The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Plo i 1.0101

Sequence 25453077

Full FASTA alignment

Sequence name:
Query sequence:
MVDAATLEKLEAGFSKLAASDSKSLLKKYLTREVFDALKNKKTSFGSTLL
DSIQSGVENLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHPP
KNWGDVETLGNLDPAGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEEK
VSSTLSGLEGELKGTFFPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
RFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGVN
DIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEVA
SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIK
IEKSL

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Plo i 1Q95PM9Go!355518.81.1e-148
2Bomb m 1.0101ABB88514Go!355487.52.9e-139
3Lit v 2.0101Q004B5Go!356435.41.4e-123
4Pen m 2AAO15713Go!356433.26.4e-123
5Der p 20.0101ACD50950Go!356402.61.1e-113

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Plo i 1, Sequence: Q95PM9
Sequence identity: 100.00 (355/355)
Sequence 1 MVDAATLEKLEAGFSKLAASDSKSLLKKYLTREVFDALKNKKTSFGSTLL
           MVDAATLEKLEAGFSKLAASDSKSLLKKYLTREVFDALKNKKTSFGSTLL
Sequence 2 MVDAATLEKLEAGFSKLAASDSKSLLKKYLTREVFDALKNKKTSFGSTLL

Sequence 1 DSIQSGVENLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHPP
           DSIQSGVENLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHPP
Sequence 2 DSIQSGVENLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHPP

Sequence 1 KNWGDVETLGNLDPAGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEEK
           KNWGDVETLGNLDPAGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEEK
Sequence 2 KNWGDVETLGNLDPAGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEEK

Sequence 1 VSSTLSGLEGELKGTFFPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
           VSSTLSGLEGELKGTFFPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
Sequence 2 VSSTLSGLEGELKGTFFPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC

Sequence 1 RFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGVN
           RFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGVN
Sequence 2 RFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGVN

Sequence 1 DIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEVA
           DIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEVA
Sequence 2 DIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEVA

Sequence 1 SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIK
           SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIK
Sequence 2 SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIK

Sequence 1 IEKSL
           IEKSL
Sequence 2 IEKSL



Alignment 2
Sequence 1:
Sequence 2: Allergen Bomb m 1.0101, Sequence: ABB88514
Sequence identity: 92.39 (328/355)
Sequence 1 MVDAATLEKLEAGFSKLAASDSKSLLKKYLTREVFDALKNKKTSFGSTLL
           MVDAATLEKLEAGFSKL--SDSKSLLKKYLTREVFD-LKNKKTSFGSTLL
Sequence 2 MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLL

Sequence 1 DSIQSGVENLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHPP
           D-IQSGVENL-SGVGIYAPDAE-Y-VFA-LFDPIIEDYHNGFKKTDKHPP
Sequence 2 DCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPP

Sequence 1 KNWGDVETLGNLDPAGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEEK
           KNWGDV-TLGNLDPAGEFVVSTRVRCGRS-EGYPFNPCLTE-QYKEME-K
Sequence 2 KNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDK

Sequence 1 VSSTLSGLEGELKGTFFPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
           VS-TLS-LEGELKGTF-PLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
Sequence 2 VSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC

Sequence 1 RFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGVN
           RFWP-GRGIYHNENKTFLVWCNEEDHLR-ISMQMGGDL-QVYKRLV--VN
Sequence 2 RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVN

Sequence 1 DIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEVA
           -I-K-IPFSH--RLGFLTFCPTNLGTTVRASVHIKLPKLAADK-KLEEVA
Sequence 2 EIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA

Sequence 1 SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIK
           SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEY-AVKEMYDGIAELIK
Sequence 2 SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIK

Sequence 1 IEKSL
           IEKSL
Sequence 2 IEKSL



Alignment 3
Sequence 1:
Sequence 2: Allergen Lit v 2.0101, Sequence: Q004B5
Sequence identity: 81.41 (289/355)
Sequence 1 MVDAATLEKLEAGFSKL-AASDSKSLLKKYLTREVFDALKNKKTSFGSTL
           M-DAA--EKLEAGF-KL-AA-D-KSLLKKYLT-EVFD-LK-K-TS-G-TL
Sequence 2 MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATL

Sequence 1 LDSIQSGVENLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHP
           LD-IQSGVENL-SGVGIYAPDAEAY--FA-LFDPIIEDYH-GFK-TDKHP
Sequence 2 LDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHP

Sequence 1 PKNWGDVETLGNLDPAGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEE
           -K--GDV----N-DP-G-FV-STRVRCGRS--GYPFNPCLTE-QYKEME-
Sequence 2 NKDFGDVNSFVNVDPEGKFVISTRVRCGRSLQGYPFNPCLTESQYKEMEA

Sequence 1 KVSSTLSGLEGELKGTFFPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KVSSTLS-LEGELKGT--PLTGMSKE-QQ-LIDDHFLFKEGDRFLQAANA
Sequence 2 KVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGV
           CR-WP-GRGIYHN-NKTFLVW-NEEDHLR-ISMQMGGDL-QV--RL---V
Sequence 2 CRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAV

Sequence 1 NDIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEV
           N-I-KRIPFSH--RLGFLTFCPTNLGTTVRASVHIKLPKLAA---KLEEV
Sequence 2 NEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELI
           A-KY-LQVRGTRGEHTEAEGG-YDISNKRRMGLTE--AVKEM-DGI-ELI
Sequence 2 AGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELI

Sequence 1 KIEKSL
           KIEK--
Sequence 2 KIEKEM



Alignment 4
Sequence 1:
Sequence 2: Allergen Pen m 2, Sequence: AAO15713
Sequence identity: 81.13 (288/355)
Sequence 1 MVDAATLEKLEAGFSKL-AASDSKSLLKKYLTREVFDALKNKKTSFGSTL
           M-DAA--EKLEAGF-KL-AA-D-KSLLKKYL---VFD-LK-KKTS-G-TL
Sequence 2 MADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATL

Sequence 1 LDSIQSGVENLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHP
           LD-IQSGVENL-SGVGIYAPDAEAY--F--LFDPIIEDYH-GFK-TDKHP
Sequence 2 LDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHP

Sequence 1 PKNWGDVETLGNLDPAGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEE
           -K--GDV-T--N-DP-G--V-STRVRCGRSMEGYPFNPCLTEAQYKEME-
Sequence 2 NKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEA

Sequence 1 KVSSTLSGLEGELKGTFFPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KVSSTLS-LEGELKGT--PLTGMSKE-QQ-LIDDHFLFKEGDRFLQAANA
Sequence 2 KVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGV
           CR-WP-GRGIYHN-NKTFLVW-NEEDHLR-ISMQMGGDL-QV--RL---V
Sequence 2 CRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAV

Sequence 1 NDIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEV
           N-I-KRIPFSH--RLGFLTFCPTNLGTT-RASVHIKLPKLAA---KLEEV
Sequence 2 NEIEKRIPFSHHDRLGFLTFCPTNLGTTARASVHIKLPKLAANREKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELI
           A-KY-LQVRGTRGEHTEAEGG-YDISNKRRMGLTE--AVKEM-DGI-ELI
Sequence 2 AGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELI

Sequence 1 KIEKSL
           K-EK--
Sequence 2 KMEKEM



Alignment 5
Sequence 1:
Sequence 2: Allergen Der p 20.0101, Sequence: ACD50950
Sequence identity: 75.49 (268/355)
Sequence 1 MVDAATLEKLEAGFSKLA-ASDSKSLLKKYLTREVFDALKNKKTSFGSTL
           MVD-ATL-KLEAGF-KL--A-D--SLLKKYLTR-VFD-LKNKKT--G-TL
Sequence 2 MVDPATLSKLEAGFQKLQNAQDCHSLLKKYLTRDVFDQLKNKKTDMGATL

Sequence 1 LDSIQSGVENLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHP
           LD-IQSGVENL-SGVGIYAPDA--Y--FA-LFDPII-DYH-GFK-TDKHP
Sequence 2 LDVIQSGVENLDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHP

Sequence 1 PKNWGDVETLGNLDPAGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEE
           ----G--E---N-DP--E-V-STRVRCGRS--GYPFNP-LTEAQYKEME-
Sequence 2 KTDFGNIENFVNVDPKNEYVLSTRVRCGRSLNGYPFNPMLTEAQYKEMET

Sequence 1 KVSSTLSGLEGELKGTFFPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KV---L---EGELKGT--PL-GM-K-TQQQLIDDHFLFKEGDRFLQAANA
Sequence 2 KVKGQLATFEGELKGTYYPLLGMDKATQQQLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGV
           CR-WP-GRGI-HN--KTFL-W-NEEDHLR-ISMQ-GGDLK-VY-RLV--V
Sequence 2 CRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDLKEVYGRLVKAV

Sequence 1 NDIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEV
           --I---IPFS---RLGFLTFCPTNLGTT-RASVHIKLPKLAAD--KLEEV
Sequence 2 KHIEQKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELI
           A--Y-LQVRGT-GEHTE--GG-YDISNKRRMGLTEY-AVKEM-DGI-ELI
Sequence 2 AGRYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGILELI

Sequence 1 KIEKSL
           K-EKS-
Sequence 2 KMEKSM


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.