The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Pha a 5

Sequence P56167

Full FASTA alignment

Sequence name:
Query sequence:
AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKID
AAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEAS
RSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAA
GAATAAGGAATVAASRPTSAGGYKV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Pha a 5P56167Go!175215.45.7e-58
2Dac g 5.02AAK62277Go!265171.81.2e-44
3Dac g 5.01AAK62276Go!265171.21.7e-44
4Lol p 5AAD20386Go!301166.84.1e-43
5Hol l 5.0101CAB10765Go!264164.51.8e-42
6Hol l 5.0201CAB10766Go!240162.75.7e-42
7Pha a 5P56164Go!320163.06.2e-42
8Phl p 5.0204AAC25996Go!265159.84.6e-41
9Phl p 5.0201Q40963Go!284159.94.8e-41
10Phl p 5.0202CAB05371Go!281159.56.2e-41
11Poa p 5.0101Q9FPR0Go!303159.37.5e-41
12Phl p 5.02059249029Go!265157.32.6e-40
13Poa p 5P22285Go!333150.53.8e-38
14Phl p 5.0109CAD87529Go!284149.85.0e-38
15Phl p 5.0101CAA52753Go!312149.95.4e-38
16Phl p 5.0107AAC16527Go!276149.18.4e-38
17Phl p 5.0106AAC16526Go!276148.99.6e-38
18Phl p 5.0102Q40962Go!286148.71.1e-37
19Phl p 5AAK25823Go!275148.31.4e-37
20Phl p 5.0108AAC16528Go!276147.91.9e-37
21Pha a 5P56166Go!294147.92.0e-37
22Poa p 5P22284Go!373148.22.0e-37
23Poa p 5P22286Go!307147.43.0e-37
24Phl p 5.0105AAC16525Go!276145.01.4e-36
25Phl p 5.0104CAB05372Go!276144.61.8e-36
26Sec c 5.0101CBG76811Go!292136.45.9e-34
27Lol p 5Q40237Go!339130.15.5e-32
28Hor v 5.0101U57845Go!313125.89.8e-31
29Lol p 5Q40240Go!308120.44.1e-29
30Pha a 5P56165Go!305110.92.8e-26
31Phl p 6.0101P43215Go!13232.55.1e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56167
Sequence identity: 100.00 (175/175)
Sequence 1 AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKID
           AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKID
Sequence 2 AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKID

Sequence 1 AAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEAS
           AAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEAS
Sequence 2 AAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEAS

Sequence 1 RSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAA
           RSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAA
Sequence 2 RSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAA

Sequence 1 GAATAAGGAATVAASRPTSAGGYKV
           GAATAAGGAATVAASRPTSAGGYKV
Sequence 2 GAATAAGGAATVAASRPTSAGGYKV



Alignment 2
Sequence 1:
Sequence 2: Allergen Dac g 5.02, Sequence: AAK62277
Sequence identity: 81.71 (143/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADK

Sequence 1 -----------------------------------------------AKY
           -----------------------------------------------AKY
Sequence 2 FKTFEATFTAACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKY

Sequence 1 DAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAF
           DAF-AALTEALRVIAGA-EVHAVKPA-EEVPAAKIPAGELQIVDKIDAA-
Sequence 2 DAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAY

Sequence 1 KIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSK
           KIAATAAN-APANDKFTVFEGAFNKAIKE--GGAYE-YKFIP-LEA---K
Sequence 2 KIAATAANAAPANDKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAA-VK

Sequence 1 QAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAA
           QAY-ATVA-APEVKYAVFEA-LTKAITAMSEAQKVA-P----T-AA--AA
Sequence 2 QAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAAATGAATAAA

Sequence 1 TAAGGAATVAASRPTSAGGYKV
           -AA-GAAT-AA------GGYKV
Sequence 2 SAATGAATAAA------GGYKV



Alignment 3
Sequence 1:
Sequence 2: Allergen Dac g 5.01, Sequence: AAK62276
Sequence identity: 81.71 (143/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADAGYTPAAAATPATAGGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADK

Sequence 1 -----------------------------------------------AKY
           -----------------------------------------------AKY
Sequence 2 FKTFEATFTAACKANIAAAATKVPLFVAKLDAAYAVAYKTATGPTPEAKY

Sequence 1 DAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAF
           DAF-AALTEALRVIAGA-EVHAVKPA-EEVPAAKIPAGELQIVDKIDAA-
Sequence 2 DAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAY

Sequence 1 KIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSK
           KIAATAAN-APANDKFTVFEGAFNKAIKE--GGAYE-YKFIP-LEA---K
Sequence 2 KIAATAANAAPANDKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAA-VK

Sequence 1 QAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAA
           QAY-ATVA-APEVKYAVFEA-LTKAITAMSEAQKVA-P----T-AA--AA
Sequence 2 QAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAVATGAATAAA

Sequence 1 TAAGGAATVAASRPTSAGGYKV
           -AA-GAAT-AA------GGYKV
Sequence 2 SAATGAATAAA------GGYKV



Alignment 4
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: AAD20386
Sequence identity: 80.00 (140/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLAVALVAGPAASYAADAGYTPAAAATPATPAATPAAAGG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLAT

Sequence 1 -----------------------------AKYDAFIAALTEALRVIAGAF
           -----------------------------AKYDAF--ALTEALRVIAGA-
Sequence 2 SAAKAPGLIPKLDTAYDVAYKAAEGATPEAKYDAFVTALTEALRVIAGAL

Sequence 1 EVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTV
           EVHAVKPATEEVPAAKIP-GELQIVDKIDAAFKIAATAAN-AP-NDKFTV
Sequence 2 EVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTV

Sequence 1 FEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVF
           FE-AFNKA--E--GGAYETYKFIPSLEA---KQAY-ATVA-APEVKYAVF
Sequence 2 FESAFNKALNECTGGAYETYKFIPSLEAA-VKQAYAATVAAAPEVKYAVF

Sequence 1 EAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSA-
           EA-LTKAITAM--AQK--KP-----AAA-GAAT-A-GAAT-AA---T-A-
Sequence 2 EAALTKAITAMTQAQKAGKPA---AAAATGAATVATGAATAAAGAATAAA

Sequence 1 GGYKV
           GGYK-
Sequence 2 GGYKA



Alignment 5
Sequence 1:
Sequence 2: Allergen Hol l 5.0101, Sequence: CAB10765
Sequence identity: 79.43 (139/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADAGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKY

Sequence 1 ----------------------------------------------AKYD
           ----------------------------------------------AKYD
Sequence 2 KTFEAAFTASSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYD

Sequence 1 AFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFK
           AF---LTEALRVIAGA-EVHAVKPATEEV-AAKIPAGELQIVDKIDAAF-
Sequence 2 AFVTTLTEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFR

Sequence 1 IAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQ
           IAATAAN-AP-NDKFTVFEGAFNKAIKE--GGAYE-YKFIPSLE----KQ
Sequence 2 IAATAANAAPVNDKFTVFEGAFNKAIKESTGGAYEAYKFIPSLETA-VKQ

Sequence 1 AYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAAT
           AY-ATVA-APEVKY-VFE--L-KAITAMSEAQK-AKPV----AAA-GAAT
Sequence 2 AYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPV----AAATGAAT

Sequence 1 AAGGAATVAASRPTSAGGYKV
           AA-G-A--AA-----AGGYKV
Sequence 2 AAAGVAAGAAT--AAAGGYKV



Alignment 6
Sequence 1:
Sequence 2: Allergen Hol l 5.0201, Sequence: CAB10766
Sequence identity: 78.86 (138/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEET

Sequence 1 --------------------------AKYDAFIAALTEALRVIAGAFEVH
           --------------------------AKYDAF---LTEALRVIAGA-EVH
Sequence 2 KMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVH

Sequence 1 AVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVFEG
           AVKPATEEVPAAKIPAG-LQ-VDKIDA-FKIAATAAN-APANDKFTVFE-
Sequence 2 AVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFET

Sequence 1 AFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAG
           AFNKA-KE--GGAYE-YKFIPSLEA---KQAY--TVA-APEVKYAVFEA-
Sequence 2 AFNKALKESTGGAYESYKFIPSLEAA-VKQAYASTVAAAPEVKYAVFEAA

Sequence 1 LTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYK
           LTKAITAMS-AQKVA-P-----AAA-GAAT-A-GAAT------T-AGGYK
Sequence 2 LTKAITAMSQAQKVAQPA----AAATGAATVAAGAAT------TAAGGYK

Sequence 1 V
           V
Sequence 2 V



Alignment 7
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56164
Sequence identity: 80.57 (141/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTMALFLAVALVAGPAAPTPPTPRTPPLLPPPRARDKATLTSRSV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EDINAASRRPWWASVPPADKFKTFADHVLCVPNADVTSAATKAPQLKAKL

Sequence 1 -----------------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEV
           -----------------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEV
Sequence 2 DAAYRVAYEAAEGSTPEAKYDAFIAALTEALRVIAGAFEVHAVKPATEEV

Sequence 1 PAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKER
           -A---P-GELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKE-
Sequence 2 VAD--PVGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKES

Sequence 1 HGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMS
           --GAYETYKFIPSLEA---KQAYGATVARAPEVKYAVFEAGLTKAITAMS
Sequence 2 TAGAYETYKFIPSLEAA-VKQAYGATVARAPEVKYAVFEAGLTKAITAMS

Sequence 1 EAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV--------
           EAQKVAKP--S----------AAGGAATVAA-------------------
Sequence 2 EAQKVAKPPLSPQPPQV-LPLAAGGAATVAAASDVRVCRSHGTLQDACLL

Sequence 1 ------------------------
           ------------------------
Sequence 2 RCRGGCQPVVWRGGSHRARGGYKV



Alignment 8
Sequence 1:
Sequence 2: Allergen Phl p 5.0204, Sequence: AAC25996
Sequence identity: 74.29 (130/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAADK

Sequence 1 -------------------------------------------AKYDAFI
           -------------------------------------------AK-D-F-
Sequence 2 FKTFEAAFTSSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFV

Sequence 1 AALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAA
           A-LTEALRVIAGA-EVHAVKP-TEE---AKIPAGELQI-DKIDAAFK-AA
Sequence 2 ASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAA

Sequence 1 TAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYG
           TAA--APA-DKFTVFE-AFNKAIKE--GGAY-TYK-IPSLEA---KQAY-
Sequence 2 TAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAA-VKQAYA

Sequence 1 ATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAG
           ATVA-AP-VKYAVFEA-LTKAITAMSE-QKV--P-------AAGAAT-A-
Sequence 2 ATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAA

Sequence 1 GAATVAASRPTSAGGYKV
           GAA--AA-----AGGYKV
Sequence 2 GAASGAAT--VAAGGYKV



Alignment 9
Sequence 1:
Sequence 2: Allergen Phl p 5.0201, Sequence: Q40963
Sequence identity: 74.29 (130/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYS

Sequence 1 ------------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKI
           ------------AK-D-F-A-LTEALRVIAGA-EVHAVKP-TEE---AKI
Sequence 2 VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI

Sequence 1 PAGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAY
           PAGELQI-DKIDAAFK-AATAA--APA-DKFTVFE-AFNKAIKE--GGAY
Sequence 2 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY

Sequence 1 ETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKV
           -TYK-IPSLEA---KQAY-ATVA-AP-VKYAVFEA-LTKAITAMSE-QKV
Sequence 2 DTYKCIPSLEAA-VKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKV

Sequence 1 AKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           --P-------AAGAAT-A-GAA--AA-----AGGYKV
Sequence 2 SQPATGAATVAAGAATTAAGAASGAAT--VAAGGYKV



Alignment 10
Sequence 1:
Sequence 2: Allergen Phl p 5.0202, Sequence: CAB05371
Sequence identity: 74.29 (130/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDINVG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FKAAVAAAASVPAGDKFKTFEAAFTSSSKAATAKAPGLVPKLDAAYSVAY

Sequence 1 ---------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAG
           ---------AK-D-F-A-LTEALRVIAGA-EVHAVKP-TEE---AKIPAG
Sequence 2 KAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAG

Sequence 1 ELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETY
           ELQI-DKIDAAFK-AATAA--APA-DKFTVFE-AFNKAIKE--GGAY-TY
Sequence 2 ELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTY

Sequence 1 KFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKP
           K-IPSLEA---KQAY-ATVA-AP-VKYAVFEA-LTKAITAMSE-QKV--P
Sequence 2 KCIPSLEAA-VKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQP

Sequence 1 VRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           -------AAGAAT-A-GAA--AA-----AGGYKV
Sequence 2 ATGAATVAAGAATTATGAASGAAT--VAAGGYKV



Alignment 11
Sequence 1:
Sequence 2: Allergen Poa p 5.0101, Sequence: Q9FPR0
Sequence identity: 74.86 (131/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQA

Sequence 1 ------------------------AKYDAFIAALTEALRVIAGAFEVHAV
           ------------------------AK-D-F-AA-TEALR-IAG---VHAV
Sequence 2 PGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAV

Sequence 1 KPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAF
           KP-TEE--AAKIPAGE-QI-DKIDAAFK-AATAAN-APANDKFTVFE-AF
Sequence 2 KPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAF

Sequence 1 NKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLT
           N-AIKE--GGAY-TYK-IPSLEA---KQAY-AT-A-APEVK-AVF-A-LT
Sequence 2 NNAIKESTGGAYDTYKSIPSLEAA-VKQAYAATIAAAPEVKFAVFKAALT

Sequence 1 KAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPT-----SAG
           KAITAM-E-QKV-KPV------AAGAATAA-GAAT-AA---T-----SAG
Sequence 2 KAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAG

Sequence 1 GYKV
           GYKV
Sequence 2 GYKV



Alignment 12
Sequence 1:
Sequence 2: Allergen Phl p 5.0205, Sequence: 9249029
Sequence identity: 73.14 (128/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFNAAVAAAASVPAADK

Sequence 1 -------------------------------------------AKYDAFI
           -------------------------------------------AK-D---
Sequence 2 FKTFEAAFTSSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSLV

Sequence 1 AALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAA
           A-LTEALRVIAGA-EVHAVKP-TEE---AKIPAGELQI-DKIDAAFK-AA
Sequence 2 ASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAA

Sequence 1 TAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYG
           TAA--APA-DKFTVFE-AFNKAIKE--GGAY-TYK-IPSLEA---KQ-Y-
Sequence 2 TAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAA-VKQPYA

Sequence 1 ATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAG
           ATVA-AP-VKYAVFEA-LTKAITAMSE-QKV--P-------AAGAAT-A-
Sequence 2 ATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAA

Sequence 1 GAATVAASRPTSAGGYKV
           GAA--AA-----AGGYKV
Sequence 2 GAASGAAT--VAAGGYKV



Alignment 13
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22285
Sequence identity: 70.86 (124/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAAPAAGYT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PAAPAGAAPKATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFG

Sequence 1 ------------------------------------------------AK
           ------------------------------------------------AK
Sequence 2 TASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGATPEAK

Sequence 1 YDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAA
           YDA--A-L-EALR-IAG--EVHAVKPA-EEV-A--IPAGELQ--DK-DAA
Sequence 2 YDAYVATLSEALRIIAGTLEVHAVKPAGEEVKA--IPAGELQVIDKVDAA

Sequence 1 FKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRS
           FK-AATAAN-APANDKFTVFE-AFN-AIK---GGAY--YKFIP-LEA---
Sequence 2 FKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAA-V

Sequence 1 KQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAA--
           KQ-Y-ATVA-AP-VKY-VFE--L-KAITAMS-AQK-AKP---VTA-A---
Sequence 2 KQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTATATGA

Sequence 1 -GAATAAGGAATVAASRPTSAGGYKV------------
           -GAAT-A-GAAT-AA-----AGGYK-------------
Sequence 2 VGAATGAVGAATGAAT--AAAGGYKTGAATPTAGGYKV



Alignment 14
Sequence 1:
Sequence 2: Allergen Phl p 5.0109, Sequence: CAD87529
Sequence identity: 69.71 (122/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAAL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AAAAGVPPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSK

Sequence 1 ------------------AKYDAFIAALTEALRVIAGAFEVHAVKPATEE
           ------------------AKYDA--A-L-EALR-IAG--EVHAVKPA-EE
Sequence 2 LDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEE

Sequence 1 VPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKE
           V----IPAGELQ---K-DAAFK-AATAAN-APANDKFTVFE-AFN-AIK-
Sequence 2 VKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNNAIKA

Sequence 1 RHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAM
           --GGAYE-YKFIP-LEA---KQAY-ATVA-APEVKY-VFE--L-KAITAM
Sequence 2 STGGAYESYKFIPALEAA-VKQAYAATVATAPEVKYTVFETALKKAITAM

Sequence 1 SEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           SEAQK-AKP----TA-A--A--AA-GAAT-A-------GGYKV
Sequence 2 SEAQKAAKPAAAATATATSAVGAATGAATAAT------GGYKV



Alignment 15
Sequence 1:
Sequence 2: Allergen Phl p 5.0101, Sequence: CAA52753
Sequence identity: 71.43 (125/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADLGYGPATPAAPAAGYTPATPAAP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAA

Sequence 1 ----------------------------------------------AKYD
           ----------------------------------------------AKYD
Sequence 2 SNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYD

Sequence 1 AFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFK
           A--A-L-EALR-IAG--EVHAVKPA-EEV----IPAGELQ---K-DAAFK
Sequence 2 AYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFK

Sequence 1 IAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQ
           -AATAAN-APANDKFTVFE-AFN-AIK---GGAYE-YKFIP-LEA---KQ
Sequence 2 VAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAA-VKQ

Sequence 1 AYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAAT
           AY-ATVA-APEVKY-VFE--L-KAITAMSEAQK-AKP-----AAA---AT
Sequence 2 AYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA----AAATATAT

Sequence 1 AAGGAATVAASRPTSAGGYKV
           AA-GAAT-AA---T--GGYKV
Sequence 2 AAVGAATGAATAAT--GGYKV



Alignment 16
Sequence 1:
Sequence 2: Allergen Phl p 5.0107, Sequence: AAC16527
Sequence identity: 69.14 (121/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLA

Sequence 1 ----------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPA
           ----------AKYDA--A-L-EALR-IAG--EVHAVKPA-EEV----IPA
Sequence 2 YKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYET
           GELQ---K-D-AFK-AATAAN-APANDKFTVFE-AFN-AIK---GGAYE-
Sequence 2 GELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYES

Sequence 1 YKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAK
           YKFIP-LEA---KQAY-ATVA-APEVKY-VFE--L-KAITAMSEAQK-AK
Sequence 2 YKFIPALEAA-VKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAK

Sequence 1 PVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           P----TA-A--A--AA-GA-T-AA------GGYKV
Sequence 2 PAAAATATATSAVGAATGATTAAA------GGYKV



Alignment 17
Sequence 1:
Sequence 2: Allergen Phl p 5.0106, Sequence: AAC16526
Sequence identity: 69.14 (121/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLA

Sequence 1 ----------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPA
           ----------AKYDA--A-L-EALR-IAG--EVHAVKPA-EEV----IPA
Sequence 2 YKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYET
           GELQ---K-D-AFK-AATAAN-APANDKFTVFE-AFN-AIK---GGAYE-
Sequence 2 GELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYES

Sequence 1 YKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAK
           YKFIP-LEA---KQAY-ATVA-APEVKY-VFE--L-KAITAMSEAQK-AK
Sequence 2 YKFIPALEAA-VKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAK

Sequence 1 PVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           P----TA-A--A--AA-GAAT-A-------GGYKV
Sequence 2 PATEATATATAAVGAATGAATAAT------GGYKV



Alignment 18
Sequence 1:
Sequence 2: Allergen Phl p 5.0102, Sequence: Q40962
Sequence identity: 70.86 (124/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALT

Sequence 1 --------------------AKYDAFIAALTEALRVIAGAFEVHAVKPAT
           --------------------AKYDA--A-L-EALR-IAG--EVHAVKPA-
Sequence 2 SKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAA

Sequence 1 EEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAI
           EEV----IPAGELQ---K-DAAFK-AATAAN-APANDKFTVFE-AFN--I
Sequence 2 EEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEI

Sequence 1 KERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAIT
           K---GGAYE-YKFIP-LEA---KQAY-ATVA-APEVKY-VFE--L-KAIT
Sequence 2 KASTGGAYESYKFIPALEAA-VKQAYAATVATAPEVKYTVFETALKKAIT

Sequence 1 AMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           AMSEAQK-AKP-----AAA---ATAA-GAAT-AA---T--GGYKV
Sequence 2 AMSEAQKAAKPA----AAATATATAAVGAATGAATAAT--GGYKV



Alignment 19
Sequence 1:
Sequence 2: Allergen Phl p 5, Sequence: AAK25823
Sequence identity: 69.14 (121/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PISVTAPPPQLPRPPATPPPPPPPQLGASPYKLGPSPKARSERPAIVPPA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DKYRTFVATFGAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAY

Sequence 1 ---------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAG
           ---------AKYDA--A-L-EALR-IAG--EVHAVKPA-EEV----IPAG
Sequence 2 KTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAG

Sequence 1 ELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETY
           ELQ---K-DAAFK-AATAAN-APANDKFTVFE-AFN-AIK---GGAYE-Y
Sequence 2 ELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNNAIKAGTGGAYESY

Sequence 1 KFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKP
           KFIP-LEA---KQAY-ATVA-APEVKY-VFE--L-KAITAMSEAQK-AKP
Sequence 2 KFIPALEAA-VKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKP

Sequence 1 VRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           ----TA-A--A--A--GA-T-AA------GGYKV
Sequence 2 AAAATATATSAVGAPTGATTAAA------GGYKV



Alignment 20
Sequence 1:
Sequence 2: Allergen Phl p 5.0108, Sequence: AAC16528
Sequence identity: 68.57 (120/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLA

Sequence 1 ----------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPA
           ----------AKYDA--A-L-EALR-IAG--EVHAVKPA-EEV----IPA
Sequence 2 YKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYET
           GELQ---K-D-AFK-AATAAN-APANDKFTVFE-AFN-AIK---GGAYE-
Sequence 2 GELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYES

Sequence 1 YKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAK
           YKFIP-LEA---KQAY-ATVA-APEVKY-VFE--L-KA-TAMSEAQK-AK
Sequence 2 YKFIPALEAA-VKQAYAATVATAPEVKYTVFETALKKAFTAMSEAQKAAK

Sequence 1 PVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           P----TA-A--A--AA-GAAT-A-------GGYKV
Sequence 2 PATEATATATAAVGAATGAATAAT------GGYKV



Alignment 21
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56166
Sequence identity: 75.43 (132/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLAMALVAGPAASYAADAGTPPTPATPAVPGAAAGKATTH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EQKLIEDINAAFKWWPASAPPADKYKTFETAFSKANIAGASTKGLDAAYS

Sequence 1 ------------AKYDAFIAALTEALRVIAGAFEVHAVKPATEE-VPAAK
           ------------AKYD-F--ALTEALR--AG--EVHAVKPATEE-VP-AK
Sequence 2 VVYNTAAGATPEAKYDSFVTALTEALRIMAGTLEVHAVKPATEEEVPSAK

Sequence 1 IPAGELQIVDKIDAAFKIAAT---------AANSAPANDKFTVFEGAFNK
           I--------------FKIAAT---------AANSAPANDKFTVFEGAFNK
Sequence 2 ILRANSRSSTR-SSRFKIAATVATPLSHSTAANSAPANDKFTVFEGAFNK

Sequence 1 AIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKA
           AIKERHGG--ETYKFIPSLEA---KQAYGATVARAPEVKYAVFEAGLTKA
Sequence 2 AIKERHGGPTETYKFIPSLEAA-VKQAYGATVARAPEVKYAVFEAGLTKA

Sequence 1 ITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           ITAMSEAQKVAKPVR-----------AAGGAATVAA----S-GGYKV
Sequence 2 ITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASD-SRGGYKV



Alignment 22
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22284
Sequence identity: 68.57 (120/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSGPDAVGFAKK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKAPPASKFPAK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PAPKVAAYTPAAPAGAAPKATTDEQKLIEKINVGFKAAVAAAAGVPAASK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YKTFVATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKS

Sequence 1 -------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGEL
           -------AKYDA--A-L-EALR-IAG--EVH-VKPA-EEV-A--IPAGEL
Sequence 2 AEGATPEAKYDAYVATLSEALRIIAGTLEVHGVKPAAEEVKA--IPAGEL

Sequence 1 QIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKF
           Q--DK-DAAFK-AATAAN-APANDKFTVFE-AFN-AIK---GGAY--YKF
Sequence 2 QVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKF

Sequence 1 IPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVR
           IP-LEA---KQ-Y-ATVA-AP-VKY-VFE--L-KAITAMS-AQK-AKP--
Sequence 2 IPALEAA-VKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAA

Sequence 1 SVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           -VT--A--A--AA-GAAT-AA------GGYKV
Sequence 2 AVTGTATSAVGAATGAATAAA------GGYKV



Alignment 23
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22286
Sequence identity: 69.14 (121/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLVALVVGPAASYAADLSYGAPATPAAPAAGYTPAAPAGA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 APKATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAASNKAF

Sequence 1 -----------------------------------------AKYDAFIAA
           -----------------------------------------AKYD---A-
Sequence 2 AEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKYDDYVAT

Sequence 1 LTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATA
           L-EALR-IAG--EVH-VKPA-EEV-A---PAGELQ--DK-DAAFK-AATA
Sequence 2 LSEALRIIAGTLEVHGVKPAAEEVKAT--PAGELQVIDKVDAAFKVAATA

Sequence 1 ANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGAT
           AN-APANDKFTVFE-AFN-AIK---GGAY--YKFIP-LEA---KQ-Y-AT
Sequence 2 ANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAA-VKQSYAAT

Sequence 1 VARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGA
           VA-AP-VKY-VFE--L-KAITAMS-AQK-AKP-----AAA-G-ATAA-GA
Sequence 2 VATAPAVKYTVFETALKKAITAMSQAQKAAKPA----AAATGTATAAVGA

Sequence 1 ATVAASRPTSAGGYKV
           AT-AA-----AGGYKV
Sequence 2 ATGAAT--AAAGGYKV



Alignment 24
Sequence 1:
Sequence 2: Allergen Phl p 5.0105, Sequence: AAC16525
Sequence identity: 67.43 (118/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLA

Sequence 1 ----------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPA
           ----------A-YDA--A-L-EALR-IAG--EVHAVKPA-EEV----IPA
Sequence 2 YKTAEGATPEAEYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYET
           GELQ---K-D-A-K-AATAAN-APANDKFTVFE-AFN-AIK---GGAYE-
Sequence 2 GELQVIEKVDSALKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYES

Sequence 1 YKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAK
           YKFIP-LEA---KQAY-ATVA-APEVKY-VFE--L-KAITA-SEAQK-AK
Sequence 2 YKFIPALEAA-VKQAYAATVATAPEVKYTVFETALKKAITATSEAQKAAK

Sequence 1 PVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           P----TA-A--A--AA-GAAT-A-------GGYKV
Sequence 2 PATEATATATAAVGAATGAATAAT------GGYKV



Alignment 25
Sequence 1:
Sequence 2: Allergen Phl p 5.0104, Sequence: CAB05372
Sequence identity: 68.00 (119/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLA

Sequence 1 ----------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPA
           ----------AKYDA--A-L-EALR-IAG--EVHAVKPA-EEV----IPA
Sequence 2 YKTSEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYET
           GELQ---K-D-A-K-AATAAN-A-ANDKFTVFE-AFN-AIK---GGAYE-
Sequence 2 GELQFIEKVDSALKVAATAANAAAANDKFTVFEAAFNHAIKASTGGAYES

Sequence 1 YKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAK
           YKFIP-LEA---KQAY-ATVA-APEVKY-VFE--L-KAITAMSEAQK-AK
Sequence 2 YKFIPALEAA-VKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAK

Sequence 1 PVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV
           P----TA-A--A--AA-GAAT-A-------GGYKV
Sequence 2 PATEATATATAAVGAATGAATAAT------GGYKV



Alignment 26
Sequence 1:
Sequence 2: Allergen Sec c 5.0101, Sequence: CBG76811
Sequence identity: 64.00 (112/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS

Sequence 1 ---------------------------AKYDAFIAALTEALRVIAGAFEV
           ----------------------------KYD---A-LTE-LRVI-GAFEV
Sequence 2 DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV

Sequence 1 HAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVFE
           HAVKPA-EEV-----PA--L--VD-IDAA---AATAAN-AP-NDKF-VFE
Sequence 2 HAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFE

Sequence 1 GAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEA
           --FNKAIKE--GGAY--Y-F-P-LE-S--KQAY-ATVA-APEVKYAVF-A
Sequence 2 SSFNKAIKENTGGAYASYTFVPALE-SAVKQAYAATVASAPEVKYAVFQA

Sequence 1 GLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGY
           -L-KAI-AM-EA-K-AKP-----AAAA--ATA----ATV-A-----AGGY
Sequence 2 ALSKAINAMVEAEKDAKPA----AAAAATATAT---ATVGAAAGAAAGGY

Sequence 1 KV
           K-
Sequence 2 KA



Alignment 27
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40237
Sequence identity: 65.71 (115/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE

Sequence 1 -----------------------------------------------AKY
           -----------------------------------------------AKY
Sequence 2 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY

Sequence 1 DAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAF
           DA--A-LTEALRVIAG--EVHAVKPA-EEV----IPA-E-Q--DK-DAA-
Sequence 2 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY

Sequence 1 KIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSK
           --AATAAN-APANDKFTVFE--FN-AIK---G-AY--YKFIP-L-A---K
Sequence 2 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAA-VK

Sequence 1 QAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTA----AA
           QAY-A--A-APEVKY-V-E--L-KA-TAMSEA-K-A-P----TA----AA
Sequence 2 QAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAA

Sequence 1 AGA--------ATAAGGAATVAAS------RPTSAGGYKV
           A-A--------ATA---AAT--A--------P--AGGYKV
Sequence 2 ATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV



Alignment 28
Sequence 1:
Sequence 2: Allergen Hor v 5.0101, Sequence: U57845
Sequence identity: 60.00 (105/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MANSGREHSAVPRRRNLVALVPRHGCYAEFSLYVCVGNINAPFPVFNRTT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FIANAGIEAELEPHFLLLLFTFSSSSSFFTLLKTMIHFTDRSDNKNKAMM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RGREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGAT

Sequence 1 --AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDK
           --AKYDA--A-LTE-LRVI-G--EVH-VKPA-EEV-----PAGEL---D-
Sequence 2 PEAKYDAYVATLTESLRVISGTLEVHSVKPAAEEVKG--VPAGELKAIDQ

Sequence 1 IDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLE
           -DAAF--AATAA--APANDKFTVFE-----------GGAYE-YKFIP-LE
Sequence 2 VDAAFRTAATAADAAPANDKFTVFESLQQGPSRKPRGGAYESYKFIPALE

Sequence 1 ASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTAA
           A---KQAY-ATVA-APEVK--VF---L-KAI-AM--A-KVAKP-----AA
Sequence 2 AA-VKQAYAATVAAAPEVKFTVFQTALSKAINAMTQAGKVAKPA---AAA

Sequence 1 AAGAATAAGGAATVAASRPTSAGGYKV
           -A-A--AAG-AAT--------AG-YKV
Sequence 2 TATATVAAGAAAT--------AGNYKV



Alignment 29
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40240
Sequence identity: 59.43 (104/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EGDDRRAEAAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSP

Sequence 1 -----------------------------AKYDAFIAALTEALRVIAGAF
           ------------------------------------------LRVIAGA-
Sequence 2 TSAAKAPGLIPKLDTAYDVAYKAAEAHPRGQVRRLRHCPHRSLRVIAGAL

Sequence 1 EVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTV
           EVHAVKPATEEV-AAKIP-GELQIVDKIDAAFKIAATAAN-AP-NDKFTV
Sequence 2 EVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTV

Sequence 1 FEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVF
           FE-AFNKA--E--GGA-------P------S--------A-APEVKYAVF
Sequence 2 FESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPA-APEVKYAVF

Sequence 1 EAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAG
           EA-LTKAITAM--AQK--KP-----AAA--AAT-A--AAT-AA--P----
Sequence 2 EAALTKAITAMTQAQKAGKPA---AAAATAAATVATAAATAAAVLPPPLL

Sequence 1 GYKV--------
           ------------
Sequence 2 VVQSLISLLIYY



Alignment 30
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56165
Sequence identity: 54.86 (96/175)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD

Sequence 1 -----------------------------AKYDAFIAALTEALRVIAGAF
           --------------------------------DA----------VI--A-
Sequence 2 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMDDASVGSVSSEFHVIESAI

Sequence 1 EVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTV
           EV-------EEV----IPAGE-----K--AAF--AATAA--APANDKFTV
Sequence 2 EV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAPANDKFTV

Sequence 1 FEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVF
           F---FNKAIKE--GGAY--YKFIP-LEA---KQAY-A--A-APEVKYAVF
Sequence 2 FVSSFNKAIKETTGGAYAGYKFIPTLEAA-VKQAYAASSATAPEVKYAVF

Sequence 1 EAGLTKAITAMSEAQKVAKPVRSVTAA-----AAGAATAAGGAATVAASR
           E--L-KAI-AMSEAQK-AKP-----AA-----A--A--AA----------
Sequence 2 ETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTAT

Sequence 1 PTS-AGGYKV
           P---AGGYKV
Sequence 2 PAAVAGGYKV



Alignment 31
Sequence 1:
Sequence 2: Allergen Phl p 6.0101, Sequence: P43215
Sequence identity: 23.43 (41/175)
Sequence 1 AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKID
           --------A---A--V--G-----A--P--E-----K----E--------
Sequence 2 ------MVAMFLAVAVVLGL----ATSPTAE---GGKATTEEQKLIEDVN

Sequence 1 AAFKIA-ATAANSAPANDKFTVFEGAFNKAIKERHGGAY-ETYKFIPSLE
           A-F--A-AT-AN--PA-DK---FE-AF----K-----A--------P-L-
Sequence 2 ASFRAAMATTANVPPA-DKYKTFEAAFTVSSKRNLADAVSKAPQLVPKLD

Sequence 1 ASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKV--AKPVRSVT
           ------AY-A----APE-KY--F------A---------V---KP-----
Sequence 2 EVYNA-AYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA---

Sequence 1 AAAAGAATAAGGAATVAASRPTSAGGYKV
           -----------------------------
Sequence 2 -----------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.