The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Pru ar 3

Sequence P81651

Full FASTA alignment

Sequence name:
Query sequence:
ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC
LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Pru ar 3P81651Go!91133.66.6e-34
2Pru d 3P82534Go!91125.81.5e-31
3Pru p 3CAB96876Go!91125.22.2e-31
4Pru p 3P81402Go!91124.43.8e-31
5Mal d 3Q9M5X7Go!115120.85.9e-30
6Pru av 3Q9M5X8Go!117119.81.2e-29
7Pyr c 3Q9M5X6Go!115113.68.5e-28
8Fra a 3.0202Q4PLT6Go!117106.01.6e-25
9Fra a 3.0201Q4PLU0Go!117102.71.7e-24
10Fra a 3.0101Q8VX12Go!117102.52.0e-24
11Rub i 3.0101Q0Z8V0Go!117101.15.2e-24
12Fra a 3.0102Q4PLT9Go!117100.76.9e-24
13Hev b 12AAL25839Go!11699.31.8e-23
14Pha v 3.0101ADC80502Go!11598.92.4e-23
15Mor n 3.0101P85894Go!9197.35.6e-23
16Ara h 9.0101ABX56711Go!11695.52.5e-22
17Pha v 3.0201ADC80503Go!11895.13.3e-22
18Cor a 8AAK28533Go!11593.97.5e-22
19Pla or 3.0101ABY21307Go!11890.96.1e-21
20Len c 3.0101A0AT29Go!11890.77.0e-21
21Pla a 3.0101CAL07989Go!11890.11.1e-20
22Zea m 14.0101P19656-1Go!12089.71.4e-20
23Ara h 9.0201ABX75045Go!9288.52.5e-20
24Zea m 14.0102P19656-2Go!12889.02.5e-20
25Api g 2ACV04796Go!11887.56.4e-20
26Pru du 3.0101ACN11576Go!12386.11.7e-19
27Sin a 3.0101ABU95411Go!9281.53.2e-18
28Art v 3.0202ACE07187Go!11680.11.1e-17
29Lyc e 3AAB42069Go!11478.33.6e-17
30Art v 3.0201EU564845Go!11476.99.6e-17
31Art v 3.0301EU564847Go!11776.11.7e-16
32Hor v 1AAA32970Go!11776.11.7e-16
33Hor v 1CAA42832Go!13475.62.7e-16
34Tri a 14.010119846220Go!9073.96.0e-16
35Hel a 3.0101P82007Go!11666.71.1e-13
36Amb a 6O04004Go!11852.03.1e-09
37Par j 2O04403Go!13350.97.5e-09
38Par j 2P55958Go!13349.71.7e-08
39Par j 1Q40905Go!13846.12.1e-07
40Par j 1P43217Go!13945.92.4e-07
41Par j 1.0103CAI94601Go!13945.14.2e-07
42Par j 1O04404Go!17643.31.9e-06
43Par j 1.0101CAA54587Go!13341.35.7e-06
44Art v 3.0101P0C088Go!3736.16.0e-05
45Cas s 810998016Go!3633.92.7e-04
46Vit v 1P80274Go!3733.14.8e-04
47Jug r 315480333Go!3031.98.8e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 100.00 (91/91)
Sequence 1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC
           ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC
Sequence 2 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC

Sequence 1 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
Sequence 2 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK



Alignment 2
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 92.31 (84/91)
Sequence 1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC
           ITCGQVSS-LAPCI-YV-GGGAVPPACCNGIRNVNNLARTT-DRR-ACNC
Sequence 2 ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNC

Sequence 1 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           LKQLSGSI-GVNPNNAAALPGKCGVN-PYKISASTNCATVK
Sequence 2 LKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 92.31 (84/91)
Sequence 1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC
           ITCGQVSSSLAPCI-YVRGGGAVPPACCNGIRNVNNLARTTPDR--ACNC
Sequence 2 ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNC

Sequence 1 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           LKQLS-S--GVNPNNAAALPGKCGV-IPYKISASTNCATVK
Sequence 2 LKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK



Alignment 4
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 91.21 (83/91)
Sequence 1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC
           ITCGQVSS-LAPCI-YVRGGGAVPPACCNGIRNVNNLARTTPDR--ACNC
Sequence 2 ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNC

Sequence 1 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           LKQLS-S--GVNPNNAAALPGKCGV-IPYKISASTNCATVK
Sequence 2 LKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 86.81 (79/91)
Sequence 1 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA
           ------------------------ITCGQV-SSLAPCIGYVR-GGAVPPA
Sequence 2 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA

Sequence 1 CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVN
           CCNGIR--N-LARTT-DR-TACNCLK-L-GSISGVNPNNAA-LPGKCGVN
Sequence 2 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN

Sequence 1 IPYKISASTNCATVK
           -PYKIS-STNCATVK
Sequence 2 VPYKISTSTNCATVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 85.71 (78/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           ---------------------------TCGQVSS-LAPCI-YVRGGGAVP
Sequence 2 MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVP

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           PACCNGIRN-NNLA-TT-DR-TACNCLKQLS-S--GVN-NNAAALPGKCG
Sequence 2 PACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCG

Sequence 1 VNIPYKISASTNCATVK
           VN-PYKIS-STNCATVK
Sequence 2 VNVPYKISPSTNCATVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 78.02 (71/91)
Sequence 1 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA
           ------------------------ITC-QVS--LAPCI-YVR-GGAVPPA
Sequence 2 MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVPPA

Sequence 1 CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVN
           CCNGI---N-LA-TTPDR--ACNCLK-L-GS-SGVNP-NA--LPGKCGVN
Sequence 2 CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVN

Sequence 1 IPYKISASTNCATVK
           -PYKIS-STNCATVK
Sequence 2 VPYKISTSTNCATVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 72.53 (66/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           --------------------------ITCGQV-SS--PC--YV--GGAVP
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           -ACCNGIR--N--A-TT-DR-T-CNCLKQ-SG-I-G-NPN-AA-LPGKCG
Sequence 2 AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCG

Sequence 1 VNIPYKISASTNCATVK
           VN-PYKIS-STNCA-VK
Sequence 2 VNVPYKISTSTNCAAVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 69.23 (63/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           --------------------------ITCGQV-SS--PC--YV--GGAVP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           -ACCNGIR--N--A-TT-DR---CNCLKQ-SG-I-G-NP--AA-LPGKCG
Sequence 2 AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCG

Sequence 1 VNIPYKISASTNCATVK
           V--PYKIS-STNCA-VK
Sequence 2 VSVPYKISTSTNCAAVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 68.13 (62/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           --------------------------ITCGQV-S---PC--YV--GGAVP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           -ACC-GIRN-N--A-TT-DR--ACNCLKQ--G-I-G-NPN-AA-LPGKCG
Sequence 2 AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VNIPYKISASTNCATVK
           V--PYKIS--TNCA-VK
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 68.13 (62/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           --------------------------ITCGQV----APC--YV--GGAVP
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           -ACCNG-RN-N--A-TT-DR---CNCLK---GSI-G-NP--AA-LPGKCG
Sequence 2 AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCG

Sequence 1 VNIPYKISASTNCATVK
           V--PYKIS-STNCATVK
Sequence 2 VSVPYKISTSTNCATVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 65.93 (60/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           --------------------------ITCGQV-S---PC--YV--GGAVP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           --CC-GIRN-N--A-TT-DR---CNCLKQ--G-I-G-NPN-AA-LPGKCG
Sequence 2 APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VNIPYKISASTNCATVK
           V--PYKIS--TNCA-VK
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 68.13 (62/91)
Sequence 1 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA
           ------------------------ITCGQV-S-L-PC--Y----G--PPA
Sequence 2 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA

Sequence 1 -CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGV
           -CCNG-R--NN-A-TT-DRRTAC-CLK---GS--G-NP---A-LPGKCGV
Sequence 2 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV

Sequence 1 NIPYKISASTNCATVK
           NIPYKIS-STNCATVK
Sequence 2 NIPYKISLSTNCATVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 63.74 (58/91)
Sequence 1 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA
           -------------------------TCGQV-S-L-PC------GG-VP--
Sequence 2 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG

Sequence 1 CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVN
           CCNG-RN--N-AR-T-DRR--CNCLK---G---G-NPNNA-ALPGKCGVN
Sequence 2 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN

Sequence 1 IPYKISASTNCATVK
           IPYKIS-STNCA---
Sequence 2 IPYKISTSTNCASIN



Alignment 15
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 68.13 (62/91)
Sequence 1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC
           ITCGQVSSSLAPCI-Y-R-GG-VP--CCNG-R--NN-A-TT-DR--ACNC
Sequence 2 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC

Sequence 1 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           LK----SI-G-N-N-AA-LPGKCGV--PYKIS-ST-C--VK
Sequence 2 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK



Alignment 16
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 64.84 (59/91)
Sequence 1 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA
           ------------------------I-CGQV-S-LAPCI-----GGA-PPA
Sequence 2 MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPA

Sequence 1 CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVN
           CC-G-R------RTT-DR--ACNCLK---GS--G-N--NAAALPG-CGV-
Sequence 2 CCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVS

Sequence 1 IPYKISASTNCATVK-
           IPYKIS-STNCAT-K-
Sequence 2 IPYKISTSTNCATIKF



Alignment 17
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 63.74 (58/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           --------------------------I-CGQV-SSLA-CI-----GG-VP
Sequence 2 MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           --CC-G-R--N--A-TTPDR---CNCLK---G-I-G-N-NNA--LPGKCG
Sequence 2 ASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCG

Sequence 1 VNIPYKISASTNCATVK-
           V-IPYKIS-STNCAT-K-
Sequence 2 VSIPYKISTSTNCATIKF



Alignment 18
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 60.44 (55/91)
Sequence 1 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA
           -------------------------TC-Q----L-PC--Y---GG--PP-
Sequence 2 MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS

Sequence 1 CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVN
           CC-G-R-VN---RTT-DR--ACNCLK-----I-G-NPN-AA-LPGKCGVN
Sequence 2 CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVN

Sequence 1 IPYKISASTNCATVK
           IPYKIS-STNC--VK
Sequence 2 IPYKISPSTNCNNVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 61.54 (56/91)
Sequence 1 ---------------------------ITCGQVSSSLAPCIGYVRGGGAV
           ---------------------------ITCG-V---L-PC--Y-R-GGAV
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 PPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKC
           -PACCNG----NN-A-TTPDR--AC-CLK--S-SISG----NAA-L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNIPYKISASTNCATVK
           GVN-PYKIS----C--VK
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 61.54 (56/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           --------------------------I-CG-V-S-L-PC--Y--GG----
Sequence 2 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           P-CC-G-------A-TTPDR--ACNCLK---GSI---N-NNAAALPGKCG
Sequence 2 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG

Sequence 1 VNIPYKISASTNCATVK-
           VNIPYKIS--TNC-TVK-
Sequence 2 VNIPYKISTTTNCNTVKF



Alignment 21
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 60.44 (55/91)
Sequence 1 ---------------------------ITCGQVSSSLAPCIGYVRGGGAV
           ---------------------------ITCG-V---L-PC----R-GGAV
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 PPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKC
           -PACCNG----NN-A-TTPDR--AC-CLK--S-SISG----NAA-L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNIPYKISASTNCATVK
           GVN-PYKIS----C--VK
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 22
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 60.44 (55/91)
Sequence 1 ----------------------------ITCGQVSSSLAPCIGYVRGGGA
           ----------------------------I-CGQV-S--APCI-Y-RG-G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPG
           -P-A-CC-G-R--NN-ARTT-DRR-ACNCLK------SG-N--NAA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISASTNCATVK
           KCGV-IPY-IS-ST-C--V-
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 23
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 59.34 (54/91)
Sequence 1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC
           --CGQV-S-LAPCI-----GG-----CC-G-R-----A-TT-DR--ACNC
Sequence 2 LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNC

Sequence 1 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK-
           LK---GS--G-N--NAAALPG-CGV-IPYKIS-STNCAT-K-
Sequence 2 LKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF



Alignment 24
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 59.34 (54/91)
Sequence 1 ----------------------------ITCGQVSSSLAPCIGYVRGGGA
           ----------------------------I-CGQV-S--APCI-Y-RG-G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPG
           -P-A-CC-G-R--NN-ARTT-DRR-ACNCLK------SG-N--NAA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISASTNCATVK--------
           KCGV-IPY-IS-ST-C------------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 25
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 54.95 (50/91)
Sequence 1 ---------------------------ITCGQVSSSLAPCIGYVRGGGAV
           ----------------------------TCGQV---L--C-GY--GGG--
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP

Sequence 1 PPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKC
           -PACC-G----N-LA-T--DR--AC-CLK-L-GS--G-N---A-ALPGKC
Sequence 2 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC

Sequence 1 GVNIPYKISASTNCATVK
           G--IPY-IS-ST-C--V-
Sequence 2 GIRIPYPISPSTDCSRVN



Alignment 26
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 59.34 (54/91)
Sequence 1 ------------------------------ITCGQVSSSLAPCIGYVRGG
           --------------------------------CGQV---L-PCI-YV--G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNN--AAA
           GA--P-CC-G-R----LA-TT-DR---CNCLKQ----I---N-N---AA-
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 LPGKCGVNIPYKISASTNCATVK
           LPGKCGVNIPYKIS-ST-C-T-K
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK



Alignment 27
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 54.95 (50/91)
Sequence 1 -ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACN
           ---CG-V-S-LA-CIGY-------P--CC-G--N-NN-ARTTPDR--AC-
Sequence 2 ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACR

Sequence 1 CLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           CL-----S----N---AAALP--CGVNIPYKIS-STNC--V-
Sequence 2 CLVGAANSFPSLNAARAAALPKACGVNIPYKISKSTNCNSVR



Alignment 28
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 52.75 (48/91)
Sequence 1 -------------------------ITCGQVSSSLAPCIGYVRGGGAVPP
           --------------------------TC--VS----PC--Y---GG-VP-
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGV
           -CC-G----N--A-TTPDR-TACNCLK----S--------AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 NIPYKISASTNCATVK
           NIPYKIS--T-C--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 51.65 (47/91)
Sequence 1 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA
           --------------------------CG-V-S-LAPC--Y--G-G-----
Sequence 2 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG-G

Sequence 1 CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVN
           CC-G-------A-T--DR-TAC-CLK----SI-G-----AA-LPG-CGVN
Sequence 2 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN

Sequence 1 IPYKISASTNCATVK
           IPYKIS-ST-C-TV-
Sequence 2 IPYKISPSTDCSTVQ



Alignment 30
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 50.55 (46/91)
Sequence 1 -----------------------ITCGQVSSSLAPCIGYVRGGGAVPPAC
           -------------------------C--VS-----C--Y---GG-VP--C
Sequence 2 MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADC

Sequence 1 CNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNI
           C-G----N--A-TTPDR-TACNCLK----S--------AA-LP-KCGVNI
Sequence 2 CTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNI

Sequence 1 PYKISASTNCATVK
           PYKIS--T-C--VK
Sequence 2 PYKISLETDCNKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 47.25 (43/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           ---------------------------TC--VS----PC--Y---GG-VP
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           --CC-G----N----TTPDR-TACNCLK----S--------A--LP-KCG
Sequence 2 ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCG

Sequence 1 VNIPYKISASTNCATVK
           -N-PYK-S--T-C--VK
Sequence 2 LNLPYKLSLETDCNKVK



Alignment 32
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 46.15 (42/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           ----------------------------CGQV-S---PC--YV-GG----
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           --CCNG-R---N-A----DR-T-CNCLK-----I---N-NNAA--P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNIPYKISASTNCATVK
           VN-PY-IS----C----
Sequence 2 VNVPYTISPDIDCSRIY



Alignment 33
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 46.15 (42/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           ----------------------------CGQV-S---PC--YV-GG----
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           --CCNG-R---N-A----DR-T-CNCLK-----I---N-NNAA--P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNIPYKISASTNCATVK-----------------
           VN-PY-IS----C---------------------
Sequence 2 VNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 34
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 46.15 (42/91)
Sequence 1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC
           I-CG-V-S---PC--YV-GG------CC-G--N--N-AR---DR--ACNC
Sequence 2 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC

Sequence 1 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           LK-----I---N--NA---P-KCGVN-PY-IS----C--V-
Sequence 2 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-



Alignment 35
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 42.86 (39/91)
Sequence 1 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP
           --------------------------ITC--V---L-PC--Y-R-GG---
Sequence 2 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT

Sequence 1 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG
           PACC-G--------RT--DRRTAC-C-K--------V-P--A--LPGKCG
Sequence 2 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG

Sequence 1 VNIPYKISASTNCATVK
           ------I----NC-T--
Sequence 2 ISTSIPINPNVNCNTIP



Alignment 36
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 36.26 (33/91)
Sequence 1 ---------------------------ITCGQVSSSLAPCIGYVRGGGAV
           ----------------------------TC--V---LAPC-G---G----
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQEP-

Sequence 1 PPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKC
           --ACC-G--N-NN---T--DR---CNC-K-L--SI----P-----L--KC
Sequence 2 SKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA-YDPKRMPLLSTKC

Sequence 1 GVNIPYK-ISASTNCATVK-
           GV------------C-----
Sequence 2 GVKPDFPAVDKNLDCSKLPV



Alignment 37
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 31.87 (29/91)
Sequence 1 --------------------------------ITCGQVSSSLAPCIGYVR
           ----------------------------------CG-V-----PC---V-
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 GGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAA
           G----P---CC-G---------TT---R-AC-C-------ISG------A
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 ALPGKCGV--NIPYKISASTNCATVK--------
           --P-KCG-----P--I-A---C------------
Sequence 2 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 38
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 30.77 (28/91)
Sequence 1 --------------------------------ITCGQVSSSLAPCIGYVR
           ----------------------------------CG-V-----PC---V-
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 GGGAVPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAA
           G----P---CC-G---------TT---R-AC-C-------ISG------A
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 ALPGKCGV--NIPYKISASTNCATVK--------
           --P-KC------P--I-A---C------------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 39
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 29.67 (27/91)
Sequence 1 -------------------------------------ITCGQVSSSLAPC
           --------------------------------------TCG-V---L-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 IGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVN
           ---V-G----P---CC-G---------T-P-R--AC-C--------S---
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 PNNAAALPGKCGV---NIPYKISASTNCATVK-------
           -------P--CG------P--I-----C-T---------
Sequence 2 GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 40
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 29.67 (27/91)
Sequence 1 -ITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTAC
           --TCG-----L-PC---V-G----P---CC-G---------T-P-R--AC
Sequence 2 QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHAC

Sequence 1 NCLKQLSGSISGVNPNNAAALPGKCGV---NIPYKISASTNCATVK----
           -C--------S----------P--CG------P--I-----C-TV-----
Sequence 2 ECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTVGVVPR

Sequence 1 ----------------------------------------
           ----------------------------------------
Sequence 2 QPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 41
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 28.57 (26/91)
Sequence 1 -ITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTAC
           --TCG-----L-PC---V-G----P---CC-G---------T-P-R--AC
Sequence 2 QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHAC

Sequence 1 NCLKQLSGSISGVNPNNAAALPGKCGV---NIPYKISASTNCATVK----
           -C--------S----------P--CG------P--I-----C-T------
Sequence 2 ECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPR

Sequence 1 ----------------------------------------
           ----------------------------------------
Sequence 2 QPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 42
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 28.57 (26/91)
Sequence 1 --------------------------------------ITCGQVSSSLAP
           ---------------------------------------TCG-V---L-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGV
           C---V-G----P---CC-G---------T---R--AC-C--------S--
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NPNNAAALPGKCGV---NIPYKISASTNCATVK-----------------
           --------P--CG------P--I-----C-T-------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 43
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 26.37 (24/91)
Sequence 1 ITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACN
           ---------L-PC---V-G----P---CC-G---------T-P-R--AC-
Sequence 2 -----MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACE

Sequence 1 CLKQLSGSISGVNPNNAAALPGKCGV---NIPYKISASTNCATVK-----
           C--------S----------P--CG------P--I-----C-TV------
Sequence 2 CIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTVGVVPRQ

Sequence 1 ---------------------------------------
           ---------------------------------------
Sequence 2 PQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 44
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 16.48 (15/91)
Sequence 1 -ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACN
           --TC--VS----PC--Y---GG-VP--CC-G----N--------------
Sequence 2 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------

Sequence 1 CLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           ------------------------------------------
Sequence 2 ------------------------------------------



Alignment 45
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 18.68 (17/91)
Sequence 1 -ITCGQVSSSLAPCIGYVRGGGAVPP--ACCNGIRNVNNLARTTPDRRTA
           -ITC-QVS-SL-PC--Y----G--PP---CC-G-----------------
Sequence 2 SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVKL--------------

Sequence 1 CNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           --------------------------------------------
Sequence 2 --------------------------------------------



Alignment 46
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 18.68 (17/91)
Sequence 1 -ITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTAC
           --TCGQV-S-L-PCI-Y----GAVP---CC--------------------
Sequence 2 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA-------------

Sequence 1 NCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           -------------------------------------------
Sequence 2 -------------------------------------------



Alignment 47
Sequence 1:
Sequence 2: Allergen Jug r 3, Sequence: 15480333
Sequence identity: 19.78 (18/91)
Sequence 1 -ITCGQVSSSLAPCIGYVRGG-GAVPPACCNGIRNVNNLARTTPDRRTAC
           -ITCGQV-SS---CIGY-RG----VPP--C--------------------
Sequence 2 VITCGQVASSVGSCIGYLRGTVPTVPPSAC--------------------

Sequence 1 NCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK
           -------------------------------------------
Sequence 2 -------------------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.