The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Vit v 1

Sequence 462719

Full FASTA alignment

Sequence name:
Query sequence:
TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Vit v 1P80274Go!3748.93.4e-09
2Fra a 3.0202Q4PLT6Go!11734.52.3e-04
3Fra a 3.0201Q4PLU0Go!11734.52.3e-04
4Mor n 3.0101P85894Go!9132.66.7e-04
5Fra a 3.0102Q4PLT9Go!11732.87.6e-04
6Fra a 3.0101Q8VX12Go!11732.87.6e-04
7Ara h 9.0201ABX75045Go!9232.19.6e-04
8Pru p 3P81402Go!9131.81.2e-03
9Hev b 12AAL25839Go!11632.11.2e-03
10Pru d 3P82534Go!9131.41.5e-03
11Pha v 3.0101ADC80502Go!11531.61.7e-03
12Pru ar 3P81651Go!9131.11.9e-03
13Pru p 3CAB96876Go!9131.11.9e-03
14Mal d 3Q9M5X7Go!11531.41.9e-03
15Zea m 14.0101P19656-1Go!12031.42.0e-03
16Zea m 14.0102P19656-2Go!12831.52.1e-03
17Ara h 9.0101ABX56711Go!11630.92.8e-03
18Rub i 3.0101Q0Z8V0Go!11730.44.0e-03
19Pha v 3.0201ADC80503Go!11830.44.0e-03
20Pru av 3Q9M5X8Go!11730.24.5e-03
21Cas s 810998016Go!3628.44.9e-03
22Pyr c 3Q9M5X6Go!11529.76.4e-03
23Art v 3.0301EU564847Go!11729.48.1e-03
24Art v 3.0101P0C088Go!3727.59.1e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 100.00 (37/37)
Sequence 1 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA
           TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA
Sequence 2 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA



Alignment 2
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 56.76 (21/37)
Sequence 1 -------------------------TVTCGQVASALSPCIDYLQKDGAVP
           ---------------------------TCGQVAS--SPC--Y----GAVP
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 AGSCCX--KXLSSA------------------------------------
           A--CC-----L-SA------------------------------------
Sequence 2 A-ACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKC

Sequence 1 ------------------
           ------------------
Sequence 2 GVNVPYKISTSTNCAAVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 56.76 (21/37)
Sequence 1 -------------------------TVTCGQVASALSPCIDYLQKDGAVP
           ---------------------------TCGQVAS--SPC--Y----GAVP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 AGSCCX--KXLSSA------------------------------------
           A--CC-----L-SA------------------------------------
Sequence 2 A-ACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKC

Sequence 1 ------------------
           ------------------
Sequence 2 GVSVPYKISTSTNCAAVK



Alignment 4
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 51.35 (19/37)
Sequence 1 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA-------------
           --TCGQV-S-L-PCI-YL---G-VPA--CC----S---------------
Sequence 2 -ITCGQVSSSLAPCINYLRAGGVVPA-NCCNGVRSLNNAAKTTADRQAAC

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 NCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 48.65 (18/37)
Sequence 1 -------------------------TVTCGQVASALSPCIDYLQKDGAVP
           ---------------------------TCGQVAS--SPC--Y----GAVP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP

Sequence 1 AGSCCXKXLSSA--------------------------------------
           A--CC---------------------------------------------
Sequence 2 A-PCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 ------------------
           ------------------
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 48.65 (18/37)
Sequence 1 -------------------------TVTCGQVASALSPCIDYLQKDGAVP
           ---------------------------TCGQVAS--SPC--Y----GAVP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP

Sequence 1 AGSCCXKXLSSA--------------------------------------
           A--CC---------------------------------------------
Sequence 2 A-ACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 ------------------
           ------------------
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 48.65 (18/37)
Sequence 1 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA-------------
           ---CGQV-SAL-PCI--L-K-G-VP-G-CC--------------------
Sequence 2 -LSCGQVNSALAPCITFLTK-GGVPSGPCCSGVRGLLGAAKTTADRQAAC

Sequence 1 --------------------------------------------
           --------------------------------------------
Sequence 2 NCLKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF



Alignment 8
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 48.65 (18/37)
Sequence 1 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA-------------
           --TCGQV-SAL-PCI-Y----GAVP---CC--------------------
Sequence 2 -ITCGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAAC

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 NCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 43.24 (16/37)
Sequence 1 -----------------------TVTCGQVASALSPCIDYLQKDGAVPAG
           -------------------------TCGQV-SAL-PC--YL---G--P--
Sequence 2 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA

Sequence 1 SCCXKXLSSA----------------------------------------
           -CC-----------------------------------------------
Sequence 2 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NIPYKISLSTNCATVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 45.95 (17/37)
Sequence 1 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA-------------
           --TCGQV-S-L-PCI-Y----GAVP---CC--------------------
Sequence 2 -ITCGQVSSNLAPCINYVKGGGAVPP-ACCNGIRNVNNLARTTADRRAAC

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 NCLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 48.65 (18/37)
Sequence 1 -----------------------TVTCGQVASALSPCIDYLQKDGAVPAG
           -------------------------TCGQV-S-L-PC---LQ--G-VPAG
Sequence 2 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG

Sequence 1 SCCXKXLSSA----------------------------------------
           -CC-----------------------------------------------
Sequence 2 -CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NIPYKISTSTNCASIN



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 45.95 (17/37)
Sequence 1 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA-------------
           --TCGQV-S-L-PCI-Y----GAVP---CC--------------------
Sequence 2 -ITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTAC

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 NCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 45.95 (17/37)
Sequence 1 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA-------------
           --TCGQV-S-L-PCI-Y----GAVP---CC--------------------
Sequence 2 -ITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAAC

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 NCLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 45.95 (17/37)
Sequence 1 -----------------------TVTCGQVASALSPCIDYLQKDGAVPAG
           -------------------------TCGQV-S-L-PCI-Y----GAVP--
Sequence 2 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPP-

Sequence 1 SCCXKXLSSA----------------------------------------
           -CC-----------------------------------------------
Sequence 2 ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NVPYKISTSTNCATVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 43.24 (16/37)
Sequence 1 ---------------------------TVTCGQVASALSPCIDYLQKDGA
           ------------------------------CGQVASA--PCI-Y----G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VPAGSCCXKXLSSA------------------------------------
           -P---CC----S--------------------------------------
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 --------------------
           --------------------
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 16
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 43.24 (16/37)
Sequence 1 ---------------------------TVTCGQVASALSPCIDYLQKDGA
           ------------------------------CGQVASA--PCI-Y----G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VPAGSCCXKXLSSA------------------------------------
           -P---CC----S--------------------------------------
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 ----------------------------
           ----------------------------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 17
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 45.95 (17/37)
Sequence 1 -----------------------TVTCGQVASALSPCIDYLQKDGAVPAG
           --------------------------CGQV-SAL-PCI--L-K-GA-P--
Sequence 2 MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGA-PPP

Sequence 1 SCCXKXLSSA----------------------------------------
           -CC-----------------------------------------------
Sequence 2 ACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGV

Sequence 1 -----------------
           -----------------
Sequence 2 SIPYKISTSTNCATIKF



Alignment 18
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 40.54 (15/37)
Sequence 1 -------------------------TVTCGQVASALSPCIDYLQKDGAVP
           ---------------------------TCGQV-----PC--Y----GAVP
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP

Sequence 1 AGSCCXKXLSSA--------------------------------------
           A--CC---------------------------------------------
Sequence 2 A-ACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKC

Sequence 1 ------------------
           ------------------
Sequence 2 GVSVPYKISTSTNCATVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 48.65 (18/37)
Sequence 1 -------------------------TVTCGQVASALSPCIDYLQKDGAVP
           ----------------------------CGQV-S-L--CI--L-K-G-VP
Sequence 2 MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP

Sequence 1 AGSCCXKXLSSA--------------------------------------
           A-SCC----S----------------------------------------
Sequence 2 A-SCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKC

Sequence 1 -------------------
           -------------------
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 20
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 45.95 (17/37)
Sequence 1 -------------------------TVTCGQVASALSPCIDYLQKDGAVP
           ---------------------------TCGQV-S-L-PCI-Y----GAVP
Sequence 2 MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVP

Sequence 1 AGSCCXKXLSSA--------------------------------------
           ---CC---------------------------------------------
Sequence 2 P-ACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKC

Sequence 1 ------------------
           ------------------
Sequence 2 GVNVPYKISPSTNCATVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 37.84 (14/37)
Sequence 1 TVTCGQVASALSPCIDYLQKDG-AVPAGSCCXKXLSSA
           --TC-QV---L-PC--YL---G---P-G-CC-------
Sequence 2 SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVKL--



Alignment 22
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 40.54 (15/37)
Sequence 1 -----------------------TVTCGQVASALSPCIDYLQKDGAVPAG
           -------------------------TC-QV---L-PCI-Y----GAVP--
Sequence 2 MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVPP-

Sequence 1 SCCXKXLSSA----------------------------------------
           -CC-----------------------------------------------
Sequence 2 ACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NVPYKISTSTNCATVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 48.65 (18/37)
Sequence 1 -------------------------TVTCGQVASALSPCIDYLQKDGAVP
           ---------------------------TC--V----SPC--YL-K-G-VP
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 AGSCCX--KXLSSA------------------------------------
           A--CC---K-L--A------------------------------------
Sequence 2 A-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 ------------------
           ------------------
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 24
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 37.84 (14/37)
Sequence 1 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA-
           --TC--V----SPC--YL---G-VPA--CC--------
Sequence 2 ALTCSDVSNKISPCLSYLKQGGEVPA-DCCAGVKGLND


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.