The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Pha a 5

Sequence P56165

Full FASTA alignment

Sequence name:
Query sequence:
MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD
RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAI
EVITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSS
FNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALK
KAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPAAVA
GGYKV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Pha a 5P56165Go!305413.25.1e-117
2Lol p 5AAD20386Go!301169.51.1e-43
3Poa p 5.0101Q9FPR0Go!303156.78.3e-40
4Sec c 5.0101CBG76811Go!292152.21.7e-38
5Phl p 5.0101CAA52753Go!312151.62.8e-38
6Poa p 5P22285Go!333150.66.2e-38
7Phl p 5.0109CAD87529Go!284147.64.2e-37
8Phl p 5.0107AAC16527Go!276147.44.8e-37
9Phl p 5.0102Q40962Go!286146.77.6e-37
10Phl p 5.0106AAC16526Go!276144.05.0e-36
11Poa p 5P22284Go!373144.35.5e-36
12Phl p 5.0108AAC16528Go!276142.91.0e-35
13Phl p 5AAK25823Go!275142.71.2e-35
14Dac g 5.02AAK62277Go!265141.03.7e-35
15Phl p 5.0105AAC16525Go!276140.84.5e-35
16Poa p 5P22286Go!307140.84.9e-35
17Lol p 5Q40237Go!339140.95.3e-35
18Dac g 5.01AAK62276Go!265138.52.2e-34
19Phl p 5.0104CAB05372Go!276137.06.2e-34
20Phl p 5.0202CAB05371Go!281136.01.3e-33
21Phl p 5.0201Q40963Go!284134.73.2e-33
22Hol l 5.0101CAB10765Go!264134.04.6e-33
23Phl p 5.02059249029Go!265130.94.2e-32
24Phl p 5.0204AAC25996Go!265130.94.2e-32
25Hol l 5.0201CAB10766Go!240126.86.2e-31
26Pha a 5P56164Go!320124.06.1e-30
27Pha a 5P56166Go!294120.65.9e-29
28Pha a 5P56167Go!175119.66.9e-29
29Hor v 5.0101U57845Go!313120.47.2e-29
30Lol p 5Q40240Go!308117.84.1e-28
31Phl p 6.0101P43215Go!13238.31.6e-04
32Phl p 6.0102CAA76556Go!13838.11.9e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56165
Sequence identity: 100.00 (305/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
Sequence 2 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP

Sequence 1 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD
           QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD
Sequence 2 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD

Sequence 1 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAI
           RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAI
Sequence 2 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAI

Sequence 1 EVITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSS
           EVITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSS
Sequence 2 EVITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSS

Sequence 1 FNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALK
           FNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALK
Sequence 2 FNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALK

Sequence 1 KAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPAAVA
           KAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPAAVA
Sequence 2 KAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPAAVA

Sequence 1 GGYKV
           GGYKV
Sequence 2 GGYKV



Alignment 2
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: AAD20386
Sequence identity: 52.46 (160/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASATLATPA-TPAA
           MAVQKYTVALFLAVALVAGPAA-YA-D-GY---TPAA-AT-ATPA-TPAA
Sequence 2 MAVQKYTVALFLAVALVAGPAASYAADAGY---TPAAAATPATPAATPAA

Sequence 1 SPQHAGTTEYHIVR--KAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVH
           ----A-T-E--------AG------AA-------K----I----F--S--
Sequence 2 AGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKF--KIFEAAFSES--

Sequence 1 CRADRLPVCSSTSAHS--SKQDVAWMLGYGSIQGFSMD---DASVGSVSS
           -----L---S---A-----K-D-A----Y----G-------DA-V-----
Sequence 2 --SKGLLATSAAKAPGLIPKLDTAYDVAYKAAEGATPEAKYDAFVTALTE

Sequence 1 EFHVIESAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADE
           ---VI--A-EV-------EEV----IP-GE-----K--AAF--AATAA--
Sequence 2 ALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANA

Sequence 1 APANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATA
           AP-NDKFTVF-S-FNKA--E-TGGAY--YKFIP-LEAAVKQAYAA--A-A
Sequence 2 APTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAA

Sequence 1 PEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPP
           PEVKYAVFE-AL-KAI-AM--AQK--KPAAA------T-----AT-AA--
Sequence 2 PEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATGAATVATGAATAAA--

Sequence 1 PPQLGTATPAAVAGGYKV
           ----G-AT--A-AGGYK-
Sequence 2 ----GAAT--AAAGGYKA



Alignment 3
Sequence 1:
Sequence 2: Allergen Poa p 5.0101, Sequence: Q9FPR0
Sequence identity: 48.20 (147/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASATLATPATPAAS
           MAVQKYTVALFL-VALVAGPAA-YA-D-GYAPATPAA----A---TP---
Sequence 2 MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITP--T

Sequence 1 PQHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRA
           -------------KA-------A-----D--K---------F--SV---A
Sequence 2 QEQKLMEDINVGFKAAVAAAAGAP--PADKFKTFQAA----FSASVEASA

Sequence 1 DRLPVCSSTS--AH-SSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVI
           --L----------H-----D-------G-------D---V---------I
Sequence 2 AKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFD-SFVAAFTEALRII

Sequence 1 ESAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAPAND
           -----V-----I-EE-----IPAGE---I-K--AAF--AATAA--APAND
Sequence 2 AGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPAND

Sequence 1 KFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKY
           KFTVF---FN-AIKE-TGGAY--YK-IP-LEAAVKQAYAA--A-APEVK-
Sequence 2 KFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKF

Sequence 1 AVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLG
           AVF--AL-KAI-AM-E-QK--KP-A---AAT----A-TA---A------G
Sequence 2 AVFKAALTKAITAMAEVQKVSKPVAG--AATVAAGAATAATGAATGAA-G

Sequence 1 TATPAAV--AGGYKV
           -AT-AA---AGGYKV
Sequence 2 AATGAATVSAGGYKV



Alignment 4
Sequence 1:
Sequence 2: Allergen Sec c 5.0101, Sequence: CBG76811
Sequence identity: 47.54 (145/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           MAVQ-YTVALFLAVALVAGPA--Y----YAPA-P-------TP-------
Sequence 2 MAVQQYTVALFLAVALVAGPAVSYGT--YAPAAPGTQPKATTPEQKLMEN

Sequence 1 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKS-----V
           ---G--------KA----E--AA----D--K----------NK-------
Sequence 2 INNGF-------KAAV--EAAAAVAPADKYKTFQTTFIKGSNKAFADVLT

Sequence 1 HCRADRLPVCSSTSAH-SSKQDVAWMLGYGSIQGFSMD---DASVGSVSS
           -------P--S---A--S--------L-Y-S--G-------D--V-S---
Sequence 2 AAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTE

Sequence 1 EFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAP
           ---VI--A-EV-------EEVK--PA----V-----AA--TAATAA--AP
Sequence 2 SLRVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAP

Sequence 1 ANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPE
           -NDKF-VF-SSFNKAIKE-TGGAYA-Y-F-P-LE-AVKQAYAA--A-APE
Sequence 2 TNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPE

Sequence 1 VKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPP
           VKYAVF--AL-KAI-AM-EA-K-AKPAAA--AAT-T--A-----------
Sequence 2 VKYAVFQAALSKAINAMVEAEKDAKPAAA-AAATATATAT----------

Sequence 1 QLGTATPAAVAGGYKV
           --G-A--AA-AGGYK-
Sequence 2 -VGAAAGAA-AGGYKA



Alignment 5
Sequence 1:
Sequence 2: Allergen Phl p 5.0101, Sequence: CAA52753
Sequence identity: 55.74 (170/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASATLATPATPAA-
           MAV--YTVALFLAVALVAGPAA-YA-D-GY-PATPAA-A---TPATPAA-
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADLGYGPATPAAPAAGYTPATPAAP

Sequence 1 ---SPQ-HAGTTEYHIVRK--AGLNEEKNAARQTDDEQKRSDEI------
           ----P---A-T-E-----K--AG------AA-------K-----------
Sequence 2 AEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAA

Sequence 1 NCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---D
           ----F--------------SS--A--SK-D-A--L-Y----G-------D
Sequence 2 SNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYD

Sequence 1 ASVGSVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTA
           A-V---S-----I----EV-------EEVKVIPAGE--VI-KV-AAF--A
Sequence 2 AYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVA

Sequence 1 ATAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYA
           ATAA--APANDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQAYA
Sequence 2 ATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYA

Sequence 1 ASSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISA-ATTTISAST
           A--ATAPEVKY-VFETALKKAI-AMSEAQK-AKPAAA--A-AT----A-T
Sequence 2 ATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAAT

Sequence 1 ATPAAPPPPQLGTATPAAVAGGYKV
           -----------G-AT--A--GGYKV
Sequence 2 -----------GAAT--AATGGYKV



Alignment 6
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22285
Sequence identity: 55.08 (168/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGD-GYA-------PATPAASATLAT
           MAV--YTVALFLAVALVAGPAA-YA-D-GY--------PATPAA-A---T
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAAPAAGYT

Sequence 1 PATPAASPQHAGTTEYHIVRK--AGLNEEKNAARQTDDEQKRSDEI----
           PA-PA-----A-T-E-----K--AG------AA-------K---------
Sequence 2 PAAPAGAAPKATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFG

Sequence 1 --NCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD--
           ------F--------------SS-----SK-D-A--L-Y-S--G------
Sequence 2 TASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGATPEAK

Sequence 1 -DASVGSVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFS
           -DA-V---S-----I----EV------GEEVK-IPAGE--VI-KV-AAF-
Sequence 2 YDAYVATLSEALRIIAGTLEVHAVKPAGEEVKAIPAGELQVIDKVDAAFK

Sequence 1 TAATAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQA
           -AATAA--APANDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQ-
Sequence 2 VAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQS

Sequence 1 YAASSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISA--------
           YAA--ATAP-VKY-VFETALKKAI-AMS-AQK-AKPAAA--A--------
Sequence 2 YAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTATATGAVGA

Sequence 1 ATTTISAST-ATPAAPPPPQLGTATPAAVAGGYKV
           AT----A-T-A--AA------G-ATP-A--GGYKV
Sequence 2 ATGAVGAATGAATAAAGGYKTGAATPTA--GGYKV



Alignment 7
Sequence 1:
Sequence 2: Allergen Phl p 5.0109, Sequence: CAD87529
Sequence identity: 48.20 (147/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPA-AS
           ------------------------A--GY-PATPAA-A---TPA-PA-A-
Sequence 2 ------------------------ADLGYGPATPAAPAAGYTPAAPAGAE

Sequence 1 PQ-HAGTTEYHIVRK--AGLNEEKNAARQTDDEQKRSDEI------NCPD
           P---A-T-E-----K--AG------AA-------K---------------
Sequence 2 PAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVATFGAASNKA

Sequence 1 FNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVG
           F--------------SS--A--SK-D-A--L-Y----G-------DA-V-
Sequence 2 FAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVA

Sequence 1 SVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAA
           --S-----I----EV-------EEVKVIPAGE--VI-KV-AAF--AATAA
Sequence 2 TLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAA

Sequence 1 DEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSA
           --APANDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQAYAA--A
Sequence 2 NAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVA

Sequence 1 TAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISA-ATTTISASTATPA
           TAPEVKY-VFETALKKAI-AMSEAQK-AKPAAA--A-AT----A-T----
Sequence 2 TAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATSAVGAAT----

Sequence 1 APPPPQLGTATPAAVAGGYKV
           -------G-AT--A--GGYKV
Sequence 2 -------GAAT--AATGGYKV



Alignment 8
Sequence 1:
Sequence 2: Allergen Phl p 5.0107, Sequence: AAC16527
Sequence identity: 45.90 (140/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYA-PATPAASATLATPATPAAS
           ------------------------A--GY--PATPAA-A-----A-PA--
Sequence 2 ------------------------ADLGYGGPATPAAPAE----AAPAGK

Sequence 1 PQHAGTTEYHIVRKA--GLNEEKNAARQTDDEQKRSDEI------NCPDF
           ---A-T-E-----K---G------AA-------K---------------F
Sequence 2 ---ATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAF

Sequence 1 NKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGS
           --------------SS--A--SK-D-A--L-Y----G-------DA-V--
Sequence 2 AEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT

Sequence 1 VSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAAD
           -S-----I----EV-------EEVKVIPAGE--VI-KV--AF--AATAA-
Sequence 2 LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAAN

Sequence 1 EAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSAT
           -APANDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQAYAA--AT
Sequence 2 AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVAT

Sequence 1 APEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAP
           APEVKY-VFETALKKAI-AMSEAQK-AKPAAA--A------A--A--AA-
Sequence 2 APEVKYTVFETALKKAITAMSEAQKAAKPAAAATA-----TATSAVGAA-

Sequence 1 PPPQLGTATPAAVAGGYKV
           ------T----A-AGGYKV
Sequence 2 ------TGATTAAAGGYKV



Alignment 9
Sequence 1:
Sequence 2: Allergen Phl p 5.0102, Sequence: Q40962
Sequence identity: 48.85 (149/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAA--
           ------------------------A--GY-PATPAA-A---TPATPAA--
Sequence 2 ------------------------ADLGYGPATPAAPAAGYTPATPAAPA

Sequence 1 ---SPQHAGTTEYHIVRK--AGLNEE-KNAARQTDDEQKRSDEINCPDFN
           -------A-T-E-----K--AG-------A--Q--D----------P--N
Sequence 2 GADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASN

Sequence 1 KSVHCRADRLPV----CSSTSAHSSKQDVAWMLGYGSIQGFSMD---DAS
           K---------P------SS--A--SK-D-A--L-Y----G-------DA-
Sequence 2 KAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAY

Sequence 1 VGSVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAAT
           V---S-----I----EV-------EEVKVIPAGE--VI-KV-AAF--AAT
Sequence 2 VATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAAT

Sequence 1 AADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAAS
           AA--APANDKFTVF---FN--IK--TGGAY--YKFIP-LEAAVKQAYAA-
Sequence 2 AANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAAT

Sequence 1 SATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISA-ATTTISASTAT
           -ATAPEVKY-VFETALKKAI-AMSEAQK-AKPAAA--A-AT----A-T--
Sequence 2 VATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAAT--

Sequence 1 PAAPPPPQLGTATPAAVAGGYKV
           ---------G-AT--A--GGYKV
Sequence 2 ---------GAAT--AATGGYKV



Alignment 10
Sequence 1:
Sequence 2: Allergen Phl p 5.0106, Sequence: AAC16526
Sequence identity: 45.57 (139/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYA-PATPAASATLATPATPAAS
           ------------------------A--GY--PATPAA-A-----A-PA--
Sequence 2 ------------------------ADLGYGGPATPAAPAE----AAPAGK

Sequence 1 PQHAGTTEYHIVRKA--GLNEEKNAARQTDDEQKRSDEI------NCPDF
           ---A-T-E-----K---G------AA-------K---------------F
Sequence 2 ---ATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAF

Sequence 1 NKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGS
           --------------SS--A--SK-D-A--L-Y----G-------DA-V--
Sequence 2 AEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT

Sequence 1 VSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAAD
           -S-----I----EV-------EEVKVIPAGE--VI-KV--AF--AATAA-
Sequence 2 LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAAN

Sequence 1 EAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSAT
           -APANDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQAYAA--AT
Sequence 2 AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVAT

Sequence 1 APEVKYAVFETALKKAISAMSEAQKEAKPAA-AISAATTTISASTATPAA
           APEVKY-VFETALKKAI-AMSEAQK-AKPA--A---AT----A-T-----
Sequence 2 APEVKYTVFETALKKAITAMSEAQKAAKPATEATATATAAVGAAT-----

Sequence 1 PPPPQLGTATPAAVAGGYKV
           ------G-AT--A--GGYKV
Sequence 2 ------GAAT--AATGGYKV



Alignment 11
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22284
Sequence identity: 46.56 (142/305)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSGPDAVGFAKK

Sequence 1 -----------------------MAVQKYTVALFLAVALVAGPAALYAGD
           ------------------------------V--F-A-A--A-PA------
Sequence 2 LDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKAPPASKF---

Sequence 1 GYAPATPAASATLATPATPAASPQHAGTTEYHIVRK--AGLNEEKNAARQ
           ---PA-PA------TPA-PA-----A-T-E-----K---G------AA--
Sequence 2 ---PAKPAPKVAAYTPAAPAGAAPKATTDEQKLIEKINVGFKAAVAAAAG

Sequence 1 TDDEQKRSDEI------NCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAW
           -----K---------------F------------V-SS-----SK-D-A-
Sequence 2 VPAASKYKTFVATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAY

Sequence 1 MLGYGSIQGFSMD---DASVGSVSSEFHVIESAIEV--ITYIGEEVKVIP
           -L-Y-S--G-------DA-V---S-----I----EV-------EEVK-IP
Sequence 2 KLAYKSAEGATPEAKYDAYVATLSEALRIIAGTLEVHGVKPAAEEVKAIP

Sequence 1 AGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSSFNKAIKETTGGAYA
           AGE--VI-KV-AAF--AATAA--APANDKFTVF---FN-AIK--TGGAY-
Sequence 2 AGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQ

Sequence 1 GYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALKKAISAMSEAQKEAK
           -YKFIP-LEAAVKQ-YAA--ATAP-VKY-VFETALKKAI-AMS-AQK-AK
Sequence 2 SYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAK

Sequence 1 PAAAISA-ATTTISASTATPAAPPPPQLGTATPAAVAGGYKV
           PAAA----AT----A-T-----------G-AT--A-AGGYKV
Sequence 2 PAAAVTGTATSAVGAAT-----------GAAT--AAAGGYKV



Alignment 12
Sequence 1:
Sequence 2: Allergen Phl p 5.0108, Sequence: AAC16528
Sequence identity: 45.25 (138/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYA-PATPAASATLATPATPAAS
           ------------------------A--GY--PATPAA-A-----A-PA--
Sequence 2 ------------------------ADLGYGGPATPAAPAE----AAPAGK

Sequence 1 PQHAGTTEYHIVRKA--GLNEEKNAARQTDDEQKRSDEI------NCPDF
           ---A-T-E-----K---G------AA-------K---------------F
Sequence 2 ---ATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAF

Sequence 1 NKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGS
           --------------SS--A--SK-D-A--L-Y----G-------DA-V--
Sequence 2 AEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT

Sequence 1 VSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAAD
           -S-----I----EV-------EEVKVIPAGE--VI-KV--AF--AATAA-
Sequence 2 LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAAN

Sequence 1 EAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSAT
           -APANDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQAYAA--AT
Sequence 2 AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVAT

Sequence 1 APEVKYAVFETALKKAISAMSEAQKEAKPAA-AISAATTTISASTATPAA
           APEVKY-VFETALKKA--AMSEAQK-AKPA--A---AT----A-T-----
Sequence 2 APEVKYTVFETALKKAFTAMSEAQKAAKPATEATATATAAVGAAT-----

Sequence 1 PPPPQLGTATPAAVAGGYKV
           ------G-AT--A--GGYKV
Sequence 2 ------GAAT--AATGGYKV



Alignment 13
Sequence 1:
Sequence 2: Allergen Phl p 5, Sequence: AAK25823
Sequence identity: 43.28 (132/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           --------------------------------T---------PATP---P
Sequence 2 ----------------------------PISVTAPPPQLPRPPATPPPPP

Sequence 1 Q-HAGTTEYHIVRKAGLNEEKNAARQTDDEQK----RSDEINCPDFNKSV
           ----G---Y----------E--A-----D----------------F----
Sequence 2 PPQLGASPYKLGPSPKARSERPAIVPPADKYRTFVATFGAASNKAFAEGL

Sequence 1 HCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSE
           ----------SS--A--SK-D-A--L-Y----G-------DA-V---S--
Sequence 2 SGEPKGGAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA

Sequence 1 FHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPA
           ---I----EV-------EEVKVIPAGE--VI-KV-AAF--AATAA--APA
Sequence 2 LRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPA

Sequence 1 NDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEV
           NDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQAYAA--ATAPEV
Sequence 2 NDKFTVFEAAFNNAIKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEV

Sequence 1 KYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQ
           KY-VFETALKKAI-AMSEAQK-AKPAAA--A--------TAT-A---P--
Sequence 2 KYTVFETALKKAITAMSEAQKAAKPAAAATA--------TATSAVGAP--

Sequence 1 LGTATPAAVAGGYKV
           --T----A-AGGYKV
Sequence 2 --TGATTAAAGGYKV



Alignment 14
Sequence 1:
Sequence 2: Allergen Dac g 5.02, Sequence: AAK62277
Sequence identity: 42.30 (129/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           -----------------------------------A--T-A--ATPAA--
Sequence 2 ---------------------------------ADAGYTPAAAATPAAAG

Sequence 1 QHAGTTEYHIVR--KAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCR
           --A-T-E--------AG------AA----------D------------C-
Sequence 2 GKAMTEEQKLIEDVNAGFKAAVAAASSAPP----ADKFKTFEATFTAACK

Sequence 1 ADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHV
           A--------------K-D-A----Y----G-------DA-V--------V
Sequence 2 ANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRV

Sequence 1 IESAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAPAN
           I--A-EV-------EEV----IPAGE-----K--AA---AATAA--APAN
Sequence 2 IAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPAN

Sequence 1 DKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVK
           DKFTVF---FNKAIKE-TGGAY--YKFIPTLEAAVKQAYAA--A-APEVK
Sequence 2 DKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVK

Sequence 1 YAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQL
           YAVFE-AL-KAI-AMSEAQK-A-PAAA---A-T---AS-AT-AA------
Sequence 2 YAVFEAALTKAITAMSEAQKVATPAAAATGAATA-AASAATGAA------

Sequence 1 GTATPAAVAGGYKV
           ------A-AGGYKV
Sequence 2 -----TAAAGGYKV



Alignment 15
Sequence 1:
Sequence 2: Allergen Phl p 5.0105, Sequence: AAC16525
Sequence identity: 44.92 (137/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYA-PATPAASATLATPATPAAS
           ------------------------A--GY--PATPAA-A-----A-PA--
Sequence 2 ------------------------ADLGYGGPATPAAPAE----AAPAGK

Sequence 1 PQHAGTTEYHIVRKA--GLNEEKNAARQTDDEQKRSDEI------NCPDF
           ---A-T-E-----K---G------AA-------K---------------F
Sequence 2 ---ATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAF

Sequence 1 NKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGS
           --------------SS--A--SK-D-A--L-Y----G-------DA-V--
Sequence 2 AEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVAT

Sequence 1 VSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAAD
           -S-----I----EV-------EEVKVIPAGE--VI-KV--A---AATAA-
Sequence 2 LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSALKVAATAAN

Sequence 1 EAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSAT
           -APANDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQAYAA--AT
Sequence 2 AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVAT

Sequence 1 APEVKYAVFETALKKAISAMSEAQKEAKPAA-AISAATTTISASTATPAA
           APEVKY-VFETALKKAI-A-SEAQK-AKPA--A---AT----A-T-----
Sequence 2 APEVKYTVFETALKKAITATSEAQKAAKPATEATATATAAVGAAT-----

Sequence 1 PPPPQLGTATPAAVAGGYKV
           ------G-AT--A--GGYKV
Sequence 2 ------GAAT--AATGGYKV



Alignment 16
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22286
Sequence identity: 53.11 (162/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGD-GY-APATPAASATLATPATPAA
           MAVQKYTVALFL-VALV-GPAA-YA-D--Y-APATPAA-A---TPA-PA-
Sequence 2 MAVQKYTVALFL-VALVVGPAASYAADLSYGAPATPAAPAAGYTPAAPAG

Sequence 1 SPQHAGTTEYHIVRK--AGLNEEKNAARQTDDEQKRSDEI------NCPD
           ----A-T-E-----K---G------AA-------K---------------
Sequence 2 AAPKATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAASNKA

Sequence 1 FNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVG
           F------------V-SS--A--SK-D-A--L-Y-S--G-------D--V-
Sequence 2 FAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKYDDYVA

Sequence 1 SVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAA
           --S-----I----EV-------EEVK--PAGE--VI-KV-AAF--AATAA
Sequence 2 TLSEALRIIAGTLEVHGVKPAAEEVKATPAGELQVIDKVDAAFKVAATAA

Sequence 1 DEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSA
           --APANDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQ-YAA--A
Sequence 2 NAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVA

Sequence 1 TAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISA-ATTTISASTATPA
           TAP-VKY-VFETALKKAI-AMS-AQK-AKPAAA----AT----A-T----
Sequence 2 TAPAVKYTVFETALKKAITAMSQAQKAAKPAAAATGTATAAVGAAT----

Sequence 1 APPPPQLGTATPAAVAGGYKV
           -------G-AT--A-AGGYKV
Sequence 2 -------GAAT--AAAGGYKV



Alignment 17
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40237
Sequence identity: 58.36 (178/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPA---ASATLATPATP
           MAVQK-TVALFLAVALVAGPAA-YA-D-GYAPATPA---A-AT-ATPATP
Sequence 2 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP

Sequence 1 A--ASPQ-----HAGTTEYHIVRK--AGLNEEKNAAR--QTDDEQKRSDE
           A--A-P-------A-T-E-----K--AG------AA------D--K---E
Sequence 2 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE

Sequence 1 INCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---
           ------NK-------------S-----SK-D-A--L-Y---QG-------
Sequence 2 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY

Sequence 1 DASVGSVSSEFHVIESAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAF
           DA-V--------VI----EV-------EEVKV--IPA-EV--I-KV-AA-
Sequence 2 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY

Sequence 1 STAATAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQ
           -TAATAA--APANDKFTVF---FN-AIK---G-AY--YKFIPTL-AAVKQ
Sequence 2 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ

Sequence 1 AYAASSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISA
           AYAA--ATAPEVKY-V-ETALKKA--AMSEA-KEA-PAAA--A--T---A
Sequence 2 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA

Sequence 1 S-TATPAAP-----PPPQLGTATPAAV------AGGYKV
           --TATPAA------P-----TATPAA-------AGGYKV
Sequence 2 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV



Alignment 18
Sequence 1:
Sequence 2: Allergen Dac g 5.01, Sequence: AAK62276
Sequence identity: 41.64 (127/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           -----------------------------------A--T-A--ATPA---
Sequence 2 ---------------------------------ADAGYTPAAAATPATAG

Sequence 1 QHAGTTEYHIVR--KAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCR
           --A-T-E--------AG------AA----------D------------C-
Sequence 2 GKAMTEEQTLIEDVNAGFKAAVAAASSAPP----ADKFKTFEATFTAACK

Sequence 1 ADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHV
           A--------------K-D-A----Y----G-------DA-V--------V
Sequence 2 ANIAAAATKVPLFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTEALRV

Sequence 1 IESAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAPAN
           I--A-EV-------EEV----IPAGE-----K--AA---AATAA--APAN
Sequence 2 IAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPAN

Sequence 1 DKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVK
           DKFTVF---FNKAIKE-TGGAY--YKFIPTLEAAVKQAYAA--A-APEVK
Sequence 2 DKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVK

Sequence 1 YAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQL
           YAVFE-AL-KAI-AMSEAQK-A-PAA----A-T---AS-AT-AA------
Sequence 2 YAVFEAALTKAITAMSEAQKVATPAAVATGAATA-AASAATGAA------

Sequence 1 GTATPAAVAGGYKV
           ------A-AGGYKV
Sequence 2 -----TAAAGGYKV



Alignment 19
Sequence 1:
Sequence 2: Allergen Phl p 5.0104, Sequence: CAB05372
Sequence identity: 44.26 (135/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYA-PATPAASATLATPATPAAS
           ------------------------A--GY--PATPAA-A-----A-PA--
Sequence 2 ------------------------ADLGYGGPATPAAPAE----AAPAGK

Sequence 1 PQHAGTTEYHIVRKA--GLNEEKNAARQTDDEQKRSDEI------NCPDF
           ---A-T-E-----K---G------AA-------K---------------F
Sequence 2 ---ATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAF

Sequence 1 NKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGS
           --------------SS--A--SK---A--L-Y----G-------DA-V--
Sequence 2 AEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVAT

Sequence 1 VSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAAD
           -S-----I----EV-------EEVKVIPAGE---I-KV--A---AATAA-
Sequence 2 LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAAN

Sequence 1 EAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSAT
           -A-ANDKFTVF---FN-AIK--TGGAY--YKFIP-LEAAVKQAYAA--AT
Sequence 2 AAAANDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVAT

Sequence 1 APEVKYAVFETALKKAISAMSEAQKEAKPAA-AISAATTTISASTATPAA
           APEVKY-VFETALKKAI-AMSEAQK-AKPA--A---AT----A-T-----
Sequence 2 APEVKYTVFETALKKAITAMSEAQKAAKPATEATATATAAVGAAT-----

Sequence 1 PPPPQLGTATPAAVAGGYKV
           ------G-AT--A--GGYKV
Sequence 2 ------GAAT--AATGGYKV



Alignment 20
Sequence 1:
Sequence 2: Allergen Phl p 5.0202, Sequence: CAB05371
Sequence identity: 42.95 (131/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASATLATPATPAAS
           ------------------GP---YA-D-GYAPATPAA----A--AT----
Sequence 2 ---------AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKAT---T

Sequence 1 PQHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRA
           -------------KA-------AA-----------E-------K-----A
Sequence 2 EEQKLIEDINVGFKAAVAA---AASVPAGDKFKTFEAAFTSSSKAATAKA

Sequence 1 DRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHVI
           --L-----------K-D-A----Y----G-------D--V-S------VI
Sequence 2 PGL---------VPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVI

Sequence 1 ESAIEV--ITYIGEE--VKVIPAGEVEVINKVKAAFSTAATAADEAPAND
           --A-EV-------EE-----IPAGE---I-K--AAF--AATAA--APA-D
Sequence 2 AGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADD

Sequence 1 KFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKY
           KFTVF---FNKAIKE-TGGAY--YK-IP-LEAAVKQAYAA--A-AP-VKY
Sequence 2 KFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKY

Sequence 1 AVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLG
           AVFE-AL-KAI-AMSE-QK---PA----A------A-TAT-AA------G
Sequence 2 AVFEAALTKAITAMSEVQKVSQPATG-AATVAAGAATTATGAAS-----G

Sequence 1 TATPAAVAGGYKV
           -AT-AA--GGYKV
Sequence 2 AATVAA--GGYKV



Alignment 21
Sequence 1:
Sequence 2: Allergen Phl p 5.0201, Sequence: Q40963
Sequence identity: 43.61 (133/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASATLATPATPAAS
           --------A---------GP---Y--D-GYAPATPAA----A--AT----
Sequence 2 ------AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKAT---T

Sequence 1 PQHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRA
           -------------KA-------A-----D--K---------F--S----A
Sequence 2 EEQKLIEDINVGFKAAVAAA--ASVPAADKFKTFEAA----FTSSSKAAA

Sequence 1 DRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHVI
           ---P----------K-D-A----Y----G-------D--V-S------VI
Sequence 2 AKAP------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVI

Sequence 1 ESAIEV--ITYIGEE--VKVIPAGEVEVINKVKAAFSTAATAADEAPAND
           --A-EV-------EE-----IPAGE---I-K--AAF--AATAA--APA-D
Sequence 2 AGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADD

Sequence 1 KFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKY
           KFTVF---FNKAIKE-TGGAY--YK-IP-LEAAVKQAYAA--A-AP-VKY
Sequence 2 KFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKY

Sequence 1 AVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLG
           AVFE-AL-KAI-AMSE-QK---PA----AAT----A--AT-AA------G
Sequence 2 AVFEAALTKAITAMSEVQKVSQPATG--AAT--VAAGAATTAA------G

Sequence 1 TATPAA--VAGGYKV
           -A--AA---AGGYKV
Sequence 2 AASGAATVAAGGYKV



Alignment 22
Sequence 1:
Sequence 2: Allergen Hol l 5.0101, Sequence: CAB10765
Sequence identity: 42.62 (130/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           ------------------------A--GY-PA-PAA----------A---
Sequence 2 ------------------------ADAGYTPAAPAA----------AGAG

Sequence 1 QHAGTTEYHIVR--KAGLNEEKNAARQTD--DEQKRSDEINCPDFNKSVH
           --A-T-E--------AG------AA------D--K------------S--
Sequence 2 GKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSKASIA

Sequence 1 CRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEF
           --A---P--------------A----Y---QG-------DA-V-------
Sequence 2 AAATKAP------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEAL

Sequence 1 HVIESAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAP
           -VI--A-EV-------EEV----IPAGE-----K--AAF--AATAA--AP
Sequence 2 RVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAP

Sequence 1 ANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPE
           -NDKFTVF---FNKAIKE-TGGAY--YKFIP-LE-AVKQAYAA--ATAPE
Sequence 2 VNDKFTVFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPE

Sequence 1 VKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPP
           VKY-VFETALKKAI-AMSEAQKEAKP-AA---A-T------A--------
Sequence 2 VKYTVFETALKKAITAMSEAQKEAKPVAAATGAATAAAGVAA--------

Sequence 1 QLGTATPAAVAGGYKV
           --G-AT--A-AGGYKV
Sequence 2 --GAAT--AAAGGYKV



Alignment 23
Sequence 1:
Sequence 2: Allergen Phl p 5.0205, Sequence: 9249029
Sequence identity: 42.62 (130/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           ------------------------A--GYAPATPAA----A--AT-----
Sequence 2 ------------------------ADAGYAPATPAAAGAEAGKAT-----

Sequence 1 QHAGTTEYHIVR--KAGLNEEKNAARQTDDEQK-RSDEINCPDFNKSVHC
           ----T-E---------G-N----AA-------K----E-------K----
Sequence 2 ----TEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEAAFTSSSKAATA

Sequence 1 RADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFH
           -A--L-----------K-D-A----Y----G-------D--V-S------
Sequence 2 KAPGL---------VPKLDAAYSVAYKAAVGATPEAKFDSLVASLTEALR

Sequence 1 VIESAIEV--ITYIGEE--VKVIPAGEVEVINKVKAAFSTAATAADEAPA
           VI--A-EV-------EE-----IPAGE---I-K--AAF--AATAA--APA
Sequence 2 VIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPA

Sequence 1 NDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEV
           -DKFTVF---FNKAIKE-TGGAY--YK-IP-LEAAVKQ-YAA--A-AP-V
Sequence 2 DDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQPYAATVAAAPQV

Sequence 1 KYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQ
           KYAVFE-AL-KAI-AMSE-QK---PA----AAT----A--AT-AA-----
Sequence 2 KYAVFEAALTKAITAMSEVQKVSQPATG--AAT--VAAGAATTAA-----

Sequence 1 LGTATPAA--VAGGYKV
           -G-A--AA---AGGYKV
Sequence 2 -GAASGAATVAAGGYKV



Alignment 24
Sequence 1:
Sequence 2: Allergen Phl p 5.0204, Sequence: AAC25996
Sequence identity: 41.97 (128/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           ------------------------A--GYAPATPAA----A--AT-----
Sequence 2 ------------------------ADAGYAPATPAAAGAEAGKAT---TE

Sequence 1 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD
           ------------KA-------AA-----------E-------K-----A-
Sequence 2 EQKLIEDINVGFKAAVAA---AASVPAADKFKTFEAAFTSSSKAATAKAP

Sequence 1 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHVIE
           -L-----------K-D-A----Y----G-------D--V-S------VI-
Sequence 2 GL---------VPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIA

Sequence 1 SAIEV--ITYIGEE--VKVIPAGEVEVINKVKAAFSTAATAADEAPANDK
           -A-EV-------EE-----IPAGE---I-K--AAF--AATAA--APA-DK
Sequence 2 GALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDK

Sequence 1 FTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYA
           FTVF---FNKAIKE-TGGAY--YK-IP-LEAAVKQAYAA--A-AP-VKYA
Sequence 2 FTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYA

Sequence 1 VFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGT
           VFE-AL-KAI-AMSE-QK---PA----AAT----A--AT-AA------G-
Sequence 2 VFEAALTKAITAMSEVQKVSQPATG--AAT--VAAGAATTAA------GA

Sequence 1 ATPAA--VAGGYKV
           A--AA---AGGYKV
Sequence 2 ASGAATVAAGGYKV



Alignment 25
Sequence 1:
Sequence 2: Allergen Hol l 5.0201, Sequence: CAB10766
Sequence identity: 33.44 (102/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD
           ---------------------AA---------------------------
Sequence 2 ------QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQ

Sequence 1 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHVIE
           -----------SSK---A-M-------G-------DA-V--------VI-
Sequence 2 SKAEETKMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIA

Sequence 1 SAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAPANDK
           -A-EV-------EEV----IPAG---V--K--A-F--AATAA--APANDK
Sequence 2 GALEVHAVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDK

Sequence 1 FTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYA
           FTVF---FNKA-KE-TGGAY--YKFIP-LEAAVKQAYA---A-APEVKYA
Sequence 2 FTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYA

Sequence 1 VFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGT
           VFE-AL-KAI-AMS-AQK-A-PAAA---A-T---A--AT-AA--------
Sequence 2 VFEAALTKAITAMSQAQKVAQPAAAATGAAT-VAAGAATTAAGGYKV---

Sequence 1 ATPAAVAGGYKV
           ------------
Sequence 2 ------------



Alignment 26
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56164
Sequence identity: 43.93 (134/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           MAVQKYT-ALFLAVALVAGPAA--------P--P-------TP-TP---P
Sequence 2 MAVQKYTMALFLAVALVAGPAA--------PTPP-------TPRTPPLLP

Sequence 1 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHC--R
           -----------------E--NAA-----------------F---V-C---
Sequence 2 PPRARDKATLTSRS--VEDINAASRRPWWASVPPADKFKTFADHVLCVPN

Sequence 1 ADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHV
           AD-------------K-D-A----Y----G-------DA----------V
Sequence 2 ADVTSAATKAPQLKAKLDAAYRVAYEAAEGSTPEAKYDAFIAALTEALRV

Sequence 1 IESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDK
           I--A-EV-------EEV---P-GE-----K--AAF--AATAA--APANDK
Sequence 2 IAGAFEVHAVKPATEEVVADPVGELQIVDKIDAAFKIAATAANSAPANDK

Sequence 1 FTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYA
           FTVF---FNKAIKE-T-GAY--YKFIP-LEAAVKQAY-A--A-APEVKYA
Sequence 2 FTVFEGAFNKAIKESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYA

Sequence 1 VFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGT
           VFE--L-KAI-AMSEAQK-AKP-----------------P--P-PPQ---
Sequence 2 VFEAGLTKAITAMSEAQKVAKP-----------------PLSPQPPQV--

Sequence 1 ATPAAVAGGYKV--------------------------------------
           --P-A--G---V--------------------------------------
Sequence 2 -LPLAAGGAATVAAASDVRVCRSHGTLQDACLLRCRGGCQPVVWRGGSHR

Sequence 1 -------
           -------
Sequence 2 ARGGYKV



Alignment 27
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56166
Sequence identity: 42.30 (129/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           MAVQKYTVALFLA-ALVAGPAA-YA-D---P-TPA------TPA-P-A--
Sequence 2 MAVQKYTVALFLAMALVAGPAASYAADAGTPPTPA------TPAVPGAAA

Sequence 1 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD
           --A-T-E---------------A-----------E-----F-K-------
Sequence 2 GKATTHEQKLIEDINAAFKWWPASAPPADKYKTFETA---FSKA------

Sequence 1 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHVIE
           ---------A-----D-A----Y----G-------D--V-----------
Sequence 2 -----NIAGASTKGLDAAYSVVYNTAAGATPEAKYDSFVTALTEALRIMA

Sequence 1 SAIEVITYIGEEVKVIPAGEVEVIN----------KVKAAFSTA---ATA
           ---EV-----------P-------N----------K--A---T-----TA
Sequence 2 GTLEVHAVKPATEEEVPSAKILRANSRSSTRSSRFKIAATVATPLSHSTA

Sequence 1 ADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASS
           A--APANDKFTVF---FNKAIKE--GG----YKFIP-LEAAVKQAY-A--
Sequence 2 ANSAPANDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATV

Sequence 1 ATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPA
           A-APEVKYAVFE--L-KAI-AMSEAQK-AKP-------------S---P-
Sequence 2 ARAPEVKYAVFEAGLTKAITAMSEAQKVAKP----------VRLSPQPPQ

Sequence 1 APPPPQLGTATPAAVA---GGYKV
           --P----G-AT-AA-----GGYKV
Sequence 2 VLPLAAGGAATVAAASDSRGGYKV



Alignment 28
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56167
Sequence identity: 31.48 (96/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAI
           --------------------------------DA----------VI--A-
Sequence 2 -----------------------------AKYDAFIAALTEALRVIAGAF

Sequence 1 EV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAPANDKFTV
           EV-------EEV----IPAGE-----K--AAF--AATAA--APANDKFTV
Sequence 2 EVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTV

Sequence 1 FVSSFNKAIKETTGGAYAGYKFIPTLEAA-VKQAYAASSATAPEVKYAVF
           F---FNKAIKE--GGAY--YKFIP-LEA---KQAY-A--A-APEVKYAVF
Sequence 2 FEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVF

Sequence 1 ETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTAT
           E--L-KAI-AMSEAQK-AKP-----AA-----A--A--AA----------
Sequence 2 EAGLTKAITAMSEAQKVAKPVRSVTAA-----AAGAATAAGGAATVAASR

Sequence 1 PAAVAGGYKV
           P---AGGYKV
Sequence 2 PTS-AGGYKV



Alignment 29
Sequence 1:
Sequence 2: Allergen Hor v 5.0101, Sequence: U57845
Sequence identity: 33.44 (102/305)
Sequence 1 --------------------MAVQKYTVALFLAVALVAGPAALYAGDGYA
           -------------------------------L-V------A---------
Sequence 2 MANSGREHSAVPRRRNLVALVPRHGCYAEFSLYVCVGNINAPFPVFNRTT

Sequence 1 PATPAASATLATPATPAASPQHAGTTEYHIVRKAGLNEEKNAARQTDDEQ
           ----A-------P-------------------K-----------------
Sequence 2 FIANAGIEAELEPHFLLLLFTFSSSSSFFTLLKTMIHFTDRSDNKNKAMM

Sequence 1 KRSDEINCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFS
           -------------------------SS----SS-------L-Y---QG--
Sequence 2 RGREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGAT

Sequence 1 MD---DASVGSVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVK
           -----DA-V--------VI----EV-------EEVK--PAGE---I--V-
Sequence 2 PEAKYDAYVATLTESLRVISGTLEVHSVKPAAEEVKGVPAGELKAIDQVD

Sequence 1 AAFSTAATAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAA
           AAF-TAATAAD-APANDKFTVF-S----------GGAY--YKFIP-LEAA
Sequence 2 AAFRTAATAADAAPANDKFTVFESLQQGPSRKPRGGAYESYKFIPALEAA

Sequence 1 VKQAYAASSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTT
           VKQAYAA--A-APEVK--VF-TAL-KAI-AM--A-K-AKPAAA--A-T-T
Sequence 2 VKQAYAATVAAAPEVKFTVFQTALSKAINAMTQAGKVAKPAAAATA-TAT

Sequence 1 ISASTATPAAPPPPQLGTATPAAVAGGYKV
           --A--A--A---------------------
Sequence 2 VAAGAAATAGNYKV----------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40240
Sequence identity: 42.62 (130/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASATLATPATPAAS
           MAVQKYTVALFL------GP---YA-D-GY---TPAA-AT---PATPAA-
Sequence 2 MAVQKYTVALFLRRGPRGGPGRSYAADAGY---TPAAAAT---PATPAAT

Sequence 1 PQHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRA
           P--AG-------R-A----E----RQ------R------P--------R-
Sequence 2 P--AGGWREGDDRRA----EAAGGRQR--LASRQPWPPLPTPLRRTSSRS

Sequence 1 DRLP------VCSSTSAHSS-----KQDVAWMLGYGSIQGFSMDDAS--V
           -R-P--------S-TSA--------K-D-A----Y---------------
Sequence 2 SRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAEAHPRGQVRRLR

Sequence 1 GSVSSEFHVIESAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAA
           --------VI--A-EV-------EEV----IP-GE-----K--AAF--AA
Sequence 2 HCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAA

Sequence 1 TAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAA
           TAA--AP-NDKFTVF-S-FNKA--E-TGGA-------P------------
Sequence 2 TAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPP

Sequence 1 SSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTAT
           -S--APEVKYAVFE-AL-KAI-AM--AQK--KPAAA---A--T-----AT
Sequence 2 PSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAAT

Sequence 1 PAAP-PPPQLGTATPAAVAGGYKV
           -AA--PPP-L-----------Y--
Sequence 2 AAAVLPPPLLVVQSLISLLIYY--



Alignment 31
Sequence 1:
Sequence 2: Allergen Phl p 6.0101, Sequence: P43215
Sequence identity: 10.82 (33/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAI
           ------------------------------------------F-------
Sequence 2 --------------------------------------MVAMFLAVAVVL

Sequence 1 EVITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSS
           ---T----E-------E---I--V-A-F--A-------P--DK---F---
Sequence 2 GLATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAA

Sequence 1 FNKAIKETTGGAYA-GYKFIPTLEAAVKQAYAASSATAPEVKYAVFETAL
           F----K-----A--------P-L------AY-A----APE-KY--F----
Sequence 2 FTVSSKRNLADAVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHF

Sequence 1 KKA--ISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPA
           --A--I-A--------KP-A------------------------------
Sequence 2 SEALRIIAGTPEVHAVKPGA------------------------------

Sequence 1 AVAGGYKV
           --------
Sequence 2 --------



Alignment 32
Sequence 1:
Sequence 2: Allergen Phl p 6.0102, Sequence: CAA76556
Sequence identity: 10.82 (33/305)
Sequence 1 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAI
           ---------------------------------A--------F-------
Sequence 2 --------------------------------MAAHKFMVAMFLAVAVVL

Sequence 1 EVITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDKFTVFVSS
           ---T----E-------E---I----A-F--A-------P--DK---F---
Sequence 2 GLATSPTAEGGKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEAA

Sequence 1 FNKAIKETTGGAYA-GYKFIPTLEAAVKQAYAASSATAPEVKYAVFETAL
           F----K-----A--------P-L------AY-A----APE-KY--F----
Sequence 2 FTVSSKRNLADAVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHF

Sequence 1 KKA--ISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPA
           --A--I-A--------KP-A------------------------------
Sequence 2 SEALHIIAGTPEVHAVKPGA------------------------------

Sequence 1 AVAGGYKV
           --------
Sequence 2 --------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.