/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEY-ENGDGDVAQ
           ----------------------F-VE-GS----LA----Y---GD---A-
Sequence 2 ---------------------EFTVEKGSDEKNLALSIKYSKEGDA-MAE

Sequence 1 VDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVA
           V-LKE-G-----W---------VW---S---L--PF--R--S--G---V-
Sequence 2 VELKEHGSN--EWLALKKNGDGVWEIKSDKPLKGPFNFRFVSEKGMWNVF

Sequence 1 PDVIPLNWTPNTFYRSFVQYSS
           -DV-P------T----------
Sequence 2 DDVVPADFKVGT----------



Alignment 45
Sequence 1:
Sequence 2: Allergen Phl p 3.0101, Sequence: 2JNZ_A
Sequence identity: 10.70 (29/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           --------------------V-F-V--GS-P--L-----Y-------A-V
Sequence 2 ------RGSHHHHHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           -L---G-----W-P-----G-VW---S---L--PF--R--S--G---V--
Sequence 2 ELRQHGSE--EWEPLTKK-GNVWEVKSSKPLVGPFNFRFMSKGGMRNVFD

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           -VIP--------Y--------
Sequence 2 EVIPTAFSIGKTYKPEE----



Alignment 46
Sequence 1:
Sequence 2: Allergen Cyn d 15, Sequence: AAP80171
Sequence identity: 13.28 (36/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           --------------------------------------------------
Sequence 2 -------------------------------------------------M

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           ------V--A------------FHVEE-S----L--------------QV
Sequence 2 ATLTFPVLLATMVGHAWCVNIIFHVEESSPKFALSI----KDSAKEITQV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           D--E-GA------PM--S-G--W--D----L--P--IR-R---G---V--
Sequence 2 DVREHGADN--MDPMTKS-GDSWTIDKP--LKGPLNIRLRAEGGGSRVQD

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           DVIP-NW---T-Y--------
Sequence 2 DVIPENWKAGTDYPTKLHFG-



Alignment 47
Sequence 1:
Sequence 2: Allergen Lol p 3, Sequence: P14948
Sequence identity: 10.70 (29/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           -------------------KV---VE-GS----L-----Y-------A-V
Sequence 2 ------------------TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           -L---G-----W-PM----G--W---S---L--P---R--S--G---V--
Sequence 2 ELRQHGSE--EWEPMTKK-GNLWEVKSAKPLTGPMNFRFLSKGGMKNVFD

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           -VIP---T----Y--------
Sequence 2 EVIPTAFTVGKTYTPEYN---



Alignment 48
Sequence 1:
Sequence 2: Allergen Tri a 3, Sequence: CAA90746
Sequence identity: 9.59 (26/271)
Sequence 1 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLR
           --------------------------------------------------
Sequence 2 ----------------------------------------------MASA

Sequence 1 RAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQV
           ---------A---------KV---V--GS----LA----Y---------V
Sequence 2 SRMLTVAVLAALFAGAMAVKVKLTVQKGSDKKKLALKIDYTRPNDSLSEV

Sequence 1 DLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAP
           -L---G-----W-P-----G-VW-------L--PF--R--S--G---V--
Sequence 2 ELRQYGSE--EWQPLTKK-GDVWEVSCSKPLVGPFNFRFLSKNGMKKVFD

Sequence 1 DVIPLNWTPNTFYRSFVQYSS
           -V----------Y--------
Sequence 2 EVFSTDFKIGKTYEPEY----


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.