The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Fag e 1

Sequence 2317674

Full FASTA alignment

Sequence name:
Query sequence:
MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH
KQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGFQDE
ILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRVPQDFEEEYERERG
DRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSN
SLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDE
GKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGG
RTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERER
FSIV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Fag e 1BAA21760Go!504702.51.1e-203
2Fag e 1Q9XFM4Go!538430.77.8e-122
3Fag e 1BAA21758Go!565425.23.7e-120
4Pis v 2.0101DQ631676Go!496221.37.6e-59
5Ana o 2AAN76862Go!457198.65.0e-52
6Pis v 5.0101EU410073Go!473194.31.0e-50
7Gly m 6.0301P11828Go!481176.72.1e-45
8Pru du 6.0101ADN39440Go!551159.53.5e-40
9Pru du 63EHK_AGo!531158.95.2e-40
10Ber e 2AAO38859Go!465153.51.9e-38
11Cor a 9AAL73404Go!515152.34.7e-38
12Ses i 7.0101Q9AUD2Go!497151.96.1e-38
13Gly m glycinin G2CAA68460Go!485151.11.1e-37
14Gly m 6.0201P04405Go!485151.11.1e-37
15Sin a 2.0101Q2TLW0Go!510149.04.6e-37
16Pis v 2.0201DQ631677Go!472147.61.2e-36
17Jug r 4.0101Q2TPW5Go!507146.42.9e-36
18Car i 4.0101ABW86978Go!505146.23.3e-36
19Pru du 6.0201ADN39441Go!504136.92.0e-33
20Ses i 6.0101Q9XHP0Go!459134.78.7e-33
21Gly m 6.0401Q9SB11Go!563134.11.6e-32
22Gly m 6.0501Q7GC77Go!517126.52.8e-30
23Ara h 3O82580Go!507116.72.5e-27
24Ara h 3AAC63045Go!510116.72.5e-27
25Ara h 4AAD47382Go!530114.01.6e-26
26Gly m glycinin G1AAA33966Go!495100.12.4e-22
27Gly m 6.0101P04776Go!495100.12.4e-22

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 100.00 (504/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
Sequence 2 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
Sequence 2 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
           NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
Sequence 2 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE

Sequence 1 ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH
           ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH
Sequence 2 ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH

Sequence 1 KQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGFQDE
           KQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGFQDE
Sequence 2 KQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGFQDE

Sequence 1 ILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRVPQDFEEEYERERG
           ILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRVPQDFEEEYERERG
Sequence 2 ILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRVPQDFEEEYERERG

Sequence 1 DRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSN
           DRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSN
Sequence 2 DRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSN

Sequence 1 SLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDE
           SLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDE
Sequence 2 SLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDE

Sequence 1 GKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGG
           GKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGG
Sequence 2 GKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGG

Sequence 1 RTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERER
           RTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERER
Sequence 2 RTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERER

Sequence 1 FSIV
           FSIV
Sequence 2 FSIV



Alignment 2
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 87.70 (442/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           MSTKLILSFSLCLMVLSCSAQL-PWQKGQ-SRPHHG-QQ--FQHQCDIQR
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQ--FQHQCDIQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           LTASEPSRRVRSEAGVTEIWDHDTPEFRC-GFVAVRVVIQPGGLLLPSYS
Sequence 2 LTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSES--
           NAPYITFVEQGRGVQGVV-PGCPETFQS-SEFEYP-SQR---SRQSES--
Sequence 2 NAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGE

Sequence 1 ---------------------------EEESSRGDQHQKIFRIREGDVIP
           ----------------------------EE-SRGDQHQKIFRIR-GDVIP
Sequence 2 SSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIP

Sequence 1 SPAGVVQWTHNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQS-----
           SPAGVVQWTHN-G--DLIS-TL-DANS---QLDENVR-FFLAGQS-----
Sequence 2 SPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRE

Sequence 1 ----QRETREEGSDRQSRESDDDEALLGANILSGFQDEILHELFRDVDRE
           ----QR-TREEGSDRQSRES-DDEALL-ANILSGF-DEIL-E-FR-VD-E
Sequence 2 DRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE

Sequence 1 TISKLRGENDQRGFIVQAQDLKLRVPQDFEEEYERERGDRRRGQGGSGRS
           TISKLRGENDQRGFIVQA-DLKLRVP---EEE--RERGDR-RG--GSGRS
Sequence 2 TISKLRGENDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRG--GSGRS

Sequence 1 NGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSA
           NG-EQ-FCNLKFR-N-N-P----VFNPRAGRINTV-SN-LPILEF-QLSA
Sequence 2 NGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSA

Sequence 1 QHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRG
           QHVVLYKNAI-GPRWNLNAHSALYVTRGEGRVQVVGDEG-SVFDD-VQRG
Sequence 2 QHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG

Sequence 1 QILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEV
           QILVVPQGFAVVLKAGREGLEWVELKN--NAITSPI-G-TSVLRAIPVEV
Sequence 2 QILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEV

Sequence 1 LANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFSIV
           LANSYDISTKEA--LKNGRQEVEVFRPFQSRDEKERERFSIV
Sequence 2 LANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV



Alignment 3
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 86.31 (435/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           MSTKLILSFSLCLMVLSCSAQL-PW-KGQ-SRPH-G-QQ--F-HQCD-QR
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQ--FHHQCDVQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           LTASEPSRRVRSEAGVTEIWD-DTPEFRC-GFVAVRVVIQPGGLLLPSYS
Sequence 2 LTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
           NAPYITFVEQGRGVQGVV-PGCPETFQS-SEFEYPQSQR---SRQSESEE
Sequence 2 NAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEE

Sequence 1 ES------------------------------------------------
           -S------------------------------------------------
Sequence 2 SSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD

Sequence 1 -----------SRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISV
           -----------SRGDQHQKIFRIR-GDVIPSPAGVVQWTHNDG--DLIS-
Sequence 2 QRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISI

Sequence 1 TLLDANSYHKQLDENVRSFFLAGQS---------QRETREEGSDRQSRES
           TL-DANS---QLD-NVR-FFLAGQS---------QR-TREEGSDRQSRES
Sequence 2 TLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRES

Sequence 1 DDDEALLGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQD
           DDDEALL-ANIL-GFQDEIL-E-FR-VD-ETISKLRG-NDQRGFIVQA-D
Sequence 2 DDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARD

Sequence 1 LKLRVPQDFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPT
           LKLRVP---EEE--RERGDR-RG--GSGRSNG-EQ-FCNLKF--N-N-P-
Sequence 2 LKLRVPEEYEEELQRERGDRKRG--GSGRSNGLEQAFCNLKFKQNVNRPS

Sequence 1 NTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAH
           ---VFNPRAGRINTVNSN-LPILEF-QLSAQHVVLYKNAI-GPRWNLNAH
Sequence 2 RADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAH

Sequence 1 SALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGL
           SALYVTRGEGRVQVVGDEG-SVFDD-VQRGQILVVPQGFAVVLKAGREGL
Sequence 2 SALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGL

Sequence 1 EWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQ
           EWVELKN--NAITSPI-G-TSVLRAIPVEVLANSYDISTKEA--LKNGRQ
Sequence 2 EWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQ

Sequence 1 EVEVFRPFQSRDEKERERFSIV
           EVEVF-PFQSRDEKERERF---
Sequence 2 EVEVFLPFQSRDEKERERF---



Alignment 4
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 44.44 (224/504)
Sequence 1 MSTKLILSFSL-CLMVLSCS-AQLWPWQKGQGSRPHHGRQQHQFQHQCDI
           M-----LSFSL--L----CS-AQ-------Q--------QQ--FQ-QC-I
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQ-----QRQQQQRFQTQCQI

Sequence 1 QRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPS
           Q-L-A-EP-RR--SEAGVTE-WD-------C------R--IQ--GLL-PS
Sequence 2 QNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPS

Sequence 1 YSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSES
           Y-NAP----V-QG-G--G-V-PGCPETFQ--S--------R-R--R---S
Sequence 2 YDNAPELVYVVQGSGIHGAVFPGCPETFQEESQ------SRSRSERSQQS

Sequence 1 EEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANS
           ------G-QHQK---I-EGDVI--PAGV--W--N-G---L--V-L-D---
Sequence 2 ------GEQHQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGN

Sequence 1 YHKQLDENVRSFFLAGQSQRETREEGSDRQSRESDD----DEALLGANIL
           ---QLD---R-F-L-G--Q-E----G--R----S-------------NIL
Sequence 2 SENQLDQYLRKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQQSNNIL

Sequence 1 SGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQ-DLKLRVP--QDF
           S-F--EIL---F---D------L--E--QRG-IV--Q-DL----P--Q--
Sequence 2 SAFDEEILAQSF-NIDTQLARRLQKEKRQRGIIVRVQEDLEVLSPHRQEQ

Sequence 1 EEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRA
           E-EYE-ER--R-R--------NG-E--FC------N-N-P----V-NPR-
Sequence 2 EQEYEEERERRQR--------NGLEETFCTMTLKYNINDPSRADVYNPRG

Sequence 1 GRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGE
           GR---VN---LPIL-FLQLSA---VL---AI--P-WN-NAHS--Y-TRG-
Sequence 2 GRVSSVNALNLPILRFLQLSAKKGVLHRDAILAPHWNVNAHSIVYITRGN

Sequence 1 GRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSG
           GR-Q-V---G-SVFD-----GQ--VVPQ-FAVV--A-----EWV--K--G
Sequence 2 GRIQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDKFEWVSFKTNG

Sequence 1 NAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRP--
           ---TS---GR-SV-RA-P--V--NS-DIS---A--LK--R-E---F-P--
Sequence 2 LSQTSQLAGRVSVFRALPLDVIKNSFDISREDARRLKESRSETTIFAPGS

Sequence 1 -FQSRDEKERERFSIV------
           --Q-----ERER----------
Sequence 2 SSQRKSQSERERQREREEREIH



Alignment 5
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 41.47 (209/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           ---------------------L--------------RQ--Q-Q--C-I-R
Sequence 2 ---------------------LSVCFLILFHGCLASRQEWQQQDECQIDR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           L-A-EP--RV--EAG--E-WD-----FRC-G---VR--IQP-GLLLP-YS
Sequence 2 LDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
           NAP----V-QG-G--G---PGCPET-Q-------PQ---GR---QS----
Sequence 2 NAPQLIYVVQGEGMTGISYPGCPETYQA------PQ--QGRQQGQSGRFQ

Sequence 1 ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH
           -----D-HQKI-R-R-GD-I--PAGV--W--N-GN-----VTLLD-----
Sequence 2 -----DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQ

Sequence 1 KQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGFQDE
           -QLD---R-F-LAG-------------QSR---------G-N--SGF--E
Sequence 2 NQLDRTPRKFHLAG-NPKDVFQQQQQHQSR---------GRNLFSGFDTE

Sequence 1 ILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRV--P------QDFE
           -L-E-F--VD---I--L--E-D-RG-IV---D--LRV--P---------E
Sequence 2 LLAEAFQ-VDERLIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSE

Sequence 1 EEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAG
           -E-E-E---RR-GQ----R-NG-E---C------N-N-P-------P--G
Sequence 2 SEEESEDEKRRWGQ----RDNGIEETICTMRLKENINDPARADIYTPEVG

Sequence 1 RINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEG
           R--T-NS--LPIL--LQLS----VLYKNA---P-WNLN-HS--Y---G-G
Sequence 2 RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKG

Sequence 1 RVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGN
           -VQVV---G--VFD--V--GQ-LVVPQ-FAVV--A--E--EW---K----
Sequence 2 QVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDR

Sequence 1 AITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQS
           A-TSP--GRTSVL---P-EVLAN---IS---A-K-K---Q---------S
Sequence 2 AMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESS

Sequence 1 RDEKERERFSIV
           ------------
Sequence 2 HHMRDDA-----



Alignment 6
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 41.47 (209/504)
Sequence 1 MSTKLILSFSLCLMVL--SCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDI
           M-----LS-S-CL--L---C-A----------------RQQ-Q-Q--C-I
Sequence 2 MANPSLLSLSVCLLILFHGCLAS---------------RQQGQQQNECQI

Sequence 1 QRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPS
           --L-A-EP--RV--EAG--E-WD-----FRC-G----R--IQP-GL-LP-
Sequence 2 DQLDALEPDNRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPE

Sequence 1 YSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSES
           YSNAP-------G-G--G--IPGCPET-Q-------PQ--------Q---
Sequence 2 YSNAPTLMYIVEGEGMTGTLIPGCPETYQA------PQ--------QGQQ

Sequence 1 EEESSR-GDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDAN
           ---SSR--D-HQKI-R-R-GD-I--PAGV--W--N-GN-----VTLLD--
Sequence 2 HGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVS

Sequence 1 SYHKQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGF
           ----QLD---R-F-LAG----E--------QSR-----------NI--GF
Sequence 2 NSQNQLDMYPRKFNLAGNPEDEFQQQ-QQQQSRGRRQSQQKSCNNIFCGF

Sequence 1 QDEILHELFRDVDRETISKLRGENDQRGFIVQAQ-DLK-LRVPQ------
           ---IL-E-F--V-------L--E-D-RG-IV----DL---R-P-------
Sequence 2 DTKILAEVFQ-VEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERG

Sequence 1 -DFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFN
           ---EEE-E-ERG-R-------GR-NG-E---C--K---N---P-------
Sequence 2 FESEEESEYERGRR-------GRDNGLEETICTMKLKENIHDPSRSDIYT

Sequence 1 PRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVT
           P--GRI---NS--LPIL--LQLSA---VL--NA---P-WN-NAHS--Y--
Sequence 2 PEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGC

Sequence 1 RGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELK
           -G---VQVV---G--VFD--V--GQI-VVPQ-FAVV--A-----EW---K
Sequence 2 KGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFK

Sequence 1 NSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLK-NGRQEVEVF
           ----A--SP--G-TSVLRA-P-EVLAN---IS---A-K-K-N--Q-----
Sequence 2 TNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSS

Sequence 1 RPFQSRDEKERERFSIV
           -----------------
Sequence 2 GQSSQQMRDDA------



Alignment 7
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 33.93 (171/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           ---------------------L--------------R-Q-Q-Q--C-IQR
Sequence 2 --------------MAKLVLSLCFLLFSGCCFAFSFREQPQ-QNECQIQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           L-A--P--R--SE-G--E-W------F-C-G----R-------L--PSY-
Sequence 2 LNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYT

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
           NAP------QG-G--G---PGCP-TF------E-PQ-Q-G--SR------
Sequence 2 NAPQEIYIQQGSGIFGMIFPGCPSTF------EEPQ-QKGQSSRPQ----

Sequence 1 ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH
           -----D-HQKI---REGD-I--P-G---W--N--------V-L-D-NS--
Sequence 2 -----DRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQ

Sequence 1 KQLDENVRSFFLAG-------QSQRETREEGSDRQSRESDDDEALLGANI
           -QLD---R-F-LAG-------Q-Q------G---Q-------E---G--I
Sequence 2 NQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSI

Sequence 1 LSGFQDEILHELFRDVDRETISKLRGEND--QRGFIVQAQD-LKLRVP--
           LSGF--E-L---F--VDR----KL-GEN-----G-IV-----L----P--
Sequence 2 LSGFAPEFLEHAFV-VDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPT

Sequence 1 ---QDFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTY
           ---Q---EE-E----D-------S---NG-----C----R-N--------
Sequence 2 EEQQQRPEEEEKPDCDEKDKHCQSQSRNGIDETICTMRLRHNIGQTSSPD

Sequence 1 VFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSAL
           -FNP-AG-I-T--S---P-L--L-LSAQ---L-KNA---P--NLNA-S--
Sequence 2 IFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKNAMFVPHYNLNANSII

Sequence 1 YVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWV
           Y---G---VQVV---G--VFD---Q-GQ-L-VPQ-FAV---------E-V
Sequence 2 YALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAARSQSDNFEYV

Sequence 1 ELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVE
           --K-----------G--S-L-A-P-EV-----------A---KN------
Sequence 2 SFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSF

Sequence 1 VFRPFQSRDEKERERFSIV
           ---P--S------------
Sequence 2 LVPPKESQRRVVA------



Alignment 8
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 42.66 (215/504)
Sequence 1 MSTKLILSFSLCLMVL--SCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDI
           --------FSLCL------C-A--------Q-S-P---------Q-QC--
Sequence 2 --MAKAFVFSLCLLLVFNGCLAA----RQSQLS-P---------QNQCQL

Sequence 1 QRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPS
           --L-A-EP--R---EAG--E-W------F-C-G--A-R--IQ--GL-LPS
Sequence 2 NQLQAREPDNRIQAEAGQIETWNFNQEDFQCAGVAASRITIQRNGLHLPS

Sequence 1 YSNAPYITFVEQGRGVQGVVIPGCPETF-----------QSDSEFEYPQS
           YSNAP------QGRGV-G-V--GCPETF-----------Q---E-E--Q-
Sequence 2 YSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQ

Sequence 1 QRGRHSRQSESEE---------------------ESSRG-----------
           Q-G---RQ----E---------------------E---G-----------
Sequence 2 QQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQF

Sequence 1 ---DQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYHKQ
           ---D-HQK--RIREGDV---PAGV--W--NDG---L--V-L----S-H-Q
Sequence 2 RQFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQ

Sequence 1 LDENVRSFFLAG----------QSQ-RETREEGSDRQ-----SRESDDDE
           LD-N-R-F-LAG----------QSQ-R---E-G---Q------R------
Sequence 2 LDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQ

Sequence 1 ALLGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQA------
           ---G-N--SGF----L------V--ET---L-G-ND-R--I---------
Sequence 2 QGSGNNVFSGFNTQLLAQAL-NVNEETARNLQGQNDNRNQIIRVRGNLDF

Sequence 1 -QDLKLRVPQDFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFN
           -Q----R-----EE---------R--QGG----NG-E--FC-L----N--
Sequence 2 VQPPRGRQEREHEERQQEQLQQERQQQGGQLMANGLEETFCSLRLKENIG

Sequence 1 TPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNL
           -P-----F-PRAGRI-T-NS--LPIL-FL-LSA-----Y-N-I--P-WN-
Sequence 2 NPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNV

Sequence 1 NAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGR
           NAHS--YV-RG--RVQVV---G----D--VQ-GQ---VPQ---V---AG-
Sequence 2 NAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGN

Sequence 1 EGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKN
           -G-E----K---NA------GRTS-LRA-P-EVLAN-Y-IS---A--LK-
Sequence 2 QGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKY

Sequence 1 GRQEVEVFRPFQSRDEKERERFSIV
           -RQE-------Q-R-----------
Sequence 2 NRQETIALSSSQQRRAVV-------



Alignment 9
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 41.27 (208/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQ-QHQFQHQCDIQ
           ------------------------------------RQ-Q---Q-QC---
Sequence 2 -----------------------------------ARQSQLSPQNQCQLN

Sequence 1 RLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSY
           -L-A-EP--R---EAG--E-W------F-C-G--A-R--IQ--GL-LPSY
Sequence 2 QLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSY

Sequence 1 SNAPYITFVEQGRGVQGVVIPGCPETF-----------QSDSEFEYPQSQ
           SNAP------QGRGV-G-V--GCPETF-----------Q---E-E--Q-Q
Sequence 2 SNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQ

Sequence 1 RGRHSRQSESEE---------------------ESSRG------------
           -G---RQ----E---------------------E---G------------
Sequence 2 QGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFR

Sequence 1 --DQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYHKQL
           --D-HQK--RIREGDV---PAGV--W--NDG---L--V-L----S-H-QL
Sequence 2 QLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQL

Sequence 1 DENVRSFFLAG----------QSQ-RETREEGSDRQ-----SRESDDDEA
           D-N-R-F-LAG----------QSQ-R---E-G---Q------R-------
Sequence 2 DQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQ

Sequence 1 LLGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQA-------
           --G-N--SGF----L------V--ET---L-G-ND-R--I-Q--------
Sequence 2 GNGNNVFSGFNTQLLAQAL-NVNEETARNLQGQNDNRNQIIQVRGNLDFV

Sequence 1 QDLKLRVPQDFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNT
           Q----R-----EE---------R--QG-----NG-E--FC-L----N---
Sequence 2 QPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGN

Sequence 1 PTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLN
           P-----F-PRAGRI-T-NS--LPIL-FL-LSA-----Y-N-I--P-WN-N
Sequence 2 PERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVN

Sequence 1 AHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGRE
           AHS--YV-RG--RVQVV---G----D--VQ-GQ---VPQ---V---AG--
Sequence 2 AHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQ

Sequence 1 GLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNG
           G-E----K---NA------GRTS-LRA-P-EVLAN-Y-IS---A--LK--
Sequence 2 GFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYN

Sequence 1 RQEVEVFRPFQSRDEKERERFSIV
           RQE-------Q-R-----------
Sequence 2 RQETIALSSSQQRRAVV-------



Alignment 10
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 42.26 (213/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           ---------------------L-----------------------C-IQR
Sequence 2 ---------------MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           LTA-EP--R---EAGV-E-WD-----FRC-G--A-R--I-P-GLLLP-Y-
Sequence 2 LTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYT

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
           NAP----V-QGRG--GV--PGCPETFQS-S-F---Q--R-------E-EE
Sequence 2 NAPKLYYVTQGRGILGVLMPGCPETFQSMSQF---QGSR-------EQEE

Sequence 1 ESSR-GDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSY
           E--R--DQHQK------GD-I--PAGV--W--NDG--DL--V------S-
Sequence 2 ERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASD

Sequence 1 HKQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGFQD
           --QLD-N-R-FFLAG--QR-----G-----R--------L--N---GF--
Sequence 2 LNQLDQNPRHFFLAGNIQRSQKQRGERYGLR---GGQQILADNVFKGFNM

Sequence 1 EILHELFR-DVDRETISKLRGENDQRGFIVQA-QDLKLRVPQDFEEEYER
           E-L--------D-ET--K-RGE-DQRG-IV---Q-LK---P----EE-E-
Sequence 2 EALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQ

Sequence 1 ERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTV
           --G------GG----NG-E---C---F--N---P------NPRAGR--TV
Sequence 2 QEG------GGY---NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTV

Sequence 1 NSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVV
           NS---PIL-FLQLSA---VLY-NA---P-W-LNA-S--Y--RGE-RVQ-V
Sequence 2 NSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIV

Sequence 1 GDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSP
           ---G--VFDD----GQ--VVPQ-F-VV--AG--G-EWV------NA--S-
Sequence 2 DHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFST

Sequence 1 IGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKE
           --GRTS-LR-IPV-VLAN-Y--S--EA---K--R-E---F-P--------
Sequence 2 AAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRA

Sequence 1 RERFSIV
           -------
Sequence 2 SA-----



Alignment 11
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 45.44 (229/504)
Sequence 1 MSTKLIL-SFSLCLMVL--SCSAQLWPWQKGQGSRPHHGRQQHQFQHQCD
           ---KLIL-SFSLCL-VL---C-----------G-R----RQQ------C-
Sequence 2 -MAKLILVSFSLCLLVLFNGCLGI------NVGLR----RQQQRYFGECN

Sequence 1 IQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLP
           --RL-A-EP--R---EA---E-WDH----F-C-G----R--I-P-GLLLP
Sequence 2 LDRLNALEPTNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLP

Sequence 1 SYSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSE
           -YSNAP-----E-GRG--GV--PGCPETF------E-PQ-Q-----RQ--
Sequence 2 QYSNAPELIYIERGRGITGVLFPGCPETF------EDPQQQSQQGQRQGQ

Sequence 1 SEEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDAN
           -----S--D-HQKI---REGD-I--PAGV--W--NDG------V-LL--N
Sequence 2 GQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTN

Sequence 1 SYHKQLDENVRSFFLAGQSQRETREEGSD------RQSRES-----DDDE
           -Y--QLDEN-R-F-LAG----E----G--------RQ---S---------
Sequence 2 NYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQ

Sequence 1 ALLGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQD-LKL
           ---G-N--SGF--E-L---F--VD--T---L----D-R--IV-----L--
Sequence 2 QGEGNNVFSGFDAEFLADAF-NVDVDTARRLQSNQDKRRNIVKVEGRLQV

Sequence 1 RVPQDFEEEYER-ERGDR--------RRGQGGSGRS-NGVEQGFCNLKFR
           --P-----E-ER-ER--R---------R-QGG-GR--NG-E---C-L--R
Sequence 2 VRPERSRQEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLR

Sequence 1 RNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGP
           -N--T-----------GRINTVNSN-LP-L--LQLSA----L-------P
Sequence 2 ENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVP

Sequence 1 RWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVL
           -WNLNAHS--Y--RG--RVQVV-D-G--VFDD----GQ-L--PQ-FAV--
Sequence 2 HWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAK

Sequence 1 KAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAY
           -A--EG-EWV--K---NA--SP--GRTS--RA-P--VLAN---IS--EA-
Sequence 2 RAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEAR

Sequence 1 KLKNGRQEVEVFRPFQSRDEKERERFSIV------
           -LK--RQE----R---SR---ER-R-S--------
Sequence 2 RLKYNRQETTLVR--SSRSSSERKRRSESEGRAEA



Alignment 12
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 43.25 (218/504)
Sequence 1 MSTKLILSFSLC--LMVLSCSAQL-----WPWQKGQGSRPHHGRQQHQFQ
           M-----LSF-----L-----SAQL-------WQ--Q--------QQH--Q
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQS------QQQHKLQ

Sequence 1 HQ--CDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQP
           ----C---RLTA-EP--R--SEAG-TE-WD-----F-C-G--AVR-VIQP
Sequence 2 ARTDCRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQP

Sequence 1 GGLLLPSYSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGR
           -GLLLP-Y-NAP----V--GRG-QG-VIPGC-ETF--D-----P---R-R
Sequence 2 RGLLLPHYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQ---PRQDRRR

Sequence 1 HSRQSESEEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISV
           --------------D-HQK----R-GD----PAG---W--N-G---LI-V
Sequence 2 RFM-----------DRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITV

Sequence 1 TLLDANSYHKQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGA
           -LLD------QLD---R-FFLAG--Q---R-----R---E----E-----
Sequence 2 ALLDTGNAANQLDQTFRHFFLAGNPQG-GRQSYFGRPQTEKQQGET---K

Sequence 1 NILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRVPQDF
           NI--GF-DEIL---F--VD--T---L-G--D-RG-IV-A--L----P---
Sequence 2 NIFNGFDDEILADAF-GVDVQTARRLKGQDDLRGRIVRAERLDIVLPG--

Sequence 1 EEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRA
           EEE-ER---D---G-------NG-E---C--K-R-N---P----V-NP--
Sequence 2 EEEEERWERDPYSG------ANGLEETLCTAKLRENLDEPARADVYNPHG

Sequence 1 GRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGE
           GRI---NS--LP-L--L-LSA---VLY-N----P-WNLNAHS--Y-TRG-
Sequence 2 GRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGS

Sequence 1 GRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGR-EGLEWVELKNS
           GR-QVVG--G-SVFD--V--GQ---VPQ---V---A---EGLEW---K--
Sequence 2 GRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTN

Sequence 1 GNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPF
           -NA-TS---GR-S--RA-P-EV----Y--S--EA--LK--R-E--VF---
Sequence 2 DNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSST

Sequence 1 QSRDEKERERFSIV----------------
           ---------R--------------------
Sequence 2 SRYSWPRSSRPMSYMPKPFEYVLDVIKSMM



Alignment 13
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 34.52 (174/504)
Sequence 1 MSTKLILSFSLCLMVLS-CSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQ
           ---KL-LS--LC----S-C-A----------------R-Q-Q-Q--C-IQ
Sequence 2 -MAKLVLS--LCFLLFSGCFAL---------------REQAQ-QNECQIQ

Sequence 1 RLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSY
           -L-A--P--R--SE-G--E-W------F-C-G----R-------L--PSY
Sequence 2 KLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSY

Sequence 1 SNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESE
           -N-P------QG-G--G---PGCP-T-Q---E------QRGR--R-----
Sequence 2 TNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQE----SQQRGRSQRPQ---

Sequence 1 EESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSY
           ------D-HQK--R-REGD-I--P-GV--W--N--------V---D-NS-
Sequence 2 ------DRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSL

Sequence 1 HKQLDENVRSFFLAGQSQRE-----TREEGSDRQSRESDDDEALLGANIL
           --QLD---R-F-LAG----E---------G-----------E---G-NIL
Sequence 2 ENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNIL

Sequence 1 SGFQDEILHELFRDVDRETISKLRGENDQR--GFIVQAQD-LK-----LR
           SGF--E-L-E-F--V-------L-GEN-----G-IV-----L-------R
Sequence 2 SGFAPEFLKEAF-GVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMR

Sequence 1 VPQDFEEEYERERG----DRRRG-QGGSGRS-NGVEQGFCNLKFRRNFNT
           -PQ--E-----E----------G-Q--S-RS-NG-----C----R-N---
Sequence 2 KPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQ

Sequence 1 PTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLN
           -------NP-AG-I-T--S---P-L--L-LSAQ---L-KNA---P---LN
Sequence 2 NSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLN

Sequence 1 AHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGRE
           A-S--Y---G---VQVV---G--VFD---Q-G--L-VPQ-FAV--K----
Sequence 2 ANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSD

Sequence 1 GLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNG
           --E-V--K-----------G--S-L-A-P-EV-----------A---KN-
Sequence 2 NFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNN

Sequence 1 RQEVEVFRPFQSRDEKERERFSIV
           --------P--S------------
Sequence 2 NPFSFLVPPQESQRRAVA------



Alignment 14
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 34.52 (174/504)
Sequence 1 MSTKLILSFSLCLMVLS-CSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQ
           ---KL-LS--LC----S-C-A----------------R-Q-Q-Q--C-IQ
Sequence 2 -MAKLVLS--LCFLLFSGCFAL---------------REQAQ-QNECQIQ

Sequence 1 RLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSY
           -L-A--P--R--SE-G--E-W------F-C-G----R-------L--PSY
Sequence 2 KLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSY

Sequence 1 SNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESE
           -N-P------QG-G--G---PGCP-T-Q---E------QRGR--R-----
Sequence 2 TNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQE----SQQRGRSQRPQ---

Sequence 1 EESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSY
           ------D-HQK--R-REGD-I--P-GV--W--N--------V---D-NS-
Sequence 2 ------DRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSL

Sequence 1 HKQLDENVRSFFLAGQSQRE-----TREEGSDRQSRESDDDEALLGANIL
           --QLD---R-F-LAG----E---------G-----------E---G-NIL
Sequence 2 ENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNIL

Sequence 1 SGFQDEILHELFRDVDRETISKLRGENDQR--GFIVQAQD-LK-----LR
           SGF--E-L-E-F--V-------L-GEN-----G-IV-----L-------R
Sequence 2 SGFAPEFLKEAF-GVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMR

Sequence 1 VPQDFEEEYERERG----DRRRG-QGGSGRS-NGVEQGFCNLKFRRNFNT
           -PQ--E-----E----------G-Q--S-RS-NG-----C----R-N---
Sequence 2 KPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQ

Sequence 1 PTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLN
           -------NP-AG-I-T--S---P-L--L-LSAQ---L-KNA---P---LN
Sequence 2 NSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLN

Sequence 1 AHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGRE
           A-S--Y---G---VQVV---G--VFD---Q-G--L-VPQ-FAV--K----
Sequence 2 ANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSD

Sequence 1 GLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNG
           --E-V--K-----------G--S-L-A-P-EV-----------A---KN-
Sequence 2 NFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNN

Sequence 1 RQEVEVFRPFQSRDEKERERFSIV
           --------P--S------------
Sequence 2 NPFSFLVPPQESQRRAVA------



Alignment 15
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 34.92 (176/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           ------------L--L------------------------Q----C----
Sequence 2 ---------MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDN

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           L----P-----SEAG--E-WDH--P--RC-G----R-VIQ-GGL-LP---
Sequence 2 LDVLQPTEVIKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFF

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFE----YPQSQRGRHSRQS
           --P-I--V-QG-G--G-VIPGC-ETF-------------Q-Q-G----Q-
Sequence 2 SSPFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQGQQQGQQGQQGQQG

Sequence 1 ESEEESSRG-------------------------DQHQKIFRIREGDVIP
           --------G-------------------------D-HQK----R-GD-I-
Sequence 2 QQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHGDAIA

Sequence 1 SPAGVVQWTHNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQSQRETR
           ---G--QW--N-G---LI-V-L-D---Y--QLD-N-R-F-LAG--Q----
Sequence 2 MTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQ----

Sequence 1 EEGSDRQSRESDDDEALLGANILSGFQDEILHELFRDVDRETISKLRGEN
           --GS--Q-------------NILSGF----L-------D------L----
Sequence 2 -QGSSQQQQQQQQ-------NILSGFDPQVLAQALK-IDVRLAQELQNQQ

Sequence 1 DQRGFIVQAQDLKLRVPQDFEEEYERERGDRRRGQGGSGRSNGVEQGFCN
           D-RG-IV--------V-------YE-E-----RG---S---NG-E---C-
Sequence 2 DKRGNIVRVKGPFQVVRPPLRQAYESEQWRHPRGPPQSPQDNGLEETICS

Sequence 1 LKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNA
           -----N---P-------P--GR---VNS--LPIL----LSA----L---A
Sequence 2 MRTHENIDDPARADIYKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSA

Sequence 1 IIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGF
           ---P--N-NA---LY-T-G--R-QVV-D-G--V-D--VQ-GQ--V-PQGF
Sequence 2 MVLPKYNMNANEILYCTQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGF

Sequence 1 AVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDIST
           A-V--------EW---K---NA--S---GRTS-LRA-P-EV--N-Y-IS-
Sequence 2 AYVVQS-QNNFEWISFKTNANAMISTLAGRTSALRALPLEVITNAYQISL

Sequence 1 KEAYKLKNGRQEVEVFRPFQSRDEKERERFSIV
           -EA-K-K----E----R----------E----V
Sequence 2 EEARKIKFNTLETTLTRARGGQQPQLIEEIVEV



Alignment 16
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 44.44 (224/504)
Sequence 1 MSTKLILSFSL-CLMVLSCS-AQLWPWQKGQGSRPHHGRQQHQFQHQCDI
           M-----LSFSL--L----CS-AQ-------Q--------QQ--FQ-QC-I
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQ-----QRQQQQRFQTQCQI

Sequence 1 QRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPS
           Q-L-A-EP-RR--SEAGVTE-WD-------C------R--IQ--GLL-PS
Sequence 2 QNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPS

Sequence 1 YSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQ-RGRHSRQSE
           Y-NAP----V-QG-G--G-V-PGCPETFQ--S-----QSQ-R--HSR---
Sequence 2 YNNAPELVYVVQGSGIHGAVFPGCPETFQEES-----QSQSRSQHSR---

Sequence 1 SEEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDAN
           SE-----G-QHQK---IREGD-I--PAGV--W--N-G---L--V-L-D--
Sequence 2 SERSQQSGEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVG

Sequence 1 SYHKQLDENVRSFFLAGQSQRETREEGSD-RQSRESDDDEALLGANILSG
           ----QLD---R-F-L-G--Q-E----G----QSR-S---------NILS-
Sequence 2 NSENQLDQYLRKFVLGGSPQQEIQGGGQSWSQSRSSRKGQQ--SNNILSA

Sequence 1 FQDEILHELFRDVDRETISKLRGENDQRGFIVQAQ-DLKLRVPQDFEEEY
           F--EIL---F---D-----KL--E--QRG-IV----DL----PQ--E-EY
Sequence 2 FDEEILAQSF-NIDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQRQEKEY

Sequence 1 ERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRIN
           -----------------NG-E--FC------N-N-P----V-NPR-GR--
Sequence 2 S---------------DNGLEETFCTMTLKLNINDPSRADVYNPRGGRVT

Sequence 1 TVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQ
           --N---LPIL-FLQLS----VLY-NAI--P-WN-NAHS--Y-TRG-GR-Q
Sequence 2 SINALNLPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQ

Sequence 1 VVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAIT
           -V---G-SVFD-----GQ--VVPQ-FAVV--A---G-EWV--K--G-A--
Sequence 2 IVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKI

Sequence 1 SPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDE
           S---GR-SV-R--P--V--NS-DIS---A--LK--R-E---F-P--SR--
Sequence 2 SQLAGRISVMRGLPLDVIQNSFDISREDAWNLKESRSEMTIFAP-GSRSQ

Sequence 1 KERERFSIV
           --R------
Sequence 2 RQRN-----



Alignment 17
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 45.24 (228/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           M-----LS--L-L-V------L---Q-G-------GRQQ-QF--QC---R
Sequence 2 MAKPILLSIYLFLIVALFNGCLA--QSG-------GRQQQQFG-QCQLNR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           L-A-EP--R---EAGV-E-WD-----F-C-G---VR--I-P-GLLLP-YS
Sequence 2 LDALEPTNRIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
           NAP-------GRG--GV--PGCPETF----------SQR---S-Q--S-E
Sequence 2 NAPQLVYIARGRGITGVLFPGCPETFE--------ESQR--QSQQGQSRE

Sequence 1 ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH
           -----D-HQKI---REGD-I--PAGV--W--NDG--------LLD-N---
Sequence 2 FQQ--DRHQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNA

Sequence 1 KQLDENVRSFFLAGQSQRETREEGSD----------RQSR--ESDDDEAL
           -QLD-N-R-F-LAG----E-R--G------------RQ-R--E-------
Sequence 2 NQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHGQQQRG

Sequence 1 LGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRV-
           LG-N--SGF----L---F--VD-ET---L--END-R--IV------L-V-
Sequence 2 LGNNVFSGFDADFLADAF-NVDTETARRLQSENDHRRSIVRVEGRQLQVI

Sequence 1 -P------QDFEEEYERER-----GDRRRGQGGSGRSNGVEQGFCNLKFR
           -P------Q--EE--ERER-------RR----G----NG-E---C-L--R
Sequence 2 RPRWSREEQEREERKERERERESESERRQSRRGGRDDNGLEETICTLRLR

Sequence 1 RNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGP
           -N---P---------AGRI-TVNS--LP-L--LQLSA----LY--A---P
Sequence 2 ENIGDPSRADIYTEEAGRISTVNSHTLPVLRWLQLSAERGALYSDALYVP

Sequence 1 RWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVL
           -WNLNAHS--Y--RG---VQVV---G--VFDD----GQ-L--PQ-FAVV-
Sequence 2 HWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVK

Sequence 1 KAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAY
           -A--EG-EWV--K---NA--SP--GRTS--RA-P-EVLA----I----A-
Sequence 2 RARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIPREDAR

Sequence 1 KLKNGRQEVEVFRPFQSRDEKER-ERFSIV
           -LK--RQE----R---SR----R-ER---V
Sequence 2 RLKFNRQESTLVRSRPSRSRSSRSERRAEV



Alignment 18
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 44.64 (225/504)
Sequence 1 MSTKLILSFSLCLMVLS----CSAQLWPWQKGQGSRPHHGRQQHQFQHQC
           M-----LS--LCL--------C-AQ------G-------GRQQH-F--QC
Sequence 2 MAKPILLSIYLCLIIVALFNGCLAQ-----SG-------GRQQHKFG-QC

Sequence 1 DIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLL
           ---RL-A-EP--R---EAGV-E-WD-------C-G---VR--I-P-GLLL
Sequence 2 QLNRLDALEPTNRIEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLL

Sequence 1 PSYSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQS
           P-YSNAP-------GRG--GV--PGCPETF----------SQR---S-Q-
Sequence 2 PHYSNAPQLVYIARGRGITGVLFPGCPETFE--------ESQR--QSQQG

Sequence 1 ESEEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDA
           ---E-----D-HQKI---REGD-I--PAGV--W--NDG--------LLD-
Sequence 2 QRREFQQ--DRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDT

Sequence 1 NSYHKQLDENVRSFFLAGQSQRETREEGSDR----------QSRESDDDE
           -----QLD-N-R-F-LAG----E-R--G-------------Q-R-----E
Sequence 2 HNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGE

Sequence 1 AL--LGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQDLK
           ----LG-N--SGF--E-L---F--VD-ET---L--END-RG-IV------
Sequence 2 QQRDLGNNVFSGFDAEFLADAF-NVDTETARRLQSENDHRGSIVRVEGRQ

Sequence 1 LRV--P------QDFEEEYERER-----GDRRRGQGGSGRSNGVEQGFCN
           L-V--P------Q--EE--ERER-------RR----G----NG-E---C-
Sequence 2 LQVIRPRWSREEQEHEERKERERERESESERRQSRRGGRDDNGLEETICT

Sequence 1 LKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNA
           L--R-N---P---------AGRI-TVNS--LPIL--LQLSA----LY--A
Sequence 2 LSLRENIGDPSRADIYTEEAGRISTVNSHNLPILRWLQLSAERGALYSDA

Sequence 1 IIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGF
           ---P-WNLNAHS--Y--RG---VQVV---G--VFDD----GQ-L--PQ-F
Sequence 2 LYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNF

Sequence 1 AVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDIST
           AVV--A--EG-EWV--K---NA--SP--GRTS--RA-P-EVL-N---I--
Sequence 2 AVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQIPR

Sequence 1 KEAYKLKNGRQEVEVFRPFQSRDEKERERFSIV
           --A--LK--RQE----R---SR------R----
Sequence 2 EDARRLKFNRQESTLVRS-RSRSSRSERRAEV-



Alignment 19
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 38.69 (195/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQ-
           --------------------------------------QH-F------Q-
Sequence 2 -------------------------CLLLLFNGCLASRQHIFGQNKEWQL

Sequence 1 -RLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPS
           --L-A-EP-----SEAGVTE-W----P-F---G---VR--I-P-GL-LPS
Sequence 2 NQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPS

Sequence 1 YSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSES
           Y-NAP-------GRGV-G-V-PGC-ETF---------Q-Q-----R-S--
Sequence 2 YVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQ

Sequence 1 E----EESSRG----DQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLIS
           E---------G----D-HQKI--IREGD-I--PAGV--W--N-G---L--
Sequence 2 EGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVA

Sequence 1 VTLLDANSYHKQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLG
           V-LLD-N----QLD---R-F-LAG--Q-E-------RQ-----------G
Sequence 2 VSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNG

Sequence 1 ANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQ-DLKLRVP-
           -NI-SGF----L------V--ET---L-G--D-R--IV--Q--L----P-
Sequence 2 NNIFSGFDTQLLAQAL-NVNPETARNLQGQDDNRNEIVRVQGQLDFVSPF

Sequence 1 ------------QDFEEEYERERGDRRR---GQGGSGRSNGVEQGFCNLK
           ------------Q--E----RER----R----QGG-G--NGVE--FC---
Sequence 2 SRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSAR

Sequence 1 FRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAII
           ---N---P------NP--GRI--VN-N-LPIL--L-LSA---VLY-NAI-
Sequence 2 LSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIY

Sequence 1 GPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAV
           -P-W--NA----Y--RG--RVQVV---G----DD-V--GQ----PQ--AV
Sequence 2 TPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAV

Sequence 1 VLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKE
           ---A--EG-E--------N--T----GRTSVLRA-P-EVL-N---IS--E
Sequence 2 ITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQE

Sequence 1 AYKLKNGRQEVEVFRPFQSRDEKERERFSIV
           A--LK--RQE---------------------
Sequence 2 ARNLKYNRQESRLLSATSPPRGRLMSILGY-



Alignment 20
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 36.31 (183/504)
Sequence 1 -MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQ
           ----K--L--SL-L-V----AQ-------QG--------------QC--Q
Sequence 2 MVAFKFLLALSLSLLVSAAIAQTREPRLTQG-------------QQCRFQ

Sequence 1 RLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSY
           R-----PS-R--SE-G-TE-WD-----F-C-G-VA-R--I-P-GL-LP-Y
Sequence 2 RISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNY

Sequence 1 SNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRG-RHSRQSES
           ---P-----E-G-G------PGC-ET-Q---------SQR-------SE-
Sequence 2 HPSPRLVYIERGQGLISIMVPGCAETYQVH------RSQRTMERTEASEQ

Sequence 1 EEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANS
           ----S--D-HQK--R-R-GD----P-G---W--NDG--DL--V---D-N-
Sequence 2 QDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNH

Sequence 1 YHKQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGFQ
           ---QLD---R-F-LAG---R----E---RQ-------------NI---F-
Sequence 2 LSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFH----------NIFRAFD

Sequence 1 DEILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRVPQDFEEEYERE
           -E-L-E-F--V--ETI-----E---RG-IV-A------V--D-EEE-E-E
Sequence 2 AELLSEAF-NVPQETIRRMQSEEEERGLIVMARERMTFVRPD-EEEGEQE

Sequence 1 RGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVN
           ---R----------NG-E--FC--KFR-N---------F---AGR---V-
Sequence 2 HRGRQL-------DNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVD

Sequence 1 SNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVG
           -N-LPIL----LSA----LY-NA---P-W----H---YVTRG---VQVV-
Sequence 2 RNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVD

Sequence 1 DEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPI
           --G-----D-V--G---VVPQ-------AG--G-EWV--K--G----SP-
Sequence 2 HNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPL

Sequence 1 GGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKER
           -G-TSV-RA-P--V--NSY-IS---A--LK--R-----------R-----
Sequence 2 AGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS---

Sequence 1 ERFSIV
           ------
Sequence 2 ------



Alignment 21
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 36.51 (184/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           ---------------------------------------------C----
Sequence 2 --------------MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNN

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           L-A-EP--RV-SE-G----W----PE--C-G-----------GL-LPSYS
Sequence 2 LNALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
           --P------QG-G--GV-IPGCPETF------E-PQ-Q--R----S----
Sequence 2 PYPRMIIIAQGKGALGVAIPGCPETF------EEPQEQSNRRGSRSQKQQ

Sequence 1 ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH
           -----D-HQKI----EGDV---P-GV--WT-N-G--------LLD-----
Sequence 2 LQ---DSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFN

Sequence 1 KQLDENVRSFFLAG----------QSQRETREEGSDRQSRESDDDEALLG
           -QLD---R-F-LAG----------Q-Q------G---Q-------E---G
Sequence 2 NQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEE-G

Sequence 1 ANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIV------------
           ---LSGF----L---F---------KL----D-R--IV------------
Sequence 2 GSVLSGFSKHFLAQSF-NTNEDIAEKLQSPDDERKQIVTVEGGLSVISPK

Sequence 1 -QAQ----------DLKLRVP-------------QDFEEEYERER-----
           -Q-Q----------D-----P-------------QD--E-----------
Sequence 2 WQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSR

Sequence 1 ---GDRRRGQG------------------------------------GSG
           ---G-R---Q-------------------------------------G--
Sequence 2 PSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCE

Sequence 1 RSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQL
           --NGVE---C-LK---N---P------NP-AGRI-T-NS--LP-L---QL
Sequence 2 TRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQL

Sequence 1 SAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQ
           SAQ-VVLYKN-I--P-WNLNA-S--YVTRG-G-V-VV---G--VFD----
Sequence 2 SAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELR

Sequence 1 RGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPV
           RGQ-LVVPQ-F-V---AG--G-E----K---NA-TS-------V-RAIP-
Sequence 2 RGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL---KDVFRAIPS

Sequence 1 EVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFSIV
           EVLA-SY---------LK----------P---------------
Sequence 2 EVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA---



Alignment 22
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 37.30 (188/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           -------------M-------------------------------C----
Sequence 2 -------------MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNN

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           L-A-EP--RV-SE-G--E-W----PE--C-G-----------GL-LPSYS
Sequence 2 LNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE
           --P----V-QG-G--G---PGCPETF------E-PQ-Q--R----S----
Sequence 2 PYPQMIIVVQGKGAIGFAFPGCPETF------EKPQQQSSRRGSRSQQQL

Sequence 1 ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH
           -----D-HQKI----EGDV---P-GV--WT-N-G--------LLD-----
Sequence 2 Q----DSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFN

Sequence 1 KQLDENVRSFFLAG----------QSQRETREEGSDRQSRESDDDEALLG
           -QLD-N-R-F-LAG----------Q-Q------G---Q-------E---G
Sequence 2 NQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEE--G

Sequence 1 ANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQD-LKLRVP-
           ---LSGF----L---F------T--KLR---D-R--IV-----L----P-
Sequence 2 GSVLSGFSKHFLAQSF-NTNEDTAEKLRSPDDERKQIVTVEGGLSVISPK

Sequence 1 --------QDFEEEYER---------------------------------
           ---------D--EEYE----------------------------------
Sequence 2 WQEQEDEDEDEDEEYEQTPSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPP

Sequence 1 ERGDRRRGQGGSGRS----NGVEQGFCNLKFRRNFNTPTNTYVFNPRAGR
           -R--R---Q---GR-----NGVE---C--K---N---P------NP-AGR
Sequence 2 QRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRADFYNPKAGR

Sequence 1 INTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGR
           I-T-NS--LP-L----LSAQ-VVLY-N-I--P-WNLNA-S--YVTRG-GR
Sequence 2 ISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGR

Sequence 1 VQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNA
           V-VV---G--VFD----RGQ-LVVPQ-F-V----G--GLE-V--K---NA
Sequence 2 VRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNA

Sequence 1 ITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSR
           --S-I-----V-RAIP-EVL-NSY---------LK----------P----
Sequence 2 VSSYI---KDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP----

Sequence 1 DEKERERFSIV
           -----------
Sequence 2 -----------



Alignment 23
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 35.71 (180/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           ------------------------------------RQQ------C--QR
Sequence 2 ------------------------------------RQQPE-ENACQFQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           L-A--P--R--SE-G--E-W-----EF-C-G----R-V-----L--P-YS
Sequence 2 LNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSD-SEFEYPQSQRGRHSRQSESE
           NAP---F--QGRG--G---PGCP-------------QSQR-----Q-E--
Sequence 2 NAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQ

Sequence 1 EESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSY
           ----R-D-HQK--R--EGD-I--P-GV--W--ND---D---V-L-D-N--
Sequence 2 SQQQR-DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNN

Sequence 1 HKQLDENVRSFFLAGQSQRE-TREEGSDRQSRE-----------------
           --QLD---R-F-LAG----E--R-----RQSR------------------
Sequence 2 DNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQE

Sequence 1 ---------------SDDDEALLGANILSGFQDEILHELFRDVDRETISK
           -------------------E---G-NI-SGF--E-L---F---DR-----
Sequence 2 EREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQN

Sequence 1 LRG--ENDQRGFIVQAQ--------DLKLRVPQDFE---EEYERERGDRR
           LRG--E----G-IV-----------D-K-R-----E----EYE----DRR
Sequence 2 LRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRR

Sequence 1 RGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLP
           RG-G--GR-NG-E---C------N----------NP-AG---T-N---L-
Sequence 2 RGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLL

Sequence 1 ILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKS
           IL--L--SA----LY-NA------N-NAHS--Y--RG---VQVV---G--
Sequence 2 ILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNR

Sequence 1 VFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTS
           V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-----------G--S
Sequence 2 VYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENS

Sequence 1 VLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFSI
           V----P-EV-ANSY------A--LKN-------F-P--------------
Sequence 2 VIDNLPEEVVANSYGLQREQARQLKNN-NPFKFFVPPSQQSPRAVA----

Sequence 1 V
           -
Sequence 2 -



Alignment 24
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 35.71 (180/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           ------------------------------------RQQ------C--QR
Sequence 2 ---------------------------------ISFRQQPE-ENACQFQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           L-A--P--R--SE-G--E-W-----EF-C-G----R-V-----L--P-YS
Sequence 2 LNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSD-SEFEYPQSQRGRHSRQSESE
           NAP---F--QGRG--G---PGCP-------------QSQR-----Q-E--
Sequence 2 NAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQ

Sequence 1 EESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSY
           ----R-D-HQK--R--EGD-I--P-GV--W--ND---D---V-L-D-N--
Sequence 2 SQQQR-DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNN

Sequence 1 HKQLDENVRSFFLAGQSQRE-TREEGSDRQSRE-----------------
           --QLD---R-F-LAG----E--R-----RQSR------------------
Sequence 2 DNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQE

Sequence 1 ---------------SDDDEALLGANILSGFQDEILHELFRDVDRETISK
           -------------------E---G-NI-SGF--E-L---F---DR-----
Sequence 2 EREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQN

Sequence 1 LRG--ENDQRGFIVQAQ--------DLKLRVPQDFE---EEYERERGDRR
           LRG--E----G-IV-----------D-K-R-----E----EYE----DRR
Sequence 2 LRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRR

Sequence 1 RGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLP
           RG-G--GR-NG-E---C------N----------NP-AG---T-N---L-
Sequence 2 RGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLL

Sequence 1 ILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKS
           IL--L--SA----LY-NA------N-NAHS--Y--RG---VQVV---G--
Sequence 2 ILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNR

Sequence 1 VFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTS
           V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-----------G--S
Sequence 2 VYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENS

Sequence 1 VLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFSI
           V----P-EV-ANSY------A--LKN-------F-P--------------
Sequence 2 VIDNLPEEVVANSYGLQREQARQLKNN-NPFKFFVPPSQQSPRAVA----

Sequence 1 V
           -
Sequence 2 -



Alignment 25
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 36.51 (184/504)
Sequence 1 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR
           M---L-LSF--C--VL--S-----------------RQQ------C--QR
Sequence 2 MAKLLELSFCFCFLVLGASSISF-------------RQQPE-ENACQFQR

Sequence 1 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS
           L-A--P--R--SE-G--E-W-----EF-C-G----R-V-----L--P-YS
Sequence 2 LNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYS

Sequence 1 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEF-EYPQSQRGRHSRQSESE
           NAP---F--QGRG--G---PGCP-T-----------QSQR-----Q-E--
Sequence 2 NAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQ

Sequence 1 EESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSY
           ------D-HQK--R--EGD-I--P-GV--W--ND---D---V-L-D-N--
Sequence 2 SQQQQ-DSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNN

Sequence 1 HKQLDENVRSFFLAGQSQRE-TREEGSDRQSRE-----------------
           --QLD---R-F-LAG----E--R-----RQSR------------------
Sequence 2 DNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRRE

Sequence 1 ---------------SDDDEALLGANILSGFQDEILHELFRDVDRETISK
           -------------------E---G-NI-SGF--E-L---F---DR-----
Sequence 2 EREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQN

Sequence 1 LRGEND--QRGFIVQAQD-LKLRVPQ-----DFEEEYERER-----GDRR
           L-GEN-----G-IV-----L----P------D-EEEY----------D-R
Sequence 2 LWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGR

Sequence 1 RGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLP
           RG-G--G--NG-E---C------N-----------P------------L-
Sequence 2 RGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLL

Sequence 1 ILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKS
           IL--L-LSA----LY-NA---P--N-NAHS--Y--RG---VQVV---G--
Sequence 2 ILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNR

Sequence 1 VFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTS
           V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-----------G--S
Sequence 2 VYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENS

Sequence 1 VLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFSI
           -----P-EV-ANSY------A--LKN---------PFQ------------
Sequence 2 FIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA-----

Sequence 1 V
           -
Sequence 2 -



Alignment 26
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 34.52 (174/504)
Sequence 1 MSTKLILSFSLCLMVLS--CSAQLWPWQKGQGSRPHHGRQQHQFQHQCDI
           ------L-FSLC----S--C-A----------------R-Q-Q-Q--C-I
Sequence 2 ---MAKLVFSLCFLLFSGCCFA-------------FSSREQPQ-QNECQI

Sequence 1 QRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPS
           Q-L-A--P--R--SE-G--E-W------F-C-G----R-------L--PS
Sequence 2 QKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPS

Sequence 1 YSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSES
           Y-N-P------QG-G--G---PGCP-TF----E---PQ-QRG--SR----
Sequence 2 YTNGPQEIYIQQGKGIFGMIYPGCPSTFE---EPQQPQ-QRGQSSRPQ--

Sequence 1 EEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANS
           -------D-HQKI---REGD-I--P-GV--W--N--------V---D-NS
Sequence 2 -------DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNS

Sequence 1 YHKQLDENVRSFFLAGQSQRE----TREEGSDR-QSRESDDDEALLGANI
           ---QLD---R-F-LAG----E------E-G----Q-------E---G--I
Sequence 2 LENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSI

Sequence 1 LSGFQDEILHELFRDVDRETISKLRGEN--DQRGFIVQAQ----------
           LSGF--E-L---F--VD------L-GEN-----G-IV-------------
Sequence 2 LSGFTLEFLEHAF-SVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPT

Sequence 1 DLKLRVPQDFEEEYERE----RG-----DRRRGQGGSGRSNGVEQGFCNL
           D-----PQ--EEE-E-E-----G------R-RG-----R-NG-----C--
Sequence 2 DEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTM

Sequence 1 KFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAI
           --R-N----------NP-AG---T--S---P-L--L-LSA----L-KNA-
Sequence 2 RLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAM

Sequence 1 IGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFA
           --P--NLNA-S--Y---G----QVV---G--VFD---Q-G--L-VPQ-F-
Sequence 2 FVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFV

Sequence 1 VVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTK
           V---------E-V--K-----------G--S-L-A-P-EV----------
Sequence 2 VAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQ

Sequence 1 EAYKLKNGRQEVEVFRPFQSRDEKERERFSIV
           -A---KN---------P--S------------
Sequence 2 QARQIKNNNPFKFLVPPQESQKRAVA------



Alignment 27
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 34.52 (174/504)
Sequence 1 MSTKLILSFSLCLMVLS--CSAQLWPWQKGQGSRPHHGRQQHQFQHQCDI
           ------L-FSLC----S--C-A----------------R-Q-Q-Q--C-I
Sequence 2 ---MAKLVFSLCFLLFSGCCFA-------------FSSREQPQ-QNECQI

Sequence 1 QRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPS
           Q-L-A--P--R--SE-G--E-W------F-C-G----R-------L--PS
Sequence 2 QKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPS

Sequence 1 YSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSES
           Y-N-P------QG-G--G---PGCP-TF----E---PQ-QRG--SR----
Sequence 2 YTNGPQEIYIQQGKGIFGMIYPGCPSTFE---EPQQPQ-QRGQSSRPQ--

Sequence 1 EEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANS
           -------D-HQKI---REGD-I--P-GV--W--N--------V---D-NS
Sequence 2 -------DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNS

Sequence 1 YHKQLDENVRSFFLAGQSQRE----TREEGSDR-QSRESDDDEALLGANI
           ---QLD---R-F-LAG----E------E-G----Q-------E---G--I
Sequence 2 LENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSI

Sequence 1 LSGFQDEILHELFRDVDRETISKLRGEN--DQRGFIVQAQ----------
           LSGF--E-L---F--VD------L-GEN-----G-IV-------------
Sequence 2 LSGFTLEFLEHAF-SVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPT

Sequence 1 DLKLRVPQDFEEEYERE----RG-----DRRRGQGGSGRSNGVEQGFCNL
           D-----PQ--EEE-E-E-----G------R-RG-----R-NG-----C--
Sequence 2 DEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTM

Sequence 1 KFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAI
           --R-N----------NP-AG---T--S---P-L--L-LSA----L-KNA-
Sequence 2 RLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAM

Sequence 1 IGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFA
           --P--NLNA-S--Y---G----QVV---G--VFD---Q-G--L-VPQ-F-
Sequence 2 FVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFV

Sequence 1 VVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTK
           V---------E-V--K-----------G--S-L-A-P-EV----------
Sequence 2 VAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQ

Sequence 1 EAYKLKNGRQEVEVFRPFQSRDEKERERFSIV
           -A---KN---------P--S------------
Sequence 2 QARQIKNNNPFKFLVPPQESQKRAVA------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.