The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Fag e 1

Sequence 2317670

Full FASTA alignment

Sequence name:
Query sequence:
MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARDLK
LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADV
FNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY
VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE
LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV
FLPFQSRDEKERERF

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Fag e 1BAA21758Go!565717.44.5e-208
2Fag e 1Q9XFM4Go!538487.38.3e-139
3Fag e 1BAA21760Go!504392.32.9e-110
4Pru du 6.0101ADN39440Go!551229.24.0e-61
5Pru du 63EHK_AGo!531224.51.0e-59
6Pis v 5.0101EU410073Go!473189.14.2e-49
7Pis v 2.0101DQ631676Go!496169.92.7e-43
8Ses i 7.0101Q9AUD2Go!497157.41.5e-39
9Ber e 2AAO38859Go!465157.21.6e-39
10Ana o 2AAN76862Go!457154.01.4e-38
11Cor a 9AAL73404Go!515151.87.6e-38
12Jug r 4.0101Q2TPW5Go!507149.34.1e-37
13Car i 4.0101ABW86978Go!505147.71.3e-36
14Pis v 2.0201DQ631677Go!472144.88.8e-36
15Pru du 6.0201ADN39441Go!504144.11.6e-35
16Sin a 2.0101Q2TLW0Go!510141.68.7e-35
17Gly m 6.0301P11828Go!481141.01.2e-34
18Ses i 6.0101Q9XHP0Go!459135.07.7e-33
19Gly m 6.0401Q9SB11Go!563126.82.9e-30
20Gly m 6.0501Q7GC77Go!517122.84.1e-29
21Ara h 3O82580Go!507113.42.8e-26
22Ara h 3AAC63045Go!510113.42.8e-26
23Gly m glycinin G2CAA68460Go!485102.35.9e-23
24Gly m 6.0201P04405Go!485102.35.9e-23
25Gly m glycinin G1AAA33966Go!49598.96.3e-22
26Gly m 6.0101P04776Go!49598.96.3e-22
27Ara h 4AAD47382Go!53098.39.9e-22
28Gly m Bd28KBAB21619Go!47337.61.6e-03
29Lup an 1.0101ACB05815Go!61135.68.5e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 100.00 (565/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
Sequence 2 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
Sequence 2 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL

Sequence 1 YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
           YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
Sequence 2 YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD

Sequence 1 DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARDLK
           DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARDLK
Sequence 2 DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARDLK

Sequence 1 LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADV
           LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADV
Sequence 2 LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADV

Sequence 1 FNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY
           FNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY
Sequence 2 FNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY

Sequence 1 VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE
           VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE
Sequence 2 VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE

Sequence 1 LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV
           LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV
Sequence 2 LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV

Sequence 1 FLPFQSRDEKERERF
           FLPFQSRDEKERERF
Sequence 2 FLPFQSRDEKERERF



Alignment 2
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 91.15 (515/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           MSTKLILSFSLCLMVLSCSAQLLPW-KGQRSRPH-GHQQF-HQCD-QRLT
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           ASEPSRRVRSEAGVTEIWD-DTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           PYITFVEQGRGVQGVVVPGCPETFQS-SEFEYP-SQRDQRSRQSES-ESS
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           RGDQR-RQSESEE-SRGDQR-RQSESEEFSRGDQ----------------
Sequence 2 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQ----------------

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           --------------HQKIFRIRDGDVIPSPAGVVQWTHN-GDNDLISITL
Sequence 2 --------------HQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITL

Sequence 1 YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
           YDANSFQNQLD-NVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRES-D
Sequence 2 YDANSFQNQLDENVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESQD

Sequence 1 DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARDLK
           DEALLEANIL-GF-DEILQEIFRNVDQETISKLRG-NDQRGFIVQARDLK
Sequence 2 DEALLEANILSGFEDEILQEIFRNVDQETISKLRGENDQRGFIVQARDLK

Sequence 1 LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADV
           LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKF-QNVNRPSRADV
Sequence 2 LRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFRQNVNRPSRADV

Sequence 1 FNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY
           FNPRAGRINTV-SNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY
Sequence 2 FNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY

Sequence 1 VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE
           VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE
Sequence 2 VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVE

Sequence 1 LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV
           LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV
Sequence 2 LKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEV

Sequence 1 FLPFQSRDEKERERF---
           F-PFQSRDEKERERF---
Sequence 2 FRPFQSRDEKERERFSIV



Alignment 3
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 76.99 (435/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQ--QFHHQCDVQR
           MSTKLILSFSLCLMVLSCSAQL-PW-KGQ-SRPH-G-Q--QF-HQCD-QR
Sequence 2 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           LTASEPSRRVRSEAGVTEIWD-DTPEFRC-GFVAVRVVIQPGGLLLPSYS
Sequence 2 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEE
           NAPYITFVEQGRGVQGVV-PGCPETFQS-SEFEYPQSQR---SRQSESEE
Sequence 2 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE

Sequence 1 SSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD
           -S------------------------------------------------
Sequence 2 ES------------------------------------------------

Sequence 1 QRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISI
           -----------SRGDQHQKIFRIR-GDVIPSPAGVVQWTHNDG--DLIS-
Sequence 2 -----------SRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISV

Sequence 1 TLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRES
           TL-DANS---QLD-NVR-FFLAGQS---------QR-TREEGSDRQSRES
Sequence 2 TLLDANSYHKQLDENVRSFFLAGQS---------QRETREEGSDRQSRES

Sequence 1 DDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARD
           DDDEALL-ANIL-GFQDEIL-E-FR-VD-ETISKLRG-NDQRGFIVQA-D
Sequence 2 DDDEALLGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQD

Sequence 1 LKLRVPEEYEEELQRERGDRKR--GGSGRSNGLEQAFCNLKFKQNVNRPS
           LKLRVP---EEE--RERGDR-R--GGSGRSNG-EQ-FCNLKF--N-N-P-
Sequence 2 LKLRVPQDFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPT

Sequence 1 RADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAH
           ---VFNPRAGRINTVNSN-LPILEF-QLSAQHVVLYKNAI-GPRWNLNAH
Sequence 2 NTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAH

Sequence 1 SALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGL
           SALYVTRGEGRVQVVGDEG-SVFDD-VQRGQILVVPQGFAVVLKAGREGL
Sequence 2 SALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGL

Sequence 1 EWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQ
           EWVELKN--NAITSPI-G-TSVLRAIPVEVLANSYDISTKEA--LKNGRQ
Sequence 2 EWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQ

Sequence 1 EVEVFLPFQSRDEKERERF---
           EVEVF-PFQSRDEKERERF---
Sequence 2 EVEVFRPFQSRDEKERERFSIV



Alignment 4
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 40.71 (230/565)
Sequence 1 MSTKLILSFSLCLMVL--SCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQR
           --------FSLCL------C-A-----R--Q-S-P---------QC----
Sequence 2 --MAKAFVFSLCLLLVFNGCLAA----RQSQLS-PQ-------NQCQLNQ

Sequence 1 LTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP--R---EAG--E-W------F-CAG--A-R--IQ--GL-LPSYS
Sequence 2 LQAREPDNRIQAEAGQIETWNFNQEDFQCAGVAASRITIQRNGLHLPSYS

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEE
           NAP------QGRGV-G-V--GCPETF--ES-------Q--Q--RQ-E-E-
Sequence 2 NAPQLIYIVQGRGVLGAVFSGCPETFE-ESQ------QSSQQGRQQEQEQ

Sequence 1 SSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD
           ------R--Q---E------Q---Q-E------G-Q--------E---G-
Sequence 2 -----ERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQG-

Sequence 1 QRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISI
           Q--R------F---D-HQK--RIR-GDV---PAGV--W--NDGD--L---
Sequence 2 QQGRPQQQQQFRQFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAV

Sequence 1 TLYDANSFQNQLDGNVRNFFLAGQ-----SKQSREDRRSQRQTREEGSDR
           -L----S--NQLD-N-R-F-LAG--------Q-----R-Q------G---
Sequence 2 NLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQ

Sequence 1 Q--SRESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRG
           Q---R-----------N---GF----L-----NV--ET---L-G-ND-R-
Sequence 2 QPFGRPRQQEQQGSGNNVFSGFNTQLLAQAL-NVNEETARNLQGQNDNRN

Sequence 1 FIVQAR-DLKLRVP----------EEYEEELQRERGDRKRGGSGRSNGLE
           -I---R--L----P----------E---E-LQ-ER-----GG----NGLE
Sequence 2 QIIRVRGNLDFVQPPRGRQEREHEERQQEQLQQER--QQQGGQLMANGLE

Sequence 1 QAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVV
           --FC-L--K-N---P-RAD-F-PRAGRI-T-NS-NLPIL-F--LSA----
Sequence 2 ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF

Sequence 1 LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILV
           -Y-N-I--P-WN-NAHS--YV-RG--RVQVV---G----D--VQ-GQ---
Sequence 2 FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI

Sequence 1 VPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANS
           VPQ---V---AG--G-E----K---NA-----AG-TS-LRA-P-EVLAN-
Sequence 2 VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANA

Sequence 1 YDISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF
           Y-IS---A--LK--RQE-------Q-R--------
Sequence 2 YQISREQARQLKYNRQETIALSSSQQRRAVV----



Alignment 5
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 38.76 (219/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           ------------------------------------------QC----L-
Sequence 2 --------------------------------ARQSQLSPQNQCQLNQLQ

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP--R---EAG--E-W------F-CAG--A-R--IQ--GL-LPSYSNA
Sequence 2 AREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           P------QGRGV-G-V--GCPETF--ES-------Q--Q--RQ-E-E---
Sequence 2 PQLIYIVQGRGVLGAVFSGCPETFE-ESQ------QSSQQGRQQEQEQ--

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           ----R--Q---E------Q---Q-E------G-Q--------E---G-Q-
Sequence 2 ---ERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQG-QQ

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           -R------F---D-HQK--RIR-GDV---PAGV--W--NDGD--L----L
Sequence 2 GRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNL

Sequence 1 YDANSFQNQLDGNVRNFFLAGQ-----SKQSREDRRSQRQTREEGSDRQ-
           ----S--NQLD-N-R-F-LAG--------Q-----R-Q------G---Q-
Sequence 2 FHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQP

Sequence 1 -SRESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFI
           --R-----------N---GF----L-----NV--ET---L-G-ND-R--I
Sequence 2 FGRPRQQEQQGNGNNVFSGFNTQLLAQAL-NVNEETARNLQGQNDNRNQI

Sequence 1 VQAR-DLKLRVP-----EEYEEELQRERGDRKRGGSGR---SNGLEQAFC
           -Q-R--L----P-----E---EE-Q-E-----R---G-----NGLE--FC
Sequence 2 IQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFC

Sequence 1 NLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKN
           -L--K-N---P-RAD-F-PRAGRI-T-NS-NLPIL-F--LSA-----Y-N
Sequence 2 SLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRN

Sequence 1 AILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQG
           -I--P-WN-NAHS--YV-RG--RVQVV---G----D--VQ-GQ---VPQ-
Sequence 2 GIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQN

Sequence 1 FAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDIS
           --V---AG--G-E----K---NA-----AG-TS-LRA-P-EVLAN-Y-IS
Sequence 2 HGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQIS

Sequence 1 TKEAFRLKNGRQEVEVFLPFQSRDEKERERF
           ---A--LK--RQE-------Q-R--------
Sequence 2 REQARQLKYNRQETIALSSSQQRRAVV----



Alignment 6
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 37.52 (212/565)
Sequence 1 MSTKLILSFSLCLMVL--SCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQR
           M-----LS-S-CL--L---C-A----------SR---G-QQ----C----
Sequence 2 MANPSLLSLSVCLLILFHGCLA----------SR-QQGQQQ--NECQIDQ

Sequence 1 LTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP--RV--EAG--E-WD-----FRCAG----R--IQP-GL-LP-YS
Sequence 2 LDALEPDNRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYS

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEE
           NAP-------G-G--G---PGCPET-Q-------PQ--------------
Sequence 2 NAPTLMYIVEGEGMTGTLIPGCPETYQA------PQ--------------

Sequence 1 SSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD
           ---G-Q------S--F----------------------------------
Sequence 2 --QGQQ---HGQSSRFQ---------------------------------

Sequence 1 QRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISI
           --------------D-HQKI-R-R-GD-I--PAGV--W--N-G-------
Sequence 2 --------------DKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTV

Sequence 1 TLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRES
           TL-D----QNQLD---R-F-LAG------ED---Q-Q-------RQS---
Sequence 2 TLLDVSNSQNQLDMYPRKFNLAGNP----EDEFQQQQQQQSRGRRQSQQK

Sequence 1 DDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQAR-
           ---------NI--GF---IL-E-F--V-Q-----L----D-RG-IV----
Sequence 2 SCN------NIFCGFDTKILAEVFQ-VEQSLVKQLQNEKDNRGAIVKVKG

Sequence 1 DLK-LRVPEEYEEE--LQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNR
           DL---R-P----E------E-----RG--GR-NGLE---C--K-K-N---
Sequence 2 DLQVIRPPRRQSERGFESEEESEYERGRRGRDNGLEETICTMKLKENIHD

Sequence 1 PSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLN
           PSR-D---P--GRI---NS-NLPIL---QLSA---VL--NA---P-WN-N
Sequence 2 PSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFN

Sequence 1 AHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGRE
           AHS--Y---G---VQVV---G--VFD--V--GQI-VVPQ-FAVV--A---
Sequence 2 AHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQ

Sequence 1 GLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLK-N
           --EW---K--D-A--SP-AG-TSVLRA-P-EVLAN---IS---A---K-N
Sequence 2 RFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFN

Sequence 1 GRQEVEVFLPFQSRDEKERERF
           --Q-------------------
Sequence 2 NEQPTLSSGQSSQQMRDDA---



Alignment 7
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 40.88 (231/565)
Sequence 1 MSTKLILSFSL-CLMVLSCS-AQLLPWRKGQRSRPHRGHQQFHHQCDVQR
           M-----LSFSL--L----CS-AQ---------S------Q-F--QC--Q-
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQI---EQVVNSQQRQQQQRFQTQCQIQN

Sequence 1 LTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP-RR--SEAGVTE-WD-------CA-----R--IQ--GLL-PSY-
Sequence 2 LNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYD

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEE
           NAP----V-QG-G--G-V-PGCPETFQ-ES--------R--RS-QS----
Sequence 2 NAPELVYVVQGSGIHGAVFPGCPETFQEESQ----SRSRSERSQQS----

Sequence 1 SSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISI
           -------------G-QHQK---I--GDVI--PAGV--W--N-G---L---
Sequence 2 -------------GEQHQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLV

Sequence 1 TLYDANSFQNQLDGNVRNFFLAGQSKQ----SREDR-RSQRQTREEGSDR
           -L-D-----NQLD---R-F-L-G---Q----S---R-RSQ-Q----G---
Sequence 2 ALADVGNSENQLDQYLRKFVLGGSPQQEIQGSGQSRSRSQSQSSRRG--Q

Sequence 1 QSRESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFI
           Q---S---------NIL--F--EIL---F-N-D------L-----QRG-I
Sequence 2 QGQQSN--------NILSAFDEEILAQSF-NIDTQLARRLQKEKRQRGII

Sequence 1 VQAR-DLKLRVP--EEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQ
           V----DL----P---E-E-E---ER--R-R------NGLE--FC----K-
Sequence 2 VRVQEDLEVLSPHRQEQEQEYEEERERRQR------NGLEETFCTMTLKY

Sequence 1 NVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPR
           N-N-PSRADV-NPR-GR---VN--NLPIL-F-QLSA---VL---AIL-P-
Sequence 2 NINDPSRADVYNPRGGRVSSVNALNLPILRFLQLSAKKGVLHRDAILAPH

Sequence 1 WNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLK
           WN-NAHS--Y-TRG-GR-Q-V---G-SVFD-----GQ--VVPQ-FAVV--
Sequence 2 WNVNAHSIVYITRGNGRIQIVSENGESVFDEEIREGQLVVVPQNFAVVKR

Sequence 1 AGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFR
           A-----EWV--K------TS--AG--SV-RA-P--V--NS-DIS---A-R
Sequence 2 ASSDKFEWVSFKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISREDARR

Sequence 1 LKNGRQEVEVFLP---FQSRDEKERERF---------
           LK--R-E---F-P----Q-----ERER----------
Sequence 2 LKESRSETTIFAPGSSSQRKSQSERERQREREEREIH



Alignment 8
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 39.82 (225/565)
Sequence 1 MSTKLILSFSLC--LMVLSCSAQL-----LPWRKGQRSRPHRGHQQFHHQ
           M-----LSF-----L-----SAQL-------W---Q----H----Q----
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHK--LQARTD

Sequence 1 CDVQRLTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLL
           C-V-RLTA-EP--R--SEAG-TE-WD-----F-CAG--AVR-VIQP-GLL
Sequence 2 CRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLL

Sequence 1 LPSYSNAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQ
           LP-Y-NAP----V--GRG-QG-V-PGC-ETF------------RD---RQ
Sequence 2 LPHYNNAPQLLYVVRGRGIQGTVIPGCAETFE-----------RDTQPRQ

Sequence 1 SESEESSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEE
           ---------D-R-R------F-----------------------------
Sequence 2 ---------DRRRR------FM----------------------------

Sequence 1 FSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDN
           -------------------D-HQK----R-GD----PAG---W--N-G--
Sequence 2 -------------------DRHQKVRQFRQGDILALPAGLTLWFYNNGGE

Sequence 1 DLISITLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDR
           -LI---L-D-----NQLD---R-FFLAG-----R-------QT-------
Sequence 2 PLITVALLDTGNAANQLDQTFRHFFLAGNPQGGRQSYFGRPQT-----EK

Sequence 1 QSRESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFI
           Q--E----------NI--GF-DEIL---F--VD--T---L-G--D-RG-I
Sequence 2 QQGETK--------NIFNGFDDEILADAF-GVDVQTARRLKGQDDLRGRI

Sequence 1 VQARDLKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVN
           V-A--L----P-E-EEE---ER-D---G-----NGLE---C--K---N--
Sequence 2 VRAERLDIVLPGEEEEE-RWER-DPYSG----ANGLEETLCTAKLRENLD

Sequence 1 RPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNL
           -P-RADV-NP--GRI---NS--LP-L----LSA---VLY-N----P-WNL
Sequence 2 EPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNL

Sequence 1 NAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGR
           NAHS--Y-TRG-GR-QVVG--GRSVFD--V--GQ---VPQ---V---A--
Sequence 2 NAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQ

Sequence 1 -EGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLK
           -EGLEW---K--DNA-TS--AG--S--RA-P-EV----Y--S--EA-RLK
Sequence 2 DEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLK

Sequence 1 NGRQEVEVFLPFQSRDEKERERF-------------------
           --R-E--VF------------R--------------------
Sequence 2 YNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM



Alignment 9
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 39.47 (223/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           -------------M-------L---------------Q-----C--QRLT
Sequence 2 -------------MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLT

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP--R---EAGV-E-WD-----FRCAG--A-R--I-P-GLLLP-Y-NA
Sequence 2 AQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           P----V-QGRG--GV--PGCPETFQS-S-F--------Q-SR--E-E---
Sequence 2 PKLYYVTQGRGILGVLMPGCPETFQSMSQF--------QGSREQEEE---

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           RG-----------F------------------------------------
Sequence 2 RG----------RFQ-----------------------------------

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           ------------DQHQK------GD-I--PAGV--W--NDGD-DL-----
Sequence 2 ------------DQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLV

Sequence 1 YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
           ----S--NQLD-N-R-FFLAG---------RSQ-Q--E----R-------
Sequence 2 QHTASDLNQLDQNPRHFFLAGNIQ------RSQKQRGERYGLRGGQQ---

Sequence 1 DEALLEANILTGFQDEILQEIFR-NVDQETISKLRGDNDQRGFIVQA-RD
           ----L--N---GF--E-L--------D-ET--K-RG--DQRG-IV-----
Sequence 2 ---ILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQG

Sequence 1 LKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRA
           LK---P----EEL----G----GG----NGLE---C---F-QN---P--A
Sequence 2 LKVIRPPRIREELEQQEG----GGY---NGLEETICSATFIQNIDNPAEA

Sequence 1 DVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSA
           D--NPRAGR--TVNS---PIL-F-QLSA---VLY-NA---P-W-LNA-S-
Sequence 2 DFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSV

Sequence 1 LYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEW
           -Y--RGE-RVQ-V---G--VFDDN---GQ--VVPQ-F-VV--AG--G-EW
Sequence 2 VYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEW

Sequence 1 VELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEV
           V-----DNA--S--AG-TS-LR-IPV-VLAN-Y--S--EA-R-K--R-E-
Sequence 2 VVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEA

Sequence 1 EVFLPFQSRDEKERERF
           --F-P------------
Sequence 2 VLFQPGSRSRGRASA--



Alignment 10
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 37.88 (214/565)
Sequence 1 MSTKLILSFSLCLMVL--SCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQR
           ---------S-C---L---C-A----W------------QQ----C---R
Sequence 2 --------LSVCFLILFHGCLASRQEWQ-----------QQ--DECQIDR

Sequence 1 LTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP--RV--EAG--E-WD-----FRCAG---VR--IQP-GLLLP-YS
Sequence 2 LDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYS

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEE
           NAP----V-QG-G--G---PGCPET-Q-------PQ--R-----------
Sequence 2 NAPQLIYVVQGEGMTGISYPGCPETYQA------PQQGR-----------

Sequence 1 SSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD
           ---------Q--S--F----------------------------------
Sequence 2 --------QQGQSGRFQ---------------------------------

Sequence 1 QRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISI
           --------------D-HQKI-R-R-GD-I--PAGV--W--N-G-------
Sequence 2 --------------DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTV

Sequence 1 TLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRES
           TL-D----QNQLD---R-F-LAG--K----D---Q-Q--------QSR--
Sequence 2 TLLDVSNSQNQLDRTPRKFHLAGNPK----DVFQQQQ------QHQSRGR

Sequence 1 DDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARD
           ---------N---GF--E-L-E-F--VD---I--L----D-RG-IV---D
Sequence 2 ---------NLFSGFDTELLAEAFQ-VDERLIKQLKSE-DNRGGIVKVKD

Sequence 1 LKLRV--PE----EYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNV
           --LRV--P-----E---E---E--D-KR----R-NG-E---C----K-N-
Sequence 2 DELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENI

Sequence 1 NRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWN
           N-P-RAD---P--GR--T-NS-NLPIL---QLS----VLYKNA---P-WN
Sequence 2 NDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWN

Sequence 1 LNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAG
           LN-HS--Y---G-G-VQVV---G--VFD--V--GQ-LVVPQ-FAVV--A-
Sequence 2 LNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAR

Sequence 1 REGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLK
           -E--EW---K--D-A-TSP-AG-TSVL---P-EVLAN---IS---A---K
Sequence 2 EERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIK

Sequence 1 NGRQEVEVFLPFQSRDEKERERF
           ---Q---------S---------
Sequence 2 FNNQQTTLTSGESSHHMRDDA--



Alignment 11
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 40.35 (228/565)
Sequence 1 MSTKLIL-SFSLCLMVL--SCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQ
           ---KLIL-SFSLCL-VL---C----L----G-R----R--Q-----C---
Sequence 2 -MAKLILVSFSLCLLVLFNGC----LGINVGLR----RQQQRYFGECNLD

Sequence 1 RLTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSY
           RL-A-EP--R---EA---E-WD-----F-CAG----R--I-P-GLLLP-Y
Sequence 2 RLNALEPTNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQY

Sequence 1 SNAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESE
           SNAP-----E-GRG--GV--PGCPETF------E-PQ-Q--Q--RQ----
Sequence 2 SNAPELIYIERGRGITGVLFPGCPETF------EDPQQQSQQGQRQGQGQ

Sequence 1 ESSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRG
           ------QR--Q---------------------------------------
Sequence 2 -----SQRSEQ---------------------------------------

Sequence 1 DQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLIS
           ---------------D-HQKI---R-GD-I--PAGV--W--NDGD-----
Sequence 2 ---------------DRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVT

Sequence 1 ITLYDANSFQNQLDGNVRNFFLAGQ--SKQSREDRRSQRQTREEGSDRQS
           --L---N---NQLD-N-R-F-LAG-------R-------Q-R--------
Sequence 2 VSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHG

Sequence 1 RESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQ
           ------------N---GF--E-L---F-NVD--T---L----D-R--IV-
Sequence 2 EQGEQEQQGEGNNVFSGFDAEFLADAF-NVDVDTARRLQSNQDKRRNIVK

Sequence 1 ARD-LKLRVPE------------EYEEELQRERGDRKRGGSGRS-NGLEQ
           ----L----PE------------E-E-E--RER--R--GG-GR--NG-E-
Sequence 2 VEGRLQVVRPERSRQEWERQERQERESEQERER-QRRQGGRGRDVNGFEE

Sequence 1 AFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVL
           --C-L----N----SRAD------GRINTVNSN-LP-L---QLSA----L
Sequence 2 TICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDL

Sequence 1 YKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVV
           -------P-WNLNAHS--Y--RG--RVQVV-D-G--VFDD----GQ-L--
Sequence 2 QREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTI

Sequence 1 PQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSY
           PQ-FAV---A--EG-EWV--K--DNA--SP-AG-TS--RA-P--VLAN--
Sequence 2 PQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAF

Sequence 1 DISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF---------
           -IS--EA-RLK--RQE----L---SR---ER-R----------
Sequence 2 QISREEARRLKYNRQETT--LVRSSRSSSERKRRSESEGRAEA



Alignment 12
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 41.59 (235/565)
Sequence 1 MSTKLILSFSLCLMVL---SCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQ
           M-----LS--L-L-V-----C-AQ------G-R-------QQF--QC---
Sequence 2 MAKPILLSIYLFLIVALFNGCLAQ-----SGGRQQ-----QQFG-QCQLN

Sequence 1 RLTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSY
           RL-A-EP--R---EAGV-E-WD-----F-CAG---VR--I-P-GLLLP-Y
Sequence 2 RLDALEPTNRIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQY

Sequence 1 SNAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESE
           SNAP-------GRG--GV--PGCPETF----------------------E
Sequence 2 SNAPQLVYIARGRGITGVLFPGCPETF----------------------E

Sequence 1 ESSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRG
           ES-R--Q---Q--S-EF---------------------------------
Sequence 2 ESQRQSQ---QGQSREFQQ-------------------------------

Sequence 1 DQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLIS
           ---------------D-HQKI---R-GD-I--PAGV--W--NDG-N----
Sequence 2 ---------------DRHQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVA

Sequence 1 ITLYDANSFQNQLDGNVRNFFLAG--------QSKQSREDRRSQRQTREE
           I-L-D-N---NQLD-N-RNF-LAG--------Q--Q--E--R-Q-Q----
Sequence 2 ISLLDTNNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQ----

Sequence 1 GSDRQSR--ESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDN
           ---RQ-R--E-------L--N---GF----L---F-NVD-ET---L---N
Sequence 2 ---RQQRPGEHGQQQRGLGNNVFSGFDADFLADAF-NVDTETARRLQSEN

Sequence 1 DQRGFI--VQARDLKL------RVPEEYEEELQRER-----GDRK---RG
           D-R--I--V--R-L--------R---E-EE---RER-------R----RG
Sequence 2 DHRRSIVRVEGRQLQVIRPRWSREEQEREERKERERERESESERRQSRRG

Sequence 1 GSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEF
           G----NGLE---C-L----N---PSRAD-----AGRI-TVNS--LP-L--
Sequence 2 GRD-DNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNSHTLPVLRW

Sequence 1 IQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDD
           -QLSA----LY--A---P-WNLNAHS--Y--RG---VQVV---G--VFDD
Sequence 2 LQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDD

Sequence 1 NVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRA
           ----GQ-L--PQ-FAVV--A--EG-EWV--K---NA--SP-AG-TS--RA
Sequence 2 ELREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRA

Sequence 1 IPVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKER-ERF---
           -P-EVLA----I----A-RLK--RQE--------SR----R-ER----
Sequence 2 LPEEVLATAFQIPREDARRLKFNRQESTLVRSRPSRSRSSRSERRAEV



Alignment 13
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 40.35 (228/565)
Sequence 1 MSTKLILSFSLCLMVLS----CSAQLLPWRKGQRSRPHRGHQQFHHQCDV
           M-----LS--LCL--------C-AQ------G-R-----G------QC--
Sequence 2 MAKPILLSIYLCLIIVALFNGCLAQ-----SGGRQQHKFG------QCQL

Sequence 1 QRLTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPS
           -RL-A-EP--R---EAGV-E-WD-------CAG---VR--I-P-GLLLP-
Sequence 2 NRLDALEPTNRIEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLLPH

Sequence 1 YSNAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSES
           YSNAP-------GRG--GV--PGCPETF----------SQR---------
Sequence 2 YSNAPQLVYIARGRGITGVLFPGCPETFE--------ESQR---------

Sequence 1 EESSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSR
           --S--G--R-------EF--------------------------------
Sequence 2 -QSQQGQRR-------EFQQ------------------------------

Sequence 1 GDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLI
           ----------------D-HQKI---R-GD-I--PAGV--W--NDG-----
Sequence 2 ----------------DRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVV

Sequence 1 SITLYDANSFQNQLDGNVRNFFLAG--------QSKQSREDRRSQRQTRE
           -I-L-D-----NQLD-N-RNF-LAG--------Q--Q--E--R-Q-Q---
Sequence 2 AIFLLDTHNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQ

Sequence 1 EGSDRQSRESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDND
           ----------D-----L--N---GF--E-L---F-NVD-ET---L---ND
Sequence 2 RRGEHGEQQRD-----LGNNVFSGFDAEFLADAF-NVDTETARRLQSEND

Sequence 1 QRGFI--VQARDLKLRVP------EEYEEELQRER-----GDRK---RGG
           -RG-I--V--R-L----P-------E-EE---RER-------R----RGG
Sequence 2 HRGSIVRVEGRQLQVIRPRWSREEQEHEERKERERERESESERRQSRRGG

Sequence 1 SGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFI
           ----NGLE---C-L----N---PSRAD-----AGRI-TVNS-NLPIL---
Sequence 2 RD-DNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNSHNLPILRWL

Sequence 1 QLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDN
           QLSA----LY--A---P-WNLNAHS--Y--RG---VQVV---G--VFDD-
Sequence 2 QLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDE

Sequence 1 VQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAI
           ---GQ-L--PQ-FAVV--A--EG-EWV--K---NA--SP-AG-TS--RA-
Sequence 2 LREGQLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRAL

Sequence 1 PVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF--
           P-EVL-N---I----A-RLK--RQE--------SR------R---
Sequence 2 PEEVLVNAFQIPREDARRLKFNRQE-STLVRSRSRSSRSERRAEV



Alignment 14
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 40.18 (227/565)
Sequence 1 MSTKLILSFSL-CLMVLSCS-AQLLPWRKGQRSRPHRGHQQFHHQCDVQR
           M-----LSFSL--L----CS-AQ---------S------Q-F--QC--Q-
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQI---EQVVNSQQRQQQQRFQTQCQIQN

Sequence 1 LTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYS
           L-A-EP-RR--SEAGVTE-WD-------CA-----R--IQ--GLL-PSY-
Sequence 2 LNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYN

Sequence 1 NAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEE
           NAP----V-QG-G--G-V-PGCPETFQ-ES-----QSQ---RS--S-SE-
Sequence 2 NAPELVYVVQGSGIHGAVFPGCPETFQEES-----QSQ--SRSQHSRSE-

Sequence 1 SSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD
           ------R--QS---------------------------------------
Sequence 2 ------RSQQS---------------------------------------

Sequence 1 QRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISI
           -------------G-QHQK---IR-GD-I--PAGV--W--N-G---L---
Sequence 2 -------------GEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLV

Sequence 1 TLYDANSFQNQLDGNVRNFFLAGQSKQSREDR-RSQRQTREEGSDRQSRE
           -L-D-----NQLD---R-F-L-G---Q-------S--Q-R---S-R----
Sequence 2 ALADVGNSENQLDQYLRKFVLGGSPQQEIQGGGQSWSQSR---SSRKGQQ

Sequence 1 SDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQAR
           S---------NIL--F--EIL---F-N-D-----KL-----QRG-IV---
Sequence 2 SN--------NILSAFDEEILAQSF-NIDTQLVKKLQREEKQRGIIVRVK

Sequence 1 -DLKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPS
           -DL----P---E-----E--D---------NGLE--FC----K-N-N-PS
Sequence 2 EDLQVLSPQRQE----KEYSD---------NGLEETFCTMTLKLNINDPS

Sequence 1 RADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAH
           RADV-NPR-GR----N--NLPIL-F-QLS----VLY-NAI--P-WN-NAH
Sequence 2 RADVYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNAIMAPHWNMNAH

Sequence 1 SALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGL
           S--Y-TRG-GR-Q-V---G-SVFD-----GQ--VVPQ-FAVV--A---G-
Sequence 2 SIVYITRGNGRMQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDGF

Sequence 1 EWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQ
           EWV--K----A--S--AG--SV-R--P--V--NS-DIS---A--LK--R-
Sequence 2 EWVSFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISREDAWNLKESRS

Sequence 1 EVEVFLPFQSRDEKERERF
           E---F-P--SR----R---
Sequence 2 EMTIFAP-GSRSQRQRN--



Alignment 15
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 36.28 (205/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           ---------------------LL-------SR-H---Q----Q-----L-
Sequence 2 -------------------CLLLLFNGCLASRQHIFGQNKEWQ--LNQLE

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP-----SEAGVTE-W----P-F--AG---VR--I-P-GL-LPSY-NA
Sequence 2 AREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           P-------GRGV-G-V-PGC-ETF---------Q-Q--Q--R-S--E---
Sequence 2 PQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQE---

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           -G-Q---Q---E-----DQ-------------------------------
Sequence 2 -GGQGQQQFQGE-----DQQ------------------------------

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           ------------D-HQKI--IR-GD-I--PAGV--W--N-G---L----L
Sequence 2 ------------DRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSL

Sequence 1 YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
           -D-N--QNQLD---R-F-LAG-----------Q-Q-R------Q------
Sequence 2 LDLNNDQNQLDQVPRRFYLAGNPQ---DEFNPQQQGRQQQQQQQGQQGNG

Sequence 1 DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQAR-DL
           -------NI--GF----L-----NV--ET---L-G--D-R--IV-----L
Sequence 2 N------NIFSGFDTQLLAQAL-NVNPETARNLQGQDDNRNEIVRVQGQL

Sequence 1 KLRVP-------------EEYEEELQRERGDRKR-----GGSGRSNGLEQ
           ----P----------------E---QRER----R-----GG-G--NG-E-
Sequence 2 DFVSPFSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEE

Sequence 1 AFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVL
           -FC-----QN---PSRAD--NP--GRI--VN-N-LPIL----LSA---VL
Sequence 2 TFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVL

Sequence 1 YKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVV
           Y-NAI--P-W--NA----Y--RG--RVQVV---G----DD-V--GQ----
Sequence 2 YNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLI

Sequence 1 PQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSY
           PQ--AV---A--EG-E------D-N--T---AG-TSVLRA-P-EVL-N--
Sequence 2 PQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAF

Sequence 1 DISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF--
           -IS--EA--LK--RQE--------------------
Sequence 2 RISRQEARNLKYNRQESRLLSATSPPRGRLMSILGY



Alignment 16
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 32.74 (185/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           ----------L----------LL---------------Q----C----L-
Sequence 2 -------MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLD

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           ---P-----SEAG--E-WD---P--RCAG----R-VIQ-GGL-LP-----
Sequence 2 VLQPTEVIKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSS

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           P-I--V-QG-G--G-V-PGC-ETF---------Q-Q--Q---Q-------
Sequence 2 PFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQGQ--QQGQQGQ--QGQ

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           -G-Q------------G-Q------------G-Q------------G-Q-
Sequence 2 QGQQGQQGQQGQQGQQGQQ------------GQQ------------GQQG

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           --------F---D-HQK----R-GD-I----G--QW--N-GD--LI---L
Sequence 2 QQGQQGQGFR--DMHQKVEHVRHGDAIAMTPGSAQWIYNTGDQPLIIVSL

Sequence 1 YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
           -D----QNQLD-N-R-F-LAG---Q--------------GS--Q------
Sequence 2 IDIANYQNQLDRNPRTFRLAGNNQQ--------------GSSQQQQQQ--

Sequence 1 DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARD--
           -------NIL-GF----L-------D------L----D-RG-IV------
Sequence 2 -----QQNILSGFDPQVLAQALK-IDVRLAQELQNQQDKRGNIVRVKGPF

Sequence 1 LKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRA
           ---R-P-----E----R--R----S---NGLE---C------N---P-RA
Sequence 2 QVVRPPLRQAYESEQWRHPRGPPQSPQDNGLEETICSMRTHENIDDPARA

Sequence 1 DVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSA
           D---P--GR---VNS--LPIL--I-LSA----L---A---P--N-NA---
Sequence 2 DIYKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEI

Sequence 1 LYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEW
           LY-T-G--R-QVV-D-G--V-D--VQ-GQ--V-PQGFA-V--------EW
Sequence 2 LYCTQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQS-QNNFEW

Sequence 1 VELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEV
           ---K---NA--S--AG-TS-LRA-P-EV--N-Y-IS--EA---K----E-
Sequence 2 ISFKTNANAMISTLAGRTSALRALPLEVITNAYQISLEEARKIKFNTLET

Sequence 1 EVFLPFQSRDEKERERF---
           --------------E-----
Sequence 2 TLTRARGGQQPQLIEEIVEV



Alignment 17
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 31.50 (178/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           ---KL-LS--LC----S--------R------P----QQ----C--QRL-
Sequence 2 -MAKLVLS--LCFLLFSGCCFAFSFRE----QP----QQ--NECQIQRLN

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-NA
Sequence 2 ALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           P------QG-G--G---PGCP-TF------E-PQ-Q--Q-SR--------
Sequence 2 PQEIYIQQGSGIFGMIFPGCPSTF------EEPQ-QKGQSSRPQ------

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           ------------D-HQKI---R-GD-I--P-G---W--N--D-------L
Sequence 2 ------------DRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSL

Sequence 1 YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
           -D-NSFQNQLD---R-F-LAG---Q-------Q-Q----G---Q------
Sequence 2 IDTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQ--QGGTQSQKGKRQQ

Sequence 1 DEALLEANILTGFQDEILQEIFRNVDQETISKLRGDND--QRGFIVQARD
           -E------IL-GF--E-L---F--VD-----KL-G-N-----G-IV----
Sequence 2 EEENEGGSILSGFAPEFLEHAFV-VDRQIVRKLQGENEEEEKGAIVTVKG

Sequence 1 LKLRVPEEYEEELQR----ERGD----RKRGGSGRSNGLEQAFCNLKFKQ
           ---------EE--QR----E--D-----K---S---NG-----C------
Sequence 2 GLSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQSRNGIDETICTMRLRH

Sequence 1 NVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPR
           N----S--D-FNP-AG-I-T--S---P-L----LSAQ---L-KNA---P-
Sequence 2 NIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKNAMFVPH

Sequence 1 WNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLK
           -NLNA-S--Y---G---VQVV---G--VFD---Q-GQ-L-VPQ-FAV---
Sequence 2 YNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAAR

Sequence 1 AGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFR
           ------E-V--K--D-------AG--S-L-A-P-EV-----------A--
Sequence 2 SQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQ

Sequence 1 LKNGRQEVEVFLPFQSRDEKERERF
           -KN---------P--S---------
Sequence 2 VKNNNPFSFLVPPKESQRRVVA---



Alignment 18
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 34.34 (194/565)
Sequence 1 -MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRL
           ----K--L--SL-L-V----AQ----------R--R--Q----QC--QR-
Sequence 2 MVAFKFLLALSLSLLVSAAIAQ---------TREPRLTQG--QQCRFQRI

Sequence 1 TASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           ----PS-R--SE-G-TE-WD-----F-CAG-VA-R--I-P-GL-LP-Y--
Sequence 2 SGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHP

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEES
           -P-----E-G-G-----VPGC-ET-Q-----------R-QR---------
Sequence 2 SPRLVYIERGQGLISIMVPGCAETYQV---------HRSQRTME------

Sequence 1 SRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQ
           -----RT--SE-----RG--R-----------------------------
Sequence 2 -----RTEASEQQD--RGSVR-----------------------------

Sequence 1 RTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISIT
           -------------D-HQK--R-R-GD----P-G---W--NDG--DL----
Sequence 2 -------------DLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVS

Sequence 1 LYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESD
           --D-N---NQLD---R-F-LAG----S-E-----RQT-------------
Sequence 2 INDVNHLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFH-----------

Sequence 1 DDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARD-
           --------NI---F--E-L-E-F-NV-QETI---------RG-IV-AR--
Sequence 2 --------NIFRAFDAELLSEAF-NVPQETIRRMQSEEEERGLIVMARER

Sequence 1 LKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRA
           -----P-E-------E-G-----G----NGLE--FC--KF--NV-----A
Sequence 2 MTFVRPDE-------EEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREA

Sequence 1 DVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSA
           D-F---AGR---V--N-LPIL----LSA----LY-NA---P-W----H--
Sequence 2 DIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTI

Sequence 1 LYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEW
           -YVTRG---VQVV---G-----D-V--G---VVPQ-------AG--G-EW
Sequence 2 VYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEW

Sequence 1 VELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEV
           V--K-------SP-AG-TSV-RA-P--V--NSY-IS---A--LK--R---
Sequence 2 VAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQ

Sequence 1 EVFLPFQSRDEKERERF
           ---L----R--------
Sequence 2 SFLLSPGGRRS------



Alignment 19
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 36.28 (205/565)
Sequence 1 MSTKLILSFS-LCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRL
           M-----LS-S-LCL--LS---------K----------------C----L
Sequence 2 MGKPFTLSLSSLCLLLLSSACFAISSSK-------------LNECQLNNL

Sequence 1 TASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           -A-EP--RV-SE-G----W----PE--CAG-----------GL-LPSYS-
Sequence 2 NALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSP

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEES
           -P------QG-G--GV--PGCPETF------E-PQ------------E-S
Sequence 2 YPRMIIIAQGKGALGVAIPGCPETF------EEPQ------------EQS

Sequence 1 SRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQ
           -R--------------RG------------SR------Q-----------
Sequence 2 NR--------------RG------------SRSQKQQLQ-----------

Sequence 1 RTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISIT
           -------------D-HQKI-----GDV---P-GV--WT-N-GD-----I-
Sequence 2 -------------DSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAIS

Sequence 1 LYDANSFQNQLDGNVRNFFLAGQSK-QSREDRRSQRQTREEGSDRQSRES
           L-D---F-NQLD---R-F-LAG-------E----Q-Q----G---Q----
Sequence 2 LLDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQ

Sequence 1 DDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQAR-
           ---E-------L-GF----L---F-N-------KL----D-R--IV----
Sequence 2 QEEEEE-GGSVLSGFSKHFLAQSF-NTNEDIAEKLQSPDDERKQIVTVEG

Sequence 1 ----------------------DLKLRVP---------------------
           ----------------------D-----P---------------------
Sequence 2 GLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDED

Sequence 1 ----------------------EEYEEELQ-----------------RER
           -----------------------E-E-E-Q-----------------R--
Sequence 2 EDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQE

Sequence 1 GDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNN
           --R-RG---R-NG-E---C-LK---N--RPSRAD--NP-AGRI-T-NS--
Sequence 2 EPRERGCETR-NGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLT

Sequence 1 LPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEG
           LP-L---QLSAQ-VVLYKN-I--P-WNLNA-S--YVTRG-G-V-VV---G
Sequence 2 LPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQG

Sequence 1 RSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGK
           --VFD----RGQ-LVVPQ-F-V---AG--G-E----K---NA-TS-----
Sequence 2 NAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLK--

Sequence 1 TSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF
           --V-RAIP-EVLA-SY---------LK----------P------------
Sequence 2 -DVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA



Alignment 20
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 35.93 (203/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           ------------------------------S------------C----L-
Sequence 2 -----------MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLN

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A-EP--RV-SE-G--E-W----PE--CAG-----------GL-LPSYS--
Sequence 2 ALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPY

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           P----V-QG-G--G---PGCPETF------E-PQ-Q------------SS
Sequence 2 PQMIIVVQGKGAIGFAFPGCPETF------EKPQQQ------------SS

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           R--------------RG------------SR--Q----------------
Sequence 2 R--------------RG------------SRSQQQLQ-------------

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           ------------D-HQKI-----GDV---P-GV--WT-N-GD-----I-L
Sequence 2 ------------DSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISL

Sequence 1 YDANSFQNQLDGNVRNFFLAGQSK-QSREDRRSQRQTREEGSDRQSRESD
           -D---F-NQLD-N-R-F-LAG-------E----Q-Q----G---Q-----
Sequence 2 LDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQ

Sequence 1 DDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARD-
           --E-------L-GF----L---F-N----T--KLR---D-R--IV-----
Sequence 2 QEEE--GGSVLSGFSKHFLAQSF-NTNEDTAEKLRSPDDERKQIVTVEGG

Sequence 1 LKLRVP-------------EEYE----------------------EELQR
           L----P-------------EEYE----------------------EE---
Sequence 2 LSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRPSHGKHEDDEDEDEEEDQ

Sequence 1 ERGD--------------RKRGGSGRSNGLEQAFCNLKFKQNVNRPSRAD
           -R-D--------------R-RG---R-NG-E---C--K---N--RPSRAD
Sequence 2 PRPDHPPQRPSRPEQQEPRGRGCQTR-NGVEENICTMKLHENIARPSRAD

Sequence 1 VFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSAL
           --NP-AGRI-T-NS--LP-L----LSAQ-VVLY-N-I--P-WNLNA-S--
Sequence 2 FYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVI

Sequence 1 YVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWV
           YVTRG-GRV-VV---G--VFD----RGQ-LVVPQ-F-V----G--GLE-V
Sequence 2 YVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYV

Sequence 1 ELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVE
           --K---NA--S-I-----V-RAIP-EVL-NSY---------LK-------
Sequence 2 VFKTHHNAVSSYIK---DVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGP

Sequence 1 VFLPFQSRDEKERERF
           ---P------------
Sequence 2 LVNP------------



Alignment 21
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 34.51 (195/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           -------------------------------------Q-----C--QRL-
Sequence 2 -----------------------------------RQQPEENACQFQRLN

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           P---F--QGRG--G---PGCP---------E-P--Q-----R-S-S----
Sequence 2 PQEIFIQQGRGYFGLIFPGCPR------HYEEPHTQ----GRRSQSQRPP

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           R--Q------------G-----Q----------QR---------------
Sequence 2 RRLQ------------GEDQSQQ----------QR---------------

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           ------------D-HQK--R---GD-I--P-GV--W--ND-D-D-----L
Sequence 2 ------------DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSL

Sequence 1 YDANSFQNQLDGNVRNFFLAGQS--------KQSREDRR-----------
           -D-N---NQLD---R-F-LAG-----------QSR--RR-----------
Sequence 2 TDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQ

Sequence 1 SQ-RQTREEGSDR---QSRESDDDEALLEA-NILTGFQDEILQEIFRNVD
           SQ-RQ---E-S-R-----RE----E---E--NI--GF--E-L---F---D
Sequence 2 SQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDD

Sequence 1 QETISKLRGD--NDQRGFIVQARD-LKLRVP---------EEYEE-ELQR
           ------LRG-------G-IV--R--L----P---------EEY-E-E---
Sequence 2 RQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEY

Sequence 1 ERGDRKRG-GS-GRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTV
           ---DR-RG-GS-GR-NG-E---C----K-N--R----D--NP-AG---T-
Sequence 2 DEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTA

Sequence 1 NSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVV
           N--NL-IL-----SA----LY-NA------N-NAHS--Y--RG---VQVV
Sequence 2 NDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVV

Sequence 1 GDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSP
           ---G--V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-D-------
Sequence 2 DSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN

Sequence 1 IAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKE
           -AG--SV----P-EV-ANSY------A--LKN-------F-P--------
Sequence 2 LAGENSVIDNLPEEVVANSYGLQREQARQLKNN-NPFKFFVPPSQQSPRA

Sequence 1 RERF
           ----
Sequence 2 VA--



Alignment 22
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 34.51 (195/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           -------------------------------------Q-----C--QRL-
Sequence 2 --------------------------------ISFRQQPEENACQFQRLN

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           P---F--QGRG--G---PGCP---------E-P--Q-----R-S-S----
Sequence 2 PQEIFIQQGRGYFGLIFPGCPR------HYEEPHTQ----GRRSQSQRPP

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           R--Q------------G-----Q----------QR---------------
Sequence 2 RRLQ------------GEDQSQQ----------QR---------------

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           ------------D-HQK--R---GD-I--P-GV--W--ND-D-D-----L
Sequence 2 ------------DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSL

Sequence 1 YDANSFQNQLDGNVRNFFLAGQS--------KQSREDRR-----------
           -D-N---NQLD---R-F-LAG-----------QSR--RR-----------
Sequence 2 TDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQ

Sequence 1 SQ-RQTREEGSDR---QSRESDDDEALLEA-NILTGFQDEILQEIFRNVD
           SQ-RQ---E-S-R-----RE----E---E--NI--GF--E-L---F---D
Sequence 2 SQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDD

Sequence 1 QETISKLRGD--NDQRGFIVQARD-LKLRVP---------EEYEE-ELQR
           ------LRG-------G-IV--R--L----P---------EEY-E-E---
Sequence 2 RQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEY

Sequence 1 ERGDRKRG-GS-GRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTV
           ---DR-RG-GS-GR-NG-E---C----K-N--R----D--NP-AG---T-
Sequence 2 DEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTA

Sequence 1 NSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVV
           N--NL-IL-----SA----LY-NA------N-NAHS--Y--RG---VQVV
Sequence 2 NDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVV

Sequence 1 GDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSP
           ---G--V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-D-------
Sequence 2 DSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN

Sequence 1 IAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKE
           -AG--SV----P-EV-ANSY------A--LKN-------F-P--------
Sequence 2 LAGENSVIDNLPEEVVANSYGLQREQARQLKNN-NPFKFFVPPSQQSPRA

Sequence 1 RERF
           ----
Sequence 2 VA--



Alignment 23
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 31.33 (177/565)
Sequence 1 MSTKLILSFSLCLMVLS-CSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRL
           ---KL-LS--LC----S-C-A--------------R---Q----C--Q-L
Sequence 2 -MAKLVLS--LCFLLFSGCFAL-------------REQAQ-QNECQIQKL

Sequence 1 TASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           -A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N
Sequence 2 NALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTN

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEES
           -P------QG-G--G---PGCP-T-Q-------PQ----QR-R-------
Sequence 2 GPQEIYIQQGNGIFGMIFPGCPSTYQE------PQ-ESQQRGRS------

Sequence 1 SRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQ
           ----QR--------------------------------------------
Sequence 2 ----QRPQ------------------------------------------

Sequence 1 RTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISIT
           -------------D-HQK--R-R-GD-I--P-GV--W--N--D-------
Sequence 2 -------------DRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVS

Sequence 1 LYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESD
           --D-NS--NQLD---R-F-LAG---Q-------Q-Q----GS--Q-----
Sequence 2 IIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQG---GSQSQKGKQQ

Sequence 1 DDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQR--GFIVQAR
           --E-----NIL-GF--E-L-E-F--V-------L-G-N-----G-IV---
Sequence 2 EEENE-GSNILSGFAPEFLKEAF-GVNMQIVRNLQGENEEEDSGAIVTVK

Sequence 1 D-LK-----LRVPEEYE----EELQRERGDRKRG---GSGRS-NGLEQAF
           --L-------R-P---E----EE-Q--------G----S-RS-NG-----
Sequence 2 GGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETI

Sequence 1 CNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYK
           C-----QN----S--D--NP-AG-I-T--S---P-L----LSAQ---L-K
Sequence 2 CTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRK

Sequence 1 NAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQ
           NA---P---LNA-S--Y---G---VQVV---G--VFD---Q-G--L-VPQ
Sequence 2 NAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQ

Sequence 1 GFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDI
           -FAV--K------E-V--K--D-------AG--S-L-A-P-EV-------
Sequence 2 NFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNL

Sequence 1 STKEAFRLKNGRQEVEVFLPFQSRDEKERERF
           ----A---KN---------P--S---------
Sequence 2 KSQQARQVKNNNPFSFLVPPQESQRRAVA---



Alignment 24
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 31.33 (177/565)
Sequence 1 MSTKLILSFSLCLMVLS-CSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRL
           ---KL-LS--LC----S-C-A--------------R---Q----C--Q-L
Sequence 2 -MAKLVLS--LCFLLFSGCFAL-------------REQAQ-QNECQIQKL

Sequence 1 TASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           -A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N
Sequence 2 NALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTN

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEES
           -P------QG-G--G---PGCP-T-Q-------PQ----QR-R-------
Sequence 2 GPQEIYIQQGNGIFGMIFPGCPSTYQE------PQ-ESQQRGRS------

Sequence 1 SRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQ
           ----QR--------------------------------------------
Sequence 2 ----QRPQ------------------------------------------

Sequence 1 RTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISIT
           -------------D-HQK--R-R-GD-I--P-GV--W--N--D-------
Sequence 2 -------------DRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVS

Sequence 1 LYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESD
           --D-NS--NQLD---R-F-LAG---Q-------Q-Q----GS--Q-----
Sequence 2 IIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQG---GSQSQKGKQQ

Sequence 1 DDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQR--GFIVQAR
           --E-----NIL-GF--E-L-E-F--V-------L-G-N-----G-IV---
Sequence 2 EEENE-GSNILSGFAPEFLKEAF-GVNMQIVRNLQGENEEEDSGAIVTVK

Sequence 1 D-LK-----LRVPEEYE----EELQRERGDRKRG---GSGRS-NGLEQAF
           --L-------R-P---E----EE-Q--------G----S-RS-NG-----
Sequence 2 GGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETI

Sequence 1 CNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYK
           C-----QN----S--D--NP-AG-I-T--S---P-L----LSAQ---L-K
Sequence 2 CTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRK

Sequence 1 NAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQ
           NA---P---LNA-S--Y---G---VQVV---G--VFD---Q-G--L-VPQ
Sequence 2 NAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQ

Sequence 1 GFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDI
           -FAV--K------E-V--K--D-------AG--S-L-A-P-EV-------
Sequence 2 NFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNL

Sequence 1 STKEAFRLKNGRQEVEVFLPFQSRDEKERERF
           ----A---KN---------P--S---------
Sequence 2 KSQQARQVKNNNPFSFLVPPQESQRRAVA---



Alignment 25
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 30.09 (170/565)
Sequence 1 MSTKLILSFSLCLMVLS-CSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRL
           ------L-FSLC----S-C-----------R--P----QQ----C--Q-L
Sequence 2 ---MAKLVFSLCFLLFSGCCFAF-----SSREQP----QQ--NECQIQKL

Sequence 1 TASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           -A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N
Sequence 2 NALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTN

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEES
           -P------QG-G--G---PGCP-TF----E---PQ-QR-Q-SR-------
Sequence 2 GPQEIYIQQGKGIFGMIYPGCPSTFE---EPQQPQ-QRGQSSRPQ-----

Sequence 1 SRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISIT
           -------------D-HQKI---R-GD-I--P-GV--W--N--D-------
Sequence 2 -------------DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVS

Sequence 1 LYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESD
           --D-NS--NQLD---R-F-LAG---Q-------Q-Q--------------
Sequence 2 IIDTNSLENQLDQMPRRFYLAGNQEQEFL-KYQQEQGGHQSQKGKHQQEE

Sequence 1 DDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDND--QRGFIVQAR
           --E------IL-GF--E-L---F--VD------L-G-N-----G-IV---
Sequence 2 ENEG---GSILSGFTLEFLEHAF-SVDKQIAKNLQGENEGEDKGAIVTVK

Sequence 1 ----------DLKLRVPEEYEEELQRER----G-----DRKRGGSGRS--
           ----------D-----P-E-EEE---E-----G------R-RG----S--
Sequence 2 GGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRR

Sequence 1 NGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSA
           NG-----C------N----S--D--NP-AG---T--S---P-L----LSA
Sequence 2 NGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSA

Sequence 1 QHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG
           ----L-KNA---P--NLNA-S--Y---G----QVV---G--VFD---Q-G
Sequence 2 EFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEG

Sequence 1 QILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEV
           --L-VPQ-F-V---------E-V--K--D-------AG--S-L-A-P-EV
Sequence 2 RVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEV

Sequence 1 LANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF
           -----------A---KN---------P-Q----------
Sequence 2 IQHTFNLKSQQARQIKNN-NPFKFLVPPQESQKRAVA--



Alignment 26
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 30.09 (170/565)
Sequence 1 MSTKLILSFSLCLMVLS-CSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRL
           ------L-FSLC----S-C-----------R--P----QQ----C--Q-L
Sequence 2 ---MAKLVFSLCFLLFSGCCFAF-----SSREQP----QQ--NECQIQKL

Sequence 1 TASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSN
           -A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N
Sequence 2 NALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTN

Sequence 1 APYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEES
           -P------QG-G--G---PGCP-TF----E---PQ-QR-Q-SR-------
Sequence 2 GPQEIYIQQGKGIFGMIYPGCPSTFE---EPQQPQ-QRGQSSRPQ-----

Sequence 1 SRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISIT
           -------------D-HQKI---R-GD-I--P-GV--W--N--D-------
Sequence 2 -------------DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVS

Sequence 1 LYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESD
           --D-NS--NQLD---R-F-LAG---Q-------Q-Q--------------
Sequence 2 IIDTNSLENQLDQMPRRFYLAGNQEQEFL-KYQQEQGGHQSQKGKHQQEE

Sequence 1 DDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDND--QRGFIVQAR
           --E------IL-GF--E-L---F--VD------L-G-N-----G-IV---
Sequence 2 ENEG---GSILSGFTLEFLEHAF-SVDKQIAKNLQGENEGEDKGAIVTVK

Sequence 1 ----------DLKLRVPEEYEEELQRER----G-----DRKRGGSGRS--
           ----------D-----P-E-EEE---E-----G------R-RG----S--
Sequence 2 GGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRR

Sequence 1 NGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSA
           NG-----C------N----S--D--NP-AG---T--S---P-L----LSA
Sequence 2 NGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSA

Sequence 1 QHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG
           ----L-KNA---P--NLNA-S--Y---G----QVV---G--VFD---Q-G
Sequence 2 EFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEG

Sequence 1 QILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEV
           --L-VPQ-F-V---------E-V--K--D-------AG--S-L-A-P-EV
Sequence 2 RVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEV

Sequence 1 LANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF
           -----------A---KN---------P-Q----------
Sequence 2 IQHTFNLKSQQARQIKNN-NPFKFLVPPQESQKRAVA--



Alignment 27
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 33.63 (190/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           M---L-LSF--C--VL--S------R-----------Q-----C--QRL-
Sequence 2 MAKLLELSFCFCFLVLGASS--ISFRQ----------QPEENACQFQRLN

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           P---F--QGRG--G---PGCP-T-------E-P-----Q--R---S----
Sequence 2 PQEIFIQQGRGYFGLIFPGCPSTY------EEPA----QQGRRYQSQRPP

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           R--Q---QS-----------------------------------------
Sequence 2 RRLQEEDQSQQQQ-------------------------------------

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           ------------D-HQK--R---GD-I--P-GV--W--ND-D-D-----L
Sequence 2 ------------DSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSL

Sequence 1 YDANSFQNQLDGNVRNFFLAG-----------QSKQSRE-----------
           -D-N---NQLD---R-F-LAG-----------QS-QSR------------
Sequence 2 TDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPH

Sequence 1 --DRRSQRQTREEGSDRQSRESDDDEALLEANILTGFQDEILQEIFRNVD
           ---RR--R--R--G-----------E-----NI--GF--E-L---F---D
Sequence 2 SRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDD

Sequence 1 QETISKLRGDND--QRGFIVQARD-LKLRVP---------EEYEE---EL
           ------L-G-N-----G-IV--R--L----P---------EEY-E---E-
Sequence 2 RQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEY

Sequence 1 QRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTV
           ----G-R-RG--G--NG-E---C----K-N-----------P--------
Sequence 2 HEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNC

Sequence 1 NSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVV
           ---NL-IL----LSA----LY-NA---P--N-NAHS--Y--RG---VQVV
Sequence 2 HDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVV

Sequence 1 GDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSP
           ---G--V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-D-------
Sequence 2 DSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN

Sequence 1 IAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKE
           -AG--S-----P-EV-ANSY------A--LKN---------PFQ------
Sequence 2 FAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAV

Sequence 1 RERF
           ----
Sequence 2 A---



Alignment 28
Sequence 1:
Sequence 2: Allergen Gly m Bd28K, Sequence: BAB21619
Sequence identity: 12.74 (72/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           --------------------------------------------------
Sequence 2 ---------------------------------------KTTLLLLLFVL

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR
           -----T----------GD-----S--------------------------
Sequence 2 CHGVATTTMAFHDDEGGDKKSPKSLFLMSNSTRVFKTDAGEMRVLKSHGG

Sequence 1 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL
           ----------------K-----------------------G---------
Sequence 2 RIFYRHMHIGFISMEPKSLFVPQYLDSNLIIFIRRGEAKLGFIYDDELAE

Sequence 1 YDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDD
           ----------------F-L-------R-----------------------
Sequence 2 RRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSIDPSTSLGLETFQSFYI

Sequence 1 DEALLEANILTGFQDEILQEIF---RNVDQETISK-LRGD----NDQRGF
           ---------L-GF---IL---F---R-V--E--SK-L-G------D----
Sequence 2 GGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFVDDSHAP

Sequence 1 IVQARDLKLRVP---EEYEEELQRERGDRKRGGSGRS--NGLEQAF--CN
           ------L-L-------------Q----D-------RS----LE--F---N
Sequence 2 SLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVN

Sequence 1 LKF--KQNVNRPSRADVFNPRA-------GRINTVNSNNLPILEFIQLSA
           -K---K-----P-----------------G----------P-L-------
Sequence 2 EKIENKDTAGSPASYNLYDDKKADFKNAYGWSKALHGGEYPPLSEPDIGV

Sequence 1 QHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG
           --V-L-----L-P--N--------V--G-G--------G----------G
Sequence 2 LLVKLSAGSMLAPHVNPISDEYTIVLSGYGELHIGYPNGSRAMKTKIKQG

Sequence 1 QILVVPQGFAVVLKAGREG-LEWVELKNDDNAITSP--IAGKTSVLRAIP
           ---VVP--F-----A-R-G-LE-------------P---AG--S-LR---
Sequence 2 DVFVVPRYFPFCQVASRDGPLEFFGFSTSARK-NKPQFLAGAASLLRTLM

Sequence 1 VEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF--------
           ---L------S-----R------E--V-LP-------E------------
Sequence 2 GPELSAAFGVSEDTLRRAVDAQHEA-VILPSAWAAPPENAGKLKMEEEPN

Sequence 1 --------------
           --------------
Sequence 2 AIRSFANDVVMDVF



Alignment 29
Sequence 1:
Sequence 2: Allergen Lup an 1.0101, Sequence: ACB05815
Sequence identity: 18.76 (106/565)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT
           ------------L--L----------------------------------
Sequence 2 -----MAKMRVRLPMLILLLGVVFLLAASIGIAYGEKDFTKNPPKEREEE

Sequence 1 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA
           --EP----R--------------E---------R----------------
Sequence 2 EHEPRQQPRPRQQEEQEREHRREEKHDGEPSRGRSQSEESQEEEHERRRE

Sequence 1 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS
           ---------------------E----------PQS-R--R--------SS
Sequence 2 HHREREQEQQPRPQRRQEEEEEEEEWQPRRQRPQSRREEREEREQEQGSS

Sequence 1 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD--
           -G-QR----E--------------E-E--SR-D-R-RQ-----FS-----
Sequence 2 SGSQRGGGDERRQHRERRVHREEREQEQDSRSDSR-RQRNPYHFSSNRFQ

Sequence 1 --QRTRQSESEEFSRGDQH-QKIFRIRDGDVIP---SPAGVVQWTHNDGD
           ---R-R--------R--Q-------------I-----P-------H-D-D
Sequence 2 TYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDAD

Sequence 1 ------NDLISITLYDANSFQ--NQLDGNV-------RNFFLAGQSKQSR
           ------N----IT-------Q--N---G-------------L-----Q--
Sequence 2 FILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNL

Sequence 1 EDRRSQRQTREEGS----------DRQSRESDDDEALLEANILTGFQDEI
           ------------G-----------D-QS--S------LEA---T------
Sequence 2 RVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEE--

Sequence 1 LQEIFRNVD--QETISKLRGDNDQRGFIVQARDLKLRVPEEYEEELQRER
           --------D--QE-----RG---------Q------RV------EL----
Sequence 2 IERVLLGDDELQENEKQRRGQEQSH----QDEGVIVRVSKKQIQELRKH-

Sequence 1 GDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNN
           -------SG-----E----NL------N-P----------G---------
Sequence 2 ---AQSSSGEGKPSESGPFNLR----SNKP----IYSNKFGNFYEITPDI

Sequence 1 LPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVG--D
           -P-------S---------A-L-P--N--A-----V--GEG----VG--D
Sequence 2 NPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRD

Sequence 1 EGRSV----------------FDDNVQRGQILVVPQGFAVVLKAGRE-GL
           --R--------------------D----G-----P-G------A-----L
Sequence 2 QQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASSNLRL

Sequence 1 EWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQ
           ---------N-----------V------EV-------S-----RL----Q
Sequence 2 LGFGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQ

Sequence 1 EVEVFLPFQSRDEKERERF-----------------
           ----F---Q------RE-------------------
Sequence 2 Q-SYFANAQPQQQQQREKEGRRGRRGPISSILNALY


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.