The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Cyn d 1.0201

Sequence 15384338

Full FASTA alignment

Sequence name:
Query sequence:
AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Cyn d 1.0201AAK96255Go!244387.61.6e-109
2Cyn d 1.0204AAF80379Go!244386.92.6e-109
3Cyn d 1.0202AAL14077Go!262381.21.4e-107
4Cyn d 1AAL14078Go!262379.54.9e-107
5Cyn d 1.0203AAL14079Go!262378.41.0e-106
6Cyn d 1O04701Go!246340.42.6e-95
7Poa p aCAA10520Go!263281.61.4e-77
8Hol l 1CAA10140Go!263280.53.0e-77
9Phl p 1P43213Go!263277.72.2e-76
10Phl p 1.0101CAA81613Go!263275.01.3e-75
11Hol l 1.0102CAA93121Go!248273.53.8e-75
12Hol l 1P43216Go!265273.34.6e-75
13Lol p 1.0102AAA63278Go!252272.19.5e-75
14Ory s 1AAF72983Go!267271.71.3e-74
15Pha a 1Q41260Go!269271.12.1e-74
16Lol p 1.0103CAB63699Go!263270.62.9e-74
17Lol p 1P14946Go!263268.99.7e-74
18Lol p 1.0101AAA63279Go!263268.21.5e-73
19Ory s 1AAF72991Go!267267.32.9e-73
20Sor h 1.0101ABC58726Go!239251.61.3e-68
21Pas n 1.0101ACA23876Go!265249.27.8e-68
22Zea m 1P58738Go!269246.64.9e-67
23Ory s 1AAF72990Go!269238.01.9e-64
24Ory s 1Q40638Go!263235.88.7e-64
25Ory s 1AAF72984Go!268209.48.0e-56
26Ory s 1AAF72987Go!275205.61.1e-54
27Zea m 1Q07154Go!191200.03.8e-53
28Ory s 1AAB61710Go!261199.76.5e-53
29Ory s 1AAF72989Go!271196.46.6e-52
30Tri a ps93AAD10496Go!271195.31.4e-51
31Ory s 1AAF72985Go!286195.31.5e-51
32Ory s 1AAF72988Go!327162.51.3e-41
33Gly m 2AAA50175Go!277160.25.1e-41
34Ory s 1AAF72986Go!275160.05.9e-41
35Ara t expansinCAB37496Go!26595.21.8e-21
36Ory s 1AAG13596Go!27584.23.9e-18
37Ory s 1BAA85432Go!28476.58.3e-16
38Cyn d 15AAP80171Go!11269.44.7e-14
39Lol p 2P14947Go!9765.36.6e-13
40Cyn d 2CAA10346Go!12263.92.3e-12
41Phl p 2P43214Go!12263.04.2e-12
42Dac g 2CAA10345Go!12263.04.2e-12
43Poa p 2CAA10348Go!12263.04.2e-12
44Lol p 2CAA51775Go!8860.91.3e-11
45Dac g 3P93124Go!9658.38.7e-11
46Phl p 3.01012JNZ_AGo!10855.75.9e-10
47Lol p 3P14948Go!9750.81.6e-08
48Tri a 3CAA90746Go!11850.03.4e-08
49Dac g 1.0101Q7M1X8Go!3444.73.8e-07
50Ant o 1.0101Q7M1X6Go!3242.51.7e-06

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Cyn d 1.0201, Sequence: AAK96255
Sequence identity: 100.00 (244/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
Sequence 2 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
Sequence 2 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
Sequence 2 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
Sequence 2 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
Sequence 2 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF



Alignment 2
Sequence 1:
Sequence 2: Allergen Cyn d 1.0204, Sequence: AAF80379
Sequence identity: 99.59 (243/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
Sequence 2 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
Sequence 2 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
Sequence 2 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWR-
Sequence 2 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRM

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
Sequence 2 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF



Alignment 3
Sequence 1:
Sequence 2: Allergen Cyn d 1.0202, Sequence: AAL14077
Sequence identity: 98.36 (240/244)
Sequence 1 ------------------AMGDKPGPNITATYGDKWLDAKATFYGSDPRG
           ------------------AMGDKPGPNITATYGDKWLDAKATFYGSDPRG
Sequence 2 MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPA
           AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPA
Sequence 2 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPA

Sequence 1 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM
           ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 LQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK
           LQFRRVKCEYPSDTKIAFHVEKGS-PNYLALLVKYAAGDGNIV-VDIK-K
Sequence 2 LQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSK

Sequence 1 GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDW
           GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQ-DVIPEDW
Sequence 2 GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDW

Sequence 1 KPDTVYKSKIQF
           KPDTVYKSKIQF
Sequence 2 KPDTVYKSKIQF



Alignment 4
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: AAL14078
Sequence identity: 97.54 (238/244)
Sequence 1 ------------------AMGDKPGPNITATYGDKWLDAKATFYGSDPRG
           ------------------AMGDKPGPNITATYGDKWLDAKATFYGSDPRG
Sequence 2 MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPA
           AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGL-CGSCYEIKCKEPA
Sequence 2 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPA

Sequence 1 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM
           ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 LQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK
           LQFRRVKCEYPSDTKI-FHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK
Sequence 2 LQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK

Sequence 1 GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDW
           GSD-FLPMK-SWGAIWR-DPPKPLKGPFTIRLTSESGGHVEQ-DVIPEDW
Sequence 2 GSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDW

Sequence 1 KPDTVYKSKIQF
           KPDTVYKSKIQF
Sequence 2 KPDTVYKSKIQF



Alignment 5
Sequence 1:
Sequence 2: Allergen Cyn d 1.0203, Sequence: AAL14079
Sequence identity: 97.54 (238/244)
Sequence 1 ------------------AMGDKPGPNITATYGDKWLDAKATFYGSDPRG
           ------------------AMGDKPGPNITATYGDKWLDAKATFYGSDPRG
Sequence 2 MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPA
           AAPDDHGGACGYKDVDKAPFD-MTGCGNEPIFKDGL-CGSCYEIKCKEPA
Sequence 2 AAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPA

Sequence 1 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM
           ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 LQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK
           LQFRRVKCEYPSDTKIAFHVEKGS-PNYLALLVKYAAGDGNIV-VDIK-K
Sequence 2 LQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSK

Sequence 1 GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDW
           GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQ-DVIPEDW
Sequence 2 GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDW

Sequence 1 KPDTVYKSKIQF
           KPDTVYKSKIQF
Sequence 2 KPDTVYKSKIQF



Alignment 6
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: O04701
Sequence identity: 85.25 (208/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           A-GDKPGPNITATYG-KWL-A-ATFYGS-PRGAAPDDHGGACGYKDVDK-
Sequence 2 AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKP

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           PFDGMT-CGNEPIFKDGL-C--CYEIKCKEP-ECSGEPVL-KITDKNYEH
Sequence 2 PFDGMTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEH

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           IAAYHFDLSGKAFGAMAKKG-EDKLRKAGEL-LQFRRVKC-YPS-TKI-F
Sequence 2 IAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           H-EKGS---YLALLVKYAAGDGNIV-VDIKP--SDEF-PMK-SWGAIWRI
Sequence 2 HIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRI

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF--
           DP-KPLKGPF-IRLTSE-G-H--QDDVIP--WKPDTVY-SK-QF--
Sequence 2 DPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA



Alignment 7
Sequence 1:
Sequence 2: Allergen Poa p a, Sequence: CAA10520
Sequence identity: 70.49 (172/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNITATYGDKWLDAK-T-YG
Sequence 2 MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --P-GA-P-D-GGACGYKDVDKAPF-GMTGCGN-PIFK-G--CGSC-EIK
Sequence 2 K-PTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CSGEPVL--ITD-N-E-IAAYHFDLSGKAFGAMAKKGEE-KLR-
Sequence 2 CTKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKLRS

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AGEL-L-FRRVKCEYP--TK--FHVEKGS-PNYLALLVKY--GDG--V-V
Sequence 2 AGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           DIK-KG-D-----K-SWG-IWR-D-P--L-GPFT-R-T-E-G---E--DV
Sequence 2 DIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDV

Sequence 1 IPEDWKPDTVYKSKIQF
           IPE-WK-DT-Y-SK---
Sequence 2 IPEGWKADTAYASK---



Alignment 8
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: CAA10140
Sequence identity: 69.26 (169/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNITATYGDKWLDAK-T-YG
Sequence 2 MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --P-GA-P-D-GGACGYKDVDK-PF-GMTGCGN-PIFK-G--CGSC-EIK
Sequence 2 K-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CSGEP----ITD-N-E-IAAYH-DLSGKAFGAMAKKGEE-KLR-
Sequence 2 CTKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLRS

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AGEL-L-FRRVKCEYP--TK--FHVEKGS-PNYLALLVKY--GDG--V-V
Sequence 2 AGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           DIK-KG-D-----K-SWGA-WR-D-P--L-GPFT-R-T-E-G--VE--DV
Sequence 2 DIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDV

Sequence 1 IPEDWKPDTVYKSKIQF
           IPE-WK-DT-Y-SK---
Sequence 2 IPEGWKADTAYESK---



Alignment 9
Sequence 1:
Sequence 2: Allergen Phl p 1, Sequence: P43213
Sequence identity: 69.26 (169/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNITATYGDKWLDAK-T-YG
Sequence 2 MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --P-GA-P-D-GGACGYKDVDK-PF-GMTGCGN-PIFK-G--CGSC-EIK
Sequence 2 K-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CSGEPV---ITD-N-E-IA-YHFDLSG-AFGAMAKKG-E-KLR-
Sequence 2 CTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRS

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AGEL-LQFRRVKC-YP--TK--FHVEKGS-PNYLALLVKY--GDG--V-V
Sequence 2 AGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           DIK-KG-D-----K-SWGAIWRID-P--L-GPFT-R-T-E-G---E--DV
Sequence 2 DIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDV

Sequence 1 IPEDWKPDTVYKSKIQF
           IPE-WK-DT-Y-SK---
Sequence 2 IPEGWKADTSYESK---



Alignment 10
Sequence 1:
Sequence 2: Allergen Phl p 1.0101, Sequence: CAA81613
Sequence identity: 68.44 (167/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNITATYGDKWLDAK-T-YG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --P--A-P-D-GGACGYKDVDK-PF-GMTGCGN-PIFK-G--CGSC-EIK
Sequence 2 K-PTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CSGEPV---ITD-N-E-IAAYHFDLSG-AFG-MAKKG-E-KLR-
Sequence 2 CTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRS

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AGE---QFRRVKC-YP--TK--FHVEKGS-PNYLALLVK--AGDG--V-V
Sequence 2 AGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           DIK-KG-D-----K-SWGAIWRID-P--LKGPFT-R-T-E-G---E--DV
Sequence 2 DIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV

Sequence 1 IPEDWKPDTVYKSKIQF
           IPE-WK-DT-Y-SK---
Sequence 2 IPEGWKADTAYESK---



Alignment 11
Sequence 1:
Sequence 2: Allergen Hol l 1.0102, Sequence: CAA93121
Sequence identity: 67.62 (165/244)
Sequence 1 --------AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC
           -------------PGPNITATYGD-WLDAK-T-YG--P-GA-P-D-GGAC
Sequence 2 VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGAC

Sequence 1 GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIK
           GYKDVDK-PF-GMTGCGN-PIFKDG--CGSC-EIKC--P--CSGEPV---
Sequence 2 GYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVH

Sequence 1 ITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEY
           ITD-N-E-IA-YHFDLSG-AFG-MAKKGEE-KLR-AGEL-L-FRRVKC-Y
Sequence 2 ITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKY

Sequence 1 PSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQ
           P--TK--FHVEKGS-PNYLALLVKY--GDG--V-VDIK-KG-D-----K-
Sequence 2 PDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKE

Sequence 1 SWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKI
           SWGA-WR-D-P--L-GPFT-R-T-E-G---E--DVIPE-WK-DT-Y--K-
Sequence 2 SWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK-

Sequence 1 QF
           --
Sequence 2 --



Alignment 12
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: P43216
Sequence identity: 67.62 (165/244)
Sequence 1 -------------------------AMGDKPGPNITATYGDKWLDAKATF
           ------------------------------PGPNITATYGD-WLDAK-T-
Sequence 2 MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTW

Sequence 1 YGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYE
           YG--P-GA-P-D-GGACGYKDVDK-PF-GMTGCGN-PIFKDG--CGSC-E
Sequence 2 YGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFE

Sequence 1 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL
           IKC--P--CSGEPV---ITD-N-E-IA-YHFDLSG-AFG-MAKKGEE-KL
Sequence 2 IKCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL

Sequence 1 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV
           R-AGEL-L-FRRVKC-YP--TK--FHVEKGS-PNYLALLVKY--GDG--V
Sequence 2 RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVV

Sequence 1 GVDIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQD
           -VDIK-KG-D-----K-SWGA-WR-D-P--L-GPFT-R-T-E-G---E--
Sequence 2 AVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAE

Sequence 1 DVIPEDWKPDTVYKSKIQF
           DVIPE-WK-DT-Y--K---
Sequence 2 DVIPEGWKADTAYEAK---



Alignment 13
Sequence 1:
Sequence 2: Allergen Lol p 1.0102, Sequence: AAA63278
Sequence identity: 67.62 (165/244)
Sequence 1 ------------AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDH
           -----------------PGPNITA-YGDKWLDAK-T-YG--P-GA-P-D-
Sequence 2 ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDN

Sequence 1 GGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEP
           GGACGYKDVDKAPF-GMTGCGN-PIFKDG--CGSC-EIKC--P--CSGE-
Sequence 2 GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEA

Sequence 1 VLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRV
           V---ITD-N-E-IA-YHFDLSG-AFG-MAKKGEE---R-AGEL-LQFRRV
Sequence 2 VTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRV

Sequence 1 KCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFL
           KC-YP-DTK--FHVEKGS-PNYLA-LVKY--GDG--V-VDIK-KG-D---
Sequence 2 KCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWI

Sequence 1 PMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVY
           --K-SWGA-WRID-P--L-GPFT-R-T-E-G---E--DVIPE-WK-DT-Y
Sequence 2 ELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY

Sequence 1 KSKIQF
           --K---
Sequence 2 SAK---



Alignment 14
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72983
Sequence identity: 66.39 (162/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNIT--YGDKWL-AKAT-YG
Sequence 2 MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYG

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --P-GA-P-D-GGACGYKDVDKAPF-GM--CGN-PIFKDG--CGSC-EIK
Sequence 2 A-PKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CS--P-LI--TD-N-E-IAAYHFDLSG-AFGAMAK-G----LRK
Sequence 2 CSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRK

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AG----QFRRVKC-YP-DTKI-FH-EK-S-PNYLALLVKY-AGDG--V-V
Sequence 2 AGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           -IK-KGS-E----K-SWGAIWRID-PKPLKGPF--R-T-E-G------D-
Sequence 2 EIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDA

Sequence 1 IPEDWKPDTVYKSKIQF-
           IP--WK-D-VYKS--Q--
Sequence 2 IPDGWKADSVYKSNVQAK



Alignment 15
Sequence 1:
Sequence 2: Allergen Pha a 1, Sequence: Q41260
Sequence identity: 67.62 (165/244)
Sequence 1 -----------------------------AMGDKPGPNITATYGDKWLDA
           ----------------------------------PGPNITA-YGDKWLDA
Sequence 2 MMKMVCSSSSSSLLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDA

Sequence 1 KATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACG
           K-T-YG--P-GA-P-D-GGACGYKDVDKAPF-GMTGCGN-PIFKDG--CG
Sequence 2 KSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCG

Sequence 1 SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGE
           SC-E-KC--P--CSGEP----ITD-N-E-IA-YHFDLSG-AFG-MAKKGE
Sequence 2 SCFELKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGE

Sequence 1 EDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGD
           E---R-AGEL-LQFRRVKC-YP--TK--FHVEKGS-PNYLALLVKY--GD
Sequence 2 EENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGD

Sequence 1 GNIVGVDIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH
           G--V-VDIK-KG-D-----K-SWGAIWRID-P--L-GPFT-R-T-E-G--
Sequence 2 GDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTK

Sequence 1 VEQDDVIPEDWKPDTVYKSKIQF
           -E--DVIPE-WK-DT---SK---
Sequence 2 AEFEDVIPEGWKADTHDASK---



Alignment 16
Sequence 1:
Sequence 2: Allergen Lol p 1.0103, Sequence: CAB63699
Sequence identity: 67.62 (165/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNITA-YGDKWLDAK-T-YG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --P-GA-P-D-GGACGYKDVDKAPF-GMTGCGN-PIFKDG--CGSC-EIK
Sequence 2 K-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CSGE-V---ITD-N-E-IA-YHFDLSG-AFG-MAKKGEE-KLR-
Sequence 2 CTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRS

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AGEL-LQFRRVKC-YP--TK--FHVEK-S-PNYLA-LVKY--GDG--V-V
Sequence 2 AGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           DIK-KG-D-----K-SWGA-WRID-P--L-GPFT-R-T-E-G---E--DV
Sequence 2 DIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDV

Sequence 1 IPEDWKPDTVYKSKIQF
           IPE-WK-DT-Y--K---
Sequence 2 IPEGWKADTSYSAK---



Alignment 17
Sequence 1:
Sequence 2: Allergen Lol p 1, Sequence: P14946
Sequence identity: 66.80 (163/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNITA-YGDKWLDAK-T-YG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --P-GA-P-D-GGACGYK-VDKAPF-GMTGCGN-PIFKDG--CGSC-EIK
Sequence 2 K-PTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CSGE-V---ITD-N-E-IA-YHFDLSG-AFG-MAKKGEE---R-
Sequence 2 CTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRS

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AGEL-LQFRRVKC-YP-DTK--FHVEK-S-PNYLA-LVKY--GDG--V-V
Sequence 2 AGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           DIK-KG-D-----K-SWGA-WRID-P--L-GPFT-R-T-E-G---E--DV
Sequence 2 DIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDV

Sequence 1 IPEDWKPDTVYKSKIQF
           IPE-WK-DT-Y--K---
Sequence 2 IPEGWKADTSYSAK---



Alignment 18
Sequence 1:
Sequence 2: Allergen Lol p 1.0101, Sequence: AAA63279
Sequence identity: 66.80 (163/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNITA-YGDKWLDAK-T-YG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --P-GA-P-D-GGACGYK-VDKAPF-GMTGCGN-PIFKDG--CGSC-EIK
Sequence 2 K-PTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CSGE-V---ITD-N-E-IA-YHFDLSG-AFG-MAKKGEE---R-
Sequence 2 CTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRS

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AGEL-LQFRRVKC-YP-DTK--FHVEK-S-PNYLA-LVKY--GDG--V-V
Sequence 2 AGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           DIK-KG-D-----K-SWGA-WRID-P--L-GPFT-R-T-E-G---E--DV
Sequence 2 DIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDV

Sequence 1 IPEDWKPDTVYKSKIQF
           IPE-WK-DT-Y--K---
Sequence 2 IPEGWKADTSYSAK---



Alignment 19
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72991
Sequence identity: 63.11 (154/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNITA-YG--WL-A--T-YG
Sequence 2 MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYG

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --P-GA-PDD-GGACGYKD-DKAPF-GM--CGN-PIFKDG--CGSC-E-K
Sequence 2 K-PKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CS--PV-I-ITD-N-E-IAAYHFDLSG-AFGAMAK-G----LRK
Sequence 2 CSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRK

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AG----QFRRV-C-YP--TK--FHVEKGS-PNY-A-LVKY--GDG--V-V
Sequence 2 AGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           --K-KGS-E--P---SWGAIWRID-PKPLKGPF--R-T-ES-------DV
Sequence 2 ELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDV

Sequence 1 IPEDWKPDTVYKSKIQF-
           IP--WK----YKS-IQ--
Sequence 2 IPDNWKANALYKSEIQVD



Alignment 20
Sequence 1:
Sequence 2: Allergen Sor h 1.0101, Sequence: ABC58726
Sequence identity: 64.75 (158/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           ------G-NIT-TYG--WL--KAT-YG--P-GA-PDD-GGACGYKDV-KA
Sequence 2 PPKVAKGKNITETYGSDWLERKATWYGK-PTGAGPDDNGGACGYKDVNKA

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEP--AECSGEPVLIKITDKNY
           PF--M--CGN-PIFKDGL-CGSC-EIKC--P--AECSGE-V---ITD-NY
Sequence 2 PFNSMGACGNLPIFKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNY

Sequence 1 EHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKI
           E-IAAYHFDL-G-AFGAMAKKG-E-KL-KAG-----FRRVKC-Y----K-
Sequence 2 EQIAAYHFDLAGHAFGAMAKKGQEEKLAKAGIIDMKFRRVKCKY--GEKV

Sequence 1 AFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIW
           -FHVEKGS-PNYLALLVKY--GDG-IVGVDIK-KG-D---P-K-SWGAIW
Sequence 2 TFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKGGDAYQPLKHSWGAIW

Sequence 1 RIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           R-D-P-P-K-P-T---T-E-G-----DDVIPE-WK-DT-Y--K---
Sequence 2 RKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK---



Alignment 21
Sequence 1:
Sequence 2: Allergen Pas n 1.0101, Sequence: ACA23876
Sequence identity: 64.34 (157/244)
Sequence 1 ------------------------AMGDKPGPNITATYGDKWLDAKATFY
           -----------------------------PGPNIT--Y--KWL-AKAT-Y
Sequence 2 MGSLAKIVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWY

Sequence 1 GSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEI
           G--P-GA-PDD-GGACG-K-V---P--G-T-CGN-PIFKDG--CGSCYEI
Sequence 2 GQ-PNGAGPDDNGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEI

Sequence 1 KCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLR
           -C--P-ECSG-PV---ITD-NYE-IA-YHFDLSGKAFGAMAK-G--DKLR
Sequence 2 RCNKP-ECSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAMAKPGLNDKLR

Sequence 1 KAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVG
           --G---L-FRRV-C-Y----KI-FHVEKGS-PNYLA-LVK--A-DG-IV-
Sequence 2 HYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVL

Sequence 1 VDIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDD
           ---K-K-SD---PMK-SWGAIWR-D-PK-L--PF-IRLTSESG--V---D
Sequence 2 MELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQD

Sequence 1 VIPEDWKPDTVYKSKIQF
           VIP--WKPDTVY-S--QF
Sequence 2 VIPVNWKPDTVYNSNVQF



Alignment 22
Sequence 1:
Sequence 2: Allergen Zea m 1, Sequence: P58738
Sequence identity: 61.48 (150/244)
Sequence 1 -------------------------AMGDKPGPNITATYGDKWLDAKATF
           ------------------------------PGPNIT--Y--KWL-A-AT-
Sequence 2 MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATW

Sequence 1 YGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYE
           YG--P-GA---D-GGACG-K-V---P--GMT-CGN-PIFKDG--CGSCYE
Sequence 2 YGQ-PNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYE

Sequence 1 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL
           --CKE--ECSG-PV---ITD-NYE-IA-YHFDLSGKAFG--AK-G--DK-
Sequence 2 VRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKI

Sequence 1 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV
           R--G-----FRRV-C-YP---KI-FH-EKG--PNYLA-LVKY-A-DG-IV
Sequence 2 RHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIV

Sequence 1 GVDIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQD
           ---I--K-S-E--PMK-SWGAIWR-D--K-LKGPF-IRLTSESG--V---
Sequence 2 LMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAK

Sequence 1 DVIPEDWKPDTVYKSKIQF-
           DVIP--W-PD-VY-S--QF-
Sequence 2 DVIPANWRPDAVYTSNVQFY



Alignment 23
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72990
Sequence identity: 57.38 (140/244)
Sequence 1 -------------------------AMGDKPGPNITATYGDKWLDAKATF
           ------------------------------PGPNIT--Y---WL-A-AT-
Sequence 2 MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATW

Sequence 1 YGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYE
           YG--P-G----D-GGACG-K-V---P--GM--CGN-PIFKDG--CGSCYE
Sequence 2 YGQ-PYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYE

Sequence 1 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL
           -KC--PA-CS--PV---ITD-NYE-I-AYHFD-SGKAFGAMA--G-E--L
Sequence 2 VKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETEL

Sequence 1 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV
           RKAG----QFRRV-C-YP---K--FHVEKGS-PNYLA-LVK--A-DG---
Sequence 2 RKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVI

Sequence 1 GVDIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQD
           --D----G-----PMK-SWGAIWR-D---PLK-PF-IR-T-ESG------
Sequence 2 QMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAK

Sequence 1 DVIPEDWKPDTVYKSKIQF-
           DVIP--W-PD--Y-S--QF-
Sequence 2 DVIPVNWMPDAIYVSNVQFY



Alignment 24
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: Q40638
Sequence identity: 59.84 (146/244)
Sequence 1 -----------------------AMGDKPGPNITATYGDKWLDAKATFYG
           ----------------------------PGPNIT--YGDKWL-A------
Sequence 2 MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGM-

Sequence 1 SDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK
           --PR--AP-D-GGACGYKDVDKAPF-GM--CGN-PIFKDG--CGSC-EIK
Sequence 2 VRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIK

Sequence 1 CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRK
           C--P--CS--P-LI--TD-N-E-IAAYHFDLSG-A---MAK-G----LRK
Sequence 2 CSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRK

Sequence 1 AGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGV
           AG----QFRRVKC-YP-DTKI-FH-EK-S-PNYLALLVKY-AGDG--V-V
Sequence 2 AGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEV

Sequence 1 DIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDV
           -IK-KGS-E----K-SWGAIWRID-PKPLKGPF--R-T-E--------D-
Sequence 2 EIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDA

Sequence 1 IPEDWKPDTVYKSKIQF
           IP-------V-------
Sequence 2 IPDPGRRQRVQVNVQAK



Alignment 25
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72984
Sequence identity: 51.64 (126/244)
Sequence 1 ----------------------AMGDKPGPNITA---TYGDKWLDAKATF
           ------------------------G--PG-N--A---T----W--A-AT-
Sequence 2 MAFSISKKAAVAALFSFLVVTCVAGARPG-NFSASDFTADPNWEVARATW

Sequence 1 YGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYE
           YG--P-GA-PDD-GGACG-K-----PF--MT-CGNEPIFKDG--CGSCY-
Sequence 2 YGA-PTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQ

Sequence 1 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL
           I-C-----CSG-P----ITD-NY-----YHFDLSG-AFGAMAK-G--D-L
Sequence 2 IRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQL

Sequence 1 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV
           R-AG----QF-RV-C--P---K--FHVE-GS-P-Y-A-LV-Y--GDG--V
Sequence 2 RHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEYEDGDGDVV

Sequence 1 GVDIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQD
           -VD-----S----PM--SWG-IWR-D----L--PF--R-T-ESG------
Sequence 2 QVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVAS

Sequence 1 DVIPEDWKPDTVYKSKIQF--
           -VIP--W-P--VY-S--Q---
Sequence 2 QVIPANWAPMAVYRSFVQYSS



Alignment 26
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72987
Sequence identity: 51.23 (125/244)
Sequence 1 --------------------------AMGDKPGPNITATYGDKWLDAKAT
           ---------------------------------------YG--WL-A-AT
Sequence 2 MAARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARAT

Sequence 1 FYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCY
           -YG--P-GA-PDD-GGACG-K-V---PF--MT-CGNEPIFKDG--CGSCY
Sequence 2 WYGA-PTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCY

Sequence 1 EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDK
           -I-C-----CSG------ITD-NY---A-YHFDLSG-AFGAMAK-G--DK
Sequence 2 QIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDK

Sequence 1 LRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNI
           LR--G----QFRRV-C-YP---KI-FHVE-GS-P-Y-A-LV-Y---DG--
Sequence 2 LRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFAVLVEYEDLDGDV

Sequence 1 VGVDIKPKGS------DEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSES
           V-VD-----S----------PM--SWG-IWR-D----L--PF--R--S-S
Sequence 2 VQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDS

Sequence 1 GGHVEQDDVIPEDWKPDTVYKSKIQF-
           G-------VIP--W-P---Y-S--QF-
Sequence 2 GKTLVANNVIPANWSPNSNYRSIVQFS



Alignment 27
Sequence 1:
Sequence 2: Allergen Zea m 1, Sequence: Q07154
Sequence identity: 49.18 (120/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           ----MT-CGN-PIFKDG--CGSCYE--CKE--ECSG-PV---ITD-NYE-
Sequence 2 ----MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEP

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           IA-YHFDLSGKAFG--AK-G--DKLR--G-----FRRV-C-YP---KI-F
Sequence 2 IAPYHFDLSGKAFGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           H-EKG--PNY-A-LVK--A-DG-IV---I--K-S-E--PMK-SWGAIWR-
Sequence 2 HIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRM

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF-
           D--K-LKGPF-IRLTSESG--V---D-IP--W-PD-VY-S--QF-
Sequence 2 DTAKALKGPFSIRLTSESGKKVIAKDIIPANWRPDAVYTSNVQFY



Alignment 28
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAB61710
Sequence identity: 50.41 (123/244)
Sequence 1 -------------AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDD
           -------------------G------Y---WL-AKAT-YG--P-GA-PDD
Sequence 2 MAGASAKVVAMLLSVLATYGFAAGVVYTNDWLPAKATWYGQ-PNGAGPDD

Sequence 1 HGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGE
           -GGACG-K-----PF--MT-CGNEP-F-DG--CG-CY-I-C-----CSG-
Sequence 2 NGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQ

Sequence 1 PVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRR
           P----ITD-NY---A-YHFDLSG-AFGAMA--G--D-LR-AG----QFRR
Sequence 2 PRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRR

Sequence 1 VKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK---PKGS
           V-C-Y-------FHVE-GS-P-YLA-LV--A--DG--V--D-----P-G-
Sequence 2 VPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGK

Sequence 1 DE--FLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDW
           ------PM--SWG-IWR-D----L-GP---R--SESG--V----VIP--W
Sequence 2 PTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANW

Sequence 1 KPDTVYKSKIQF-
           ---T-Y-SK-QF-
Sequence 2 RANTNYGSKVQFR



Alignment 29
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72989
Sequence identity: 47.95 (117/244)
Sequence 1 -------------------------AMGDKPGPNITATYGDKWLDAKATF
           ---------------------------G--------------W--AKAT-
Sequence 2 VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATW

Sequence 1 YGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYE
           YG--P-GA---D-GGACG-K-V---PF-GMT-CGN-P--K-G--CGSCY-
Sequence 2 YGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYR

Sequence 1 IKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL
           --C-----CSG------ITD-NY-----YHFDLSG-AFG--AK-G--D-L
Sequence 2 VRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDL

Sequence 1 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV
           R-AG----QF-RV-CE-P---K--FHVE-GSSP-YLA-LV-Y--GDG---
Sequence 2 RRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVA

Sequence 1 GVDIKPKGSD--EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVE
           -VD-K--G-------PM--SWG--WR-D----L--PF-IR--S-SG----
Sequence 2 QVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLV

Sequence 1 QDDVIPEDWKPDTVYKSKIQF--
           --DVIP--W-P-T-Y-S--Q---
Sequence 2 APDVIPLNWTPNTFYRSFVQYSS



Alignment 30
Sequence 1:
Sequence 2: Allergen Tri a ps93, Sequence: AAD10496
Sequence identity: 49.18 (120/244)
Sequence 1 ----------------------AMGDKPGPNITATYGDKWLDAKATFYGS
           -----------------------------------Y---WL-AKAT-YG-
Sequence 2 MAGVSSNAIALVALLSMLFTSVRSAVNYDTAVARSYTSGWLPAKATWYGA

Sequence 1 DPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKC
           -P-GA-PDD-GGACG-K-V---P---M--CGNEPIF--G--CG-CYEIKC
Sequence 2 -PNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKC

Sequence 1 K---EPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL
           -----P--CSG-P--I-ITD-NY---A-YH-DLSG-AFG-MAK-G--D-L
Sequence 2 EYSNNPS-CSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRL

Sequence 1 RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV
           R-AG----QFRRV-C--P---K--FHV--GS-PNYLA-LV-Y---DG--V
Sequence 2 RHAGIIDMQFRRVPCNFPG-MKVTFHVQRGSNPNYLAVLVEYVNVDGTVV

Sequence 1 GVDI------KPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESG
           -----------P-G------M--SWG--WR-D---P--GPF-IR-TS--G
Sequence 2 RMELMQTMNGRPTGY--WQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTG

Sequence 1 GHVEQDDVIPEDWKPDTVYKSKIQF-
           --------IP--W--D--Y-S--QF-
Sequence 2 KTLVANNAIPAYWQQDHAYWSNLQFY



Alignment 31
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72985
Sequence identity: 48.77 (119/244)
Sequence 1 -------------------------------------AMGDKPGPNITAT
           ---------------------------------------G--------A-
Sequence 2 MGSLSSLAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAV

Sequence 1 YGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPI
           Y---W--A-AT-YG--P-GA-PDD-GGACG-K-----PF--MT-CGN-P-
Sequence 2 YWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPL

Sequence 1 FKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAF
           FKDG--CGSCY-I-C-----CSG------ITD-NY---A--HFDLSG-AF
Sequence 2 FKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAF

Sequence 1 GAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLAL
           G--AK-G--DKLR--G-----F-RV-CE-P---KI-FHVE--S-P-Y-A-
Sequence 2 GRLAKPGLNDKLRHSGIIDIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAV

Sequence 1 LVKYAAGDGNIVGVDI--------KPKGSDEFLPMKQSWGAIWRIDPPKP
           LV-Y--GDG--V-VD----------P-G-----PM--SWG-IWR-D----
Sequence 2 LVEYEDGDGDVVQVDLMESKTAHGPPTG--KWTPMRESWGSIWRLDTNHR

Sequence 1 LKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF-
           L--PF-IR---ESG-------VIP--W-P-T-Y-S--Q--
Sequence 2 LQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS



Alignment 32
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72988
Sequence identity: 54.10 (132/244)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSS

Sequence 1 ------------------------AMGDKPGPNITATYGDKWLDAKATFY
           --------------------------G-----------G--WL-A-AT-Y
Sequence 2 SNSSTPSIPPPVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWY

Sequence 1 GSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEI
           G--P-GA-PDD-GGACG-K-V---PF--MT-CGNEP-FKDG--CGSCY-I
Sequence 2 GA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQI

Sequence 1 KCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLR
           -C-----CSG-P----ITD-NY-----YHFDLSG-AFGAMAK----D-LR
Sequence 2 RCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELR

Sequence 1 KAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV-
           -AG----QFRRV-C-YP--T---FHVE-GS-P-Y-A-LV-Y--GDG--V-
Sequence 2 HAGIIDIQFRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQ

Sequence 1 -----------GVDIKPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRL
           -----------GVD--P-G-----PM--SWG-IWR-D---PL-GPF--R-
Sequence 2 VDLMESRYSTGGVDGTPTGV--WTPMRESWGSIWRLDTNHPLQGPFSLRI

Sequence 1 TSESGGHVEQDDVIPEDWKPDTVYKSKIQF-
           T-ESG-----D-VIP-DW-P-TVY-S--QF-
Sequence 2 TNESGKTLIADQVIPADWQPNTVYSSIVQFD



Alignment 33
Sequence 1:
Sequence 2: Allergen Gly m 2, Sequence: AAA50175
Sequence identity: 42.62 (104/244)
Sequence 1 ------------------------------AMGDKPGPNITATYGDKWLD
           -----------------------------------------------W--
Sequence 2 MALTLQRALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSP

Sequence 1 AKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLA
           A-AT-YG--P--------GGACGY---V---PF------G---I---G--
Sequence 2 AVATWYG--P-ANGDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKG

Sequence 1 CGSCYEIKCKEPAECSGEPVLIKITDK--NYEHIAAYHFDLSGKAFGAMA
           CGSCYE-KC-----CSG-PV---ITD--------A-YHFDLSG-AFGAMA
Sequence 2 CGSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMA

Sequence 1 KKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKY
           --G----LR-AG----Q-RR--C-YP----IAFHV--GS---Y-A-LV-Y
Sequence 2 ISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSGSNQEYFATLVEY

Sequence 1 AAGDGNIVGVDIKPK-GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTS
           --GDG----V--K----S-----M-QSWGA-W--D---PL--PF-I-LT-
Sequence 2 EDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTT

Sequence 1 -ESGGHVEQDDVIPEDWKPDTVYKSKIQF--
           -ESG-------VIP--W-P---Y-S---F--
Sequence 2 LESGQTIVANNVIPAGWTPGQTYRSIVNFAT



Alignment 34
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72986
Sequence identity: 43.85 (107/244)
Sequence 1 ---------------------------AMGDKPGPNITATYGDKWLDAKA
           -----------------------------------------G--W----A
Sequence 2 MVSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGA

Sequence 1 TFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGS
           T-YG--P-G------GGACGY---V---PF--M---G----FK-G--CGS
Sequence 2 TWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGS

Sequence 1 CYEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKK
           CY-IKC-----CSG-PV---ITD----------A-HFD-SG-AFGAMA--
Sequence 2 CYQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANR

Sequence 1 GEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAA
           G--D-LR-AG-L--Q--RV-C--------AF-V--GS-P-YLA-LV-YA-
Sequence 2 GMGDRLRSAGVLKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYAN

Sequence 1 GDGNIVGVDI-KPKGSDEFLPMKQSWGAIWRIDPP--KPLKGPFTIRLTS
           GDG----V-I-K--G------M-QSWGA-WR------KPL--PF-IRLTS
Sequence 2 GDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFSIRLTS

Sequence 1 ESGGHVEQDDVIPEDWKPDTVYKSKIQF--
           -SG-------VIP--W-----Y-S------
Sequence 2 GSGKVLVANNVIPSGWQAGLTYRSTVNYAA



Alignment 35
Sequence 1:
Sequence 2: Allergen Ara t expansin, Sequence: CAB37496
Sequence identity: 31.15 (76/244)
Sequence 1 -------AMGDKPGPNITATYGDKWL-DAKATFYGSDPRGAAPDDHGGAC
           ------------------A---D--L---KA----S-----A-----GAC
Sequence 2 MLQGFLFLLSVVLLFSSSAAACDRCLHSSKAAYFSS-----ASALSSGAC

Sequence 1 GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIK
           -Y-------F-G--------I-KDG--CG-C----CK-P--CS-------
Sequence 2 AYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVI

Sequence 1 ITDKNYEHIAAYHFDLSGKAFGAMAKK--GEEDKLRKAGELMLQFRRVKC
           -TD-N----------LS--AF-AMAK---G----L-K-G------RRV-C
Sequence 2 VTDLNKTNQT--DLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPC

Sequence 1 EYPSDTKIAFHVEKGS-SPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLP
           -Y----K----VE--S--PNYLA----Y--G----V---I---GS-----
Sequence 2 DY-GNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSY

Sequence 1 MKQSWGAIWRID--PPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTV
           M--S-GA-W--D--P---L---F--------G--V----V-P--W-----
Sequence 2 MTRSHGAVWVTDKVPNGALQFRFVVT-AGYDGKMVWSQRVLPANWEAGKS

Sequence 1 YKSKIQF-----------------
           Y----Q------------------
Sequence 2 YDAGVQITDIAQEGCDPCDDHIWN



Alignment 36
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAG13596
Sequence identity: 26.64 (65/244)
Sequence 1 ------------AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDH
           -------------------------------D----------R-------
Sequence 2 MAVRCCSSMASASVVLFFVVVGMSASMVSGCDRCVRRSKAGFRDSSIALN

Sequence 1 GGACGYKDVDKAPFDGMTGCGNEP-IFKDGLACGSCYEIKCKEPAECSGE
           -G-CGY-----A-F-G-------P--F--G--CG-C----CK----CS--
Sequence 2 AGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTA

Sequence 1 PVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRR
           ------TD------------LS--A--AMA--G----LR----------R
Sequence 2 GAKVVVTDEA-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKR

Sequence 1 VKCEYPSDTKIAFHVE-KGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDE
           V-CEY---------VE-K---P--L-----Y--G---IV-VD----GS--
Sequence 2 VPCEYAAGRNLSIRVEEKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSN

Sequence 1 FLPMKQSWGAIWRI--DPPKPLKGPFTIRLTSESGGH-VEQD-DVIPEDW
           ---M----G--W-----P--PL---F----T----G--V--D--V-P--W
Sequence 2 WKFMTRDYGPAWSTAQAPAGPLQ--FRVVVTGGYDGKWVWADGEVLPRRW

Sequence 1 KPDTVYKSKIQF-----------------
           ----VY----Q------------------
Sequence 2 TAGRVYDAGVQIADVAQEGCYPCDTQEWK



Alignment 37
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: BAA85432
Sequence identity: 29.51 (72/244)
Sequence 1 ---------------------------------AMGDKPGPNITATYGDK
           --------------------------------------P-P-----Y---
Sequence 2 MASSWNNPAIFLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTS

Sequence 1 -WLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAP-FDGMTGCGNEPIFK
           -W-D--ATFYG-DP-G---DD-GGACGY---D--------T-----P-F-
Sequence 2 DWHDGSATFYG-DPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFA

Sequence 1 DGLACGSCYEIKCKEPAECS-GEP-VLIKIT------------DKNYEHI
           DG--CG-CYE--C-----C--G-P-V-I--T------------D------
Sequence 2 DGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNP

Sequence 1 AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFH
           ---HFD-----F---A--------R-AG----Q-RRV-C-----------
Sequence 2 PRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCL-

Sequence 1 VEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD-EFLPMKQSWGAIWRI
           ---G-----L-L-V----G-G-------K--G-----------WG-----
Sequence 2 --QGNH-YWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQV

Sequence 1 DPPKPLKGPFTIRLTSESGGH--VEQDDVIPEDWKPDTVYKSKIQF-
           ----------T--LT--S---------D-I---W-----Y-----F-
Sequence 2 FAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNFY



Alignment 38
Sequence 1:
Sequence 2: Allergen Cyn d 15, Sequence: AAP80171
Sequence identity: 20.49 (50/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           ---------------------------A-------------------I-F
Sequence 2 --------------------------MATLTFPVLLATMVGHAWCVNIIF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           HVE--SSP---AL--K--A----I--VD----G-D---PM--S-G--W-I
Sequence 2 HVEE-SSPKF-ALSIKDSAKE--ITQVDVREHGADNMDPMTKS-GDSWTI

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF-
           D--KPLKGP--IRL--E-GG---QDDVIPE-WK--T-Y--K--F-
Sequence 2 D--KPLKGPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHFG



Alignment 39
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: P14947
Sequence identity: 16.39 (40/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           -------------------------------------------------F
Sequence 2 --------------------------------------------AAPVEF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -VEKGS----LAL--KY---------V--K--GS-E-L--K------W-I
Sequence 2 TVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEI

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           ---KPLKGPF--R--SE-G-----DDV-P-D-K--T-YK-----
Sequence 2 KSDKPLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYKPE---



Alignment 40
Sequence 1:
Sequence 2: Allergen Cyn d 2, Sequence: CAA10346
Sequence identity: 16.39 (40/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           -------------------------------M--------------K--F
Sequence 2 ------------------MSMASSSSSGLLAMAVLAALFAGAWCVPKVTF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -VEKGS----LA-LVKY--GD-----V-----GSDE---M----G--W--
Sequence 2 TVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTF

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           D---PLKGPF--R---E-G-----DDV-PE-------Y------
Sequence 2 DSEEPLKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE--



Alignment 41
Sequence 1:
Sequence 2: Allergen Phl p 2, Sequence: P43214
Sequence identity: 15.98 (39/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           -------------------------------M--------------K--F
Sequence 2 ------------------MSMASSSSSSLLAMAVLAALFAGAWCVPKVTF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -VEKGS----LA-LVKY--GD-----V-----GSDE---M----G--W--
Sequence 2 TVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTF

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           D---PL-GPF--R---E-G-----DDV-PE-------Y------
Sequence 2 DSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE--



Alignment 42
Sequence 1:
Sequence 2: Allergen Dac g 2, Sequence: CAA10345
Sequence identity: 15.98 (39/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           -------------------------------M--------------K--F
Sequence 2 ------------------MSMASSSSSGLLAMAVLAALFAGAWCVPKVTF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -VEKGS----LA-LVKY--GD-----V-----GSDE---M----G--W--
Sequence 2 TVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTF

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           D---PL-GPF--R---E-G-----DDV-PE-------Y------
Sequence 2 DSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE--



Alignment 43
Sequence 1:
Sequence 2: Allergen Poa p 2, Sequence: CAA10348
Sequence identity: 15.98 (39/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           -------------------------------M--------------K--F
Sequence 2 ------------------MSMASSSSSSLLAMAVLAALFAGAWCVPKVTF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -VEKGS----LA-LVKY--GD-----V-----GSDE---M----G--W--
Sequence 2 TVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTF

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           D---PL-GPF--R---E-G-----DDV-PE-------Y------
Sequence 2 DSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE--



Alignment 44
Sequence 1:
Sequence 2: Allergen Lol p 2, Sequence: CAA51775
Sequence identity: 15.57 (38/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           -------------------------------------------------F
Sequence 2 ------------------------------------------------EF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -VEKGS----LAL--KY---------V--K--GS-E-L--K------W-I
Sequence 2 TVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEI

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           ---KPLKGPF--R--SE-G-----DDV-P-D-K--T--------
Sequence 2 KSDKPLKGPFNFRFVSEKGMWNVFDDVVPADFKVGT--------



Alignment 45
Sequence 1:
Sequence 2: Allergen Dac g 3, Sequence: P93124
Sequence identity: 14.34 (35/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           ----------------------------------------------K--F
Sequence 2 ---------------------------------------------VKVTF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -VEKGS-P--L-L--KY---------V-----GS-E--P-----G--W--
Sequence 2 KVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEV

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           ---KPL-GPF--R--S--G-----D-VIP---K--T-Y------
Sequence 2 KSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE--



Alignment 46
Sequence 1:
Sequence 2: Allergen Phl p 3.0101, Sequence: 2JNZ_A
Sequence identity: 13.52 (33/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           -------------------------------------------S-----F
Sequence 2 ---------------------------------RGSHHHHHHGSAVQVTF

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -V-KGS-P--L-L--KY---------V-----GS-E--P-----G--W--
Sequence 2 TVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEV

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           ---KPL-GPF--R--S--G-----D-VIP--------YK-----
Sequence 2 KSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE--



Alignment 47
Sequence 1:
Sequence 2: Allergen Lol p 3, Sequence: P14948
Sequence identity: 13.11 (32/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           ---------------------------------------------TK---
Sequence 2 ---------------------------------------------TKVDL

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -VEKGS----L-L--KY---------V-----GS-E--PM----G--W--
Sequence 2 TVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEV

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           ---KPL-GP---R--S--G-----D-VIP--------Y------
Sequence 2 KSAKPLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPEYN-



Alignment 48
Sequence 1:
Sequence 2: Allergen Tri a 3, Sequence: CAA90746
Sequence identity: 12.70 (31/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           ------------------------------L---------------K---
Sequence 2 -----------------------MASASRMLTVAVLAALFAGAMAVKVKL

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           -V-KGS----LAL---Y---------V-----GS-E--P-----G--W--
Sequence 2 TVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEV

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           ---KPL-GPF--R--S--G-----D-V---D-K----Y------
Sequence 2 SCSKPLVGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYEPEY--



Alignment 49
Sequence 1:
Sequence 2: Allergen Dac g 1.0101, Sequence: Q7M1X8
Sequence identity: 9.84 (24/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           -----PGPNITATYGDKWLDAK-T-YG--P-GA-P---------------
Sequence 2 IPKVPPGPNITATYGDKWLDAKSTWYGK-PTGAGP---------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           --------------------------------------------
Sequence 2 --------------------------------------------



Alignment 50
Sequence 1:
Sequence 2: Allergen Ant o 1.0101, Sequence: Q7M1X6
Sequence identity: 9.43 (23/244)
Sequence 1 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA
           -----PGPNITATYGDKWLDAK-T-YG--P-GA-----------------
Sequence 2 IAKVPPGPNITATYGDKWLDAKSTWYGK-PTGA-----------------

Sequence 1 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF
           --------------------------------------------
Sequence 2 --------------------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.