The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Gly m conglycinin

Sequence 256427

Full FASTA alignment

Sequence name:
Query sequence:
MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQN
VRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLS
GRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI
PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEE
EEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYS
NNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN
EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVV
NATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDV
ERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Gly m conglycininAAB23463Go!439590.34.9e-170
2Gly m 5.0201Q9FZP9Go!559438.63.0e-124
3Gly m 5.0101O22120Go!543438.43.3e-124
4Gly m conglycininCAA35691Go!605438.43.7e-124
5Vig r 2.0101Q198W3Go!453399.61.4e-112
6Vig r 2.0201B1NPN8Go!454392.41.9e-110
7Gly m conglycininAAB01374Go!639331.65.4e-92
8Gly m conglycininAAA33947Go!218250.54.9e-68
9Jug n 2AAM54366Go!481205.73.2e-54
10Jug r 2AAF18269Go!593204.59.4e-54
11Ses i 3AAK15089Go!585182.15.0e-47
12Pis v 3.0101EF116865Go!519175.83.5e-45
13Lup an 1.0101ACB05815Go!611156.13.6e-39
14Len c 1.0101CAD87730Go!418150.89.6e-38
15Len c 1.0102CAD87731Go!415146.12.4e-36
16Ana o 1.0101AAM73730Go!538144.59.8e-36
17Ana o 1.0102AAM73729Go!536144.31.1e-35
18Ara h 1P43237Go!614140.81.4e-34
19Ara h 1P43238Go!626140.81.4e-34
20Cor a 11AAL86739Go!448137.21.3e-33
21Gly m Bd28KBAB21619Go!47356.03.7e-09
22Cor a 9AAL73404Go!51535.18.2e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB23463
Sequence identity: 100.00 (439/439)
Sequence 1 MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQN
           MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQN
Sequence 2 MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQN

Sequence 1 VRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLS
           VRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLS
Sequence 2 VRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLS

Sequence 1 GRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI
           GRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI
Sequence 2 GRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI

Sequence 1 PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEE
           PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEE
Sequence 2 PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEE

Sequence 1 EEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYS
           EEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYS
Sequence 2 EEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYS

Sequence 1 NNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN
           NNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN
Sequence 2 NNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN

Sequence 1 EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVV
           EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVV
Sequence 2 EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVV

Sequence 1 NATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDV
           NATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDV
Sequence 2 NATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDV

Sequence 1 ERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY
           ERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY
Sequence 2 ERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY



Alignment 2
Sequence 1:
Sequence 2: Allergen Gly m 5.0201, Sequence: Q9FZP9
Sequence identity: 72.44 (318/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEW

Sequence 1 ----------------MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPF
           ----------------------------------S-------R----NPF
Sequence 2 QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPF

Sequence 1 YFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTI
           -F--S--FQTLF-NQ----R-LQRFNKRS-QL-NLRDYRI--F-SKPNT-
Sequence 2 HF-NSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTL

Sequence 1 LLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYL
           LLPHHADAD-L---L-G-AILTLVNNDDRDSYNL--GDA-R-PAGTTYY-
Sequence 2 LLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYV

Sequence 1 VNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETS
           VNP----NL--I-LAIPVNKPGR---FFLSSTQAQQSYLQGFS-NILE-S
Sequence 2 VNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEAS

Sequence 1 FHSEFEEINRVLFGEEE-----EQRQQEGVIVELSKEQIRQLSRRAKSSS
           ----FEEIN-VLFG-EE-----E-R-QE-VIVE-SK-QIR-LS--AKSSS
Sequence 2 YDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSS

Sequence 1 RKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDI
           RKTISSED-PFNLRSR-PIYSN--GK-FEITPEKNPQLRDLD-FLS-VD-
Sequence 2 RKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDM

Sequence 1 NEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQR
           NEGAL-LPHFNSKAIV-LVINEG-ANIELVGIKEQQQ-Q-QEE-PLEV--
Sequence 2 NEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRK

Sequence 1 YRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDN
           YRAELSE-D-FVIPA-YP-VVNATS-LNF-AFGINAENNQRNFLAG-KDN
Sequence 2 YRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDN

Sequence 1 VVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKG
           V--QI--QVQELAFPGSA-D-E-L-K-Q-ESYFVDAQPQQKEEG-KGRKG
Sequence 2 VISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKG

Sequence 1 PFPSILGALY
           P--SIL-A-Y
Sequence 2 PLSSILRAFY



Alignment 3
Sequence 1:
Sequence 2: Allergen Gly m 5.0101, Sequence: O22120
Sequence identity: 73.35 (322/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQK

Sequence 1 MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQN
           --R-------------------S---R----NPF-F--SN-F-TLF-NQ-
Sequence 2 EERKQEEDEDEEQQRESEESEDSELRRHKNKNPFLF-GSNRFETLFKNQY

Sequence 1 VRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLS
           -RIR-LQRFN-RSPQL-NLRDYRI--F-SKPNT-LLP-HADAD-L---L-
Sequence 2 GRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILN

Sequence 1 GRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI
           G-AIL-LVNNDDRDSY-L--GDA-R-P-GTTYY-VNP----NL--I-LAI
Sequence 2 GTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAI

Sequence 1 PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEE
           PVNKPGR---FFLSST-AQQSYLQGFS-NILE-S----FEEIN-VLF--E
Sequence 2 PVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSRE

Sequence 1 E-----EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSR
           E-----EQR-QE-VIVE-SKEQIR-LS-RAKSSSRKTISSED-PFNLRSR
Sequence 2 EGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSR

Sequence 1 NPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIV
           -PIYSN--GKFFEITPEKNPQLRDLDIFLS-VD-NEGALLLPHFNSKAIV
Sequence 2 DPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIV

Sequence 1 ILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAA
           ILVINEGDANIELVG-KEQQQ-Q-QEE-PLEV--YRAELSE-D-FVIPA-
Sequence 2 ILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAG

Sequence 1 YPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPG
           YP-VVNATSNLNF-A-GINAENNQRNFLAG--DNV--QI--QVQELAFPG
Sequence 2 YPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPG

Sequence 1 SAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY
           SAQ-VE-LLK-QRESYFVDAQP--KEEG-KGRKGP--SIL-A-Y
Sequence 2 SAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY



Alignment 4
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: CAA35691
Sequence identity: 73.35 (322/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE

Sequence 1 ------------MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRS
           --------------R-------------------S---R----NPF-F--
Sequence 2 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLF-G

Sequence 1 SNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPH
           SN-F-TLF-NQ--RIR-LQRFN-RSPQL-NLRDYRI--F-SKPNT-LLP-
Sequence 2 SNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPN

Sequence 1 HADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPH
           HADAD-L---L-G-AIL-LVNNDDRDSY-L--GDA-R-P-GTTYY-VNP-
Sequence 2 HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPD

Sequence 1 DHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSE
           ---NL--I-LAIPVNKPGR---FFLSST-AQQSYLQGFS-NILE-S----
Sequence 2 NNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTK

Sequence 1 FEEINRVLFGEEE-----EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTI
           FEEIN-VLF--EE-----EQR-QE-VIVE-SKEQIR-LS-RAKSSSRKTI
Sequence 2 FEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI

Sequence 1 SSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGA
           SSED-PFNLRSR-PIYSN--GKFFEITPEKNPQLRDLDIFLS-VD-NEGA
Sequence 2 SSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGA

Sequence 1 LLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAE
           LLLPHFNSKAIVILVINEGDANIELVG-KEQQQ-Q-QEE-PLEV--YRAE
Sequence 2 LLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAE

Sequence 1 LSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQ
           LSE-D-FVIPA-YP-VVNATSNLNF-A-GINAENNQRNFLAG--DNV--Q
Sequence 2 LSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQ

Sequence 1 IERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPS
           I--QVQELAFPGSAQ-VE-LLK-QRESYFVDAQP--KEEG-KGRKGP--S
Sequence 2 IPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSS

Sequence 1 ILGALY
           IL-A-Y
Sequence 2 ILRAFY



Alignment 5
Sequence 1:
Sequence 2: Allergen Vig r 2.0101, Sequence: Q198W3
Sequence identity: 69.70 (306/439)
Sequence 1 MMRVRFPLLVLLGTVFLASVCVSLKV--REDE-----------NNPFYFR
           M-R-R--LL--LG--FLAS--VS-----RE-------------NNPFYF-
Sequence 2 MVRARVQLL--LGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFN

Sequence 1 SSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLP
           S---F-TLF-NQ----R---RF--RS-Q--NL--YR-V-F-SKPNT-LLP
Sequence 2 SDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLP

Sequence 1 HHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNP
           HHADADFLL-VL-GRAILTLVN-D-RDSY-L--G-AQ-IPAGTT--LVNP
Sequence 2 HHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNP

Sequence 1 HDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHS
           -D--NL-IIKLAIPVN-P-R---FFLSST-AQQSYL-GFS-NILE-SF-S
Sequence 2 NDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDS

Sequence 1 EFEEINRVLFGEEEEQR-----QQEGVIVELSKEQIRQLSRRAKSSSRKT
           -F-EI-RVLFGEE--Q------Q-EGVIVEL--EQIR-L---AKSSSRK-
Sequence 2 DFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKE

Sequence 1 ISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEG
           -SS-DEPFNLR--NPIYSN-FG---EITPEKNPQL-DLD-F-SSVD--EG
Sequence 2 LSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEG

Sequence 1 ALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRA
           -LLLPH-NSKAIVILVINEG-A-IELVG---QQQ------E-LEVQRYRA
Sequence 2 GLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQ----DESLEVQRYRA

Sequence 1 ELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVR
           ELSEDDVFVIPAAYP---NATSNLNF-AFGINAENNQRNFLAGEKDNV--
Sequence 2 ELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMS

Sequence 1 QIERQVQELAFPGSAQDVERLLKKQRESYFVDAQP--QQKEEGSKGRKGP
           -I---V----FP-S---VE-L-KKQ-ES-FVDAQP--QQ-EEG-KGRKG-
Sequence 2 EIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGS

Sequence 1 FPSILGALY
           --SILG-LY
Sequence 2 LSSILGSLY



Alignment 6
Sequence 1:
Sequence 2: Allergen Vig r 2.0201, Sequence: B1NPN8
Sequence identity: 67.88 (298/439)
Sequence 1 MMRVRFPLLVLLGTVFLASVCVSLKV--RED-----------ENNPFYFR
           M-R-R-PLL-LLG--FLAS--VS-----RE-------------NNPFYF-
Sequence 2 MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFN

Sequence 1 SSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLP
           S---F-TLF-NQ----R-LQRF--RS-Q--NL--YR-V---SKPNT-LLP
Sequence 2 SDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLP

Sequence 1 HHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNP
           HHADADFLL-VL-GRA-LTLVN-D-RDS--L--G-AQ-IPAGTT--LVNP
Sequence 2 HHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNP

Sequence 1 HDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHS
           -D--NL-IIKLA-PVN-P-R--DFFLSST-AQQSYLQGFS-NILE-SF-S
Sequence 2 DDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDS

Sequence 1 EFEEINRVLFGEEEEQRQQ------EGVIVELSKEQIRQLSRRAKSSSRK
           ---EI-RVLFGEE--Q-QQ------EGVIVEL--EQIR-L---AKSSS-K
Sequence 2 DIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKK

Sequence 1 TISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINE
           --SSED-PFNLR---PIYSN--G--FEITPEKNPQLRDLD-F--SVD--E
Sequence 2 SLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE

Sequence 1 GALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYR
           G-LLLPH-NSKAIVILVINEG-ANIELVG--EQQ--Q---EE--EVQRYR
Sequence 2 GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYR

Sequence 1 AELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVV
           AELSEDDVF-IPA-YP---NATSNLNF-AFGINAENNQRNFLAGEKDNV-
Sequence 2 AELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVI

Sequence 1 RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQ--KEEGSKGRKG
           --I---V----FP-S---V--L-KKQ-ES-FVDAQP-Q---EE--KG-KG
Sequence 2 SEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEARKGGKG

Sequence 1 PFPSILGALY
           PF--------
Sequence 2 PFVY------



Alignment 7
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB01374
Sequence identity: 70.84 (311/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NQACHARCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPH

Sequence 1 ----------------------------MMRVRFPLLVLLGTVFLASVCV
           ----------------------------------------------S---
Sequence 2 QPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQ

Sequence 1 SLKVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDY
           ----R----NPF-F--S--FQTLF-NQ----R-LQRFNKRS-QL-NLRDY
Sequence 2 REPRRHKNKNPFHF-NSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDY

Sequence 1 RIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGD
           RI--F-SKPNT-LLPHHADAD-L---L-G-AILTLVNNDDRDSYNL--GD
Sequence 2 RILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGD

Sequence 1 AQRIPAGTTYYLVNPHDHQNL-------------------KIIKLAIPVN
           A-R-PAGTT-Y-VNP----NL---------------------I-LAIPVN
Sequence 2 ALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVN

Sequence 1 KPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEE--
           KPGR---FFLSSTQAQQSYLQGFS-NILE-S----FEEIN-VLFG-EE--
Sequence 2 KPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQ

Sequence 1 ---EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPI
           ---E-R-QE-VIVE-SK-QIR-LS--AKSSSRKTISSED-PFNL-SR-PI
Sequence 2 QQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLGSRDPI

Sequence 1 YSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILV
           YSN--GK-FEIT---NPQLRDLD-FLS-VD-NEGAL-LPHFNSKAIV-LV
Sequence 2 YSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLV

Sequence 1 INEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPF
           INEG-ANIELVGIKEQQQ-Q-QEE-PLEV--YRAELSE-D-FVIPA-YP-
Sequence 2 INEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPV

Sequence 1 VVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQ
           -VNATS-LNF-AFGINAENNQRNFLAG-KDNV--QI--QVQELAFP-SA-
Sequence 2 MVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAK

Sequence 1 DVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY
           D-E-L-K-Q-ESYFVDAQPQQKEEG-KGRKGP--SIL-A-Y
Sequence 2 DIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY



Alignment 8
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAA33947
Sequence identity: 41.23 (181/439)
Sequence 1 MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQN
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYS
           ---------------------S-RAKSSSRKTISSED-PFNL-SR-PIYS
Sequence 2 ---------------------SKRAKSSSRKTISSEDKPFNLGSRDPIYS

Sequence 1 NNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVIN
           ---GKFFEITPEKNPQLRDLDIFLS-VD-NEGALLLPHFNSKAIVILVIN
Sequence 2 KKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVIN

Sequence 1 EGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVV
           EGDANIELVG-KEQQQ-Q-QEE-PLEV--YRAELSE-D-FVIPA-YP-VV
Sequence 2 EGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVV

Sequence 1 NATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDV
           NATSNLNF-A-GINAENNQRNFLAG--DNV--QI--QVQELAFPGSAQ-V
Sequence 2 NATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAV

Sequence 1 ERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY
           E-LLK-QRESYFVDAQP--KEEG-KGRKGP--SIL-A-Y
Sequence 2 EKLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY



Alignment 9
Sequence 1:
Sequence 2: Allergen Jug n 2, Sequence: AAM54366
Sequence identity: 38.04 (167/439)
Sequence 1 ---------------------------------MMRVRFPLLVLLGTVFL
           --------------------------------------------------
Sequence 2 GRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPE

Sequence 1 ASVCVSLKVREDE---NNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSP
           AS-----K-RE-E----NP-YF-S--S-----E--------L-RF--R--
Sequence 2 ASPRRESKGREEEQQRHNPYYFHSQ-SIRSRHESEEGEVKYLERFAERTE

Sequence 1 QLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRD
           -L-----YR-V-----PNT--LPHH-DA-----V--GRA-LTLV----R-
Sequence 2 LLRGIENYRVVILDANPNTFMLPHHKDAESVIVVTRGRATLTLVSQETRE

Sequence 1 SYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLS
           S-NL--GD--R-PAG-T-Y--N------L---KL--PVN-PG--------
Sequence 2 SFNLECGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNPGQVREYYAA

Sequence 1 STQA-QQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVEL
           ------QSYL--FS--IL------------R--F----EQR--EGVI---
Sequence 2 GAKSPDQSYLRVFSNDILVAALNTPRDRLER--FFDQQEQR--EGVIIRA

Sequence 1 SKEQIRQLSRRAKSSSRKTIS--SEDEPFNLRSRNPIYSNNFGKFFEITP
           S-E--R-LS--A-S---------S---P--L-S--P-YSN-FG-FFE--P
Sequence 2 SQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQFFEACP

Sequence 1 EKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELV--
           E---QL---D-------I--GA---PH-NSKA-V-----EG----E----
Sequence 2 EEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACP

Sequence 1 -----GIKEQQQKQKQEEEPL-EVQRYRAELSEDDVFVIPAAYPFVVNAT
           ---------Q------EEE-----Q---A-L---D-FVIPA--P----A-
Sequence 2 HVSSQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITAS

Sequence 1 S--NLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVE
           ---NL--L-FGIN-ENNQRNFLAG-------Q-ER---EL-F-------E
Sequence 2 QNENLRLLGFGINGENNQRNFLAGQ-NSIINQLEREAKELSFNMPREEIE

Sequence 1 RLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY-
           -----Q-ESYFV----Q-------GR--P--SILG----
Sequence 2 EIFESQMESYFVPTERQSRR--GQGRDHPLASILGFAFF



Alignment 10
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 37.81 (166/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE

Sequence 1 ---------------------------------------------MMRVR
           --------------------------------------------------
Sequence 2 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ

Sequence 1 FPLLVLLGTVFLASVCVSLKVREDE---NNPFYFRSSNSFQTLFENQNVR
           ------------AS-------RE-E----NP-YF-S--S-----E-----
Sequence 2 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQ-SIRSRHESEEGE

Sequence 1 IRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGR
           ---L-RF--R---L-----YR-V-----PNT--LPHH-DA-----V--GR
Sequence 2 VKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGR

Sequence 1 AILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPV
           A-LTLV----R-S-NL--GD--R-PAG-T-Y--N------L---KL--PV
Sequence 2 ATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPV

Sequence 1 NKPGRYDDFFLSSTQA-QQSYLQGFSHNILETSFHSEFEEINRVLFGEEE
           N-PG--------------QSYL--FS--IL------------R--F----
Sequence 2 NNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER--FFDQQ

Sequence 1 EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTIS--SEDEPFNLRSRNPIY
           EQR--EGVI---S-E--R-LS--A-S---------S---P--L-S--P-Y
Sequence 2 EQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSY

Sequence 1 SNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVI
           SN-FG-FFE--PE---QL---D-------I--GA---PH-NSKA-V----
Sequence 2 SNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYV

Sequence 1 NEGDANIELVGIK------EQQQKQKQEEEPL--EVQRYRAELSEDDVFV
           -EG----E-----------E-Q----QEEE------Q---A-L---D-FV
Sequence 2 VEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFV

Sequence 1 IPAAYPFVVNATS--NLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQ
           IPA--P----A----NL--L-F-IN-ENNQR-FLAG---N---Q-ER---
Sequence 2 IPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ-NNIINQLEREAK

Sequence 1 ELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY
           EL-F-------E-----Q-ESYFV----Q-------GR--P--SIL----
Sequence 2 ELSFNMPREEIEEIFESQMESYFVPTERQSRR--GQGRDHPLASILDFAF

Sequence 1 -
           -
Sequence 2 F



Alignment 11
Sequence 1:
Sequence 2: Allergen Ses i 3, Sequence: AAK15089
Sequence identity: 32.12 (141/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF

Sequence 1 ------------MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRS
           --------------------------------------------P--F--
Sequence 2 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED

Sequence 1 SNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPH
           ---F-T-F--Q--R-R-LQ-F--RS--L-----YR-------P-T---P-
Sequence 2 QH-FITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPN

Sequence 1 HADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPH
           H-DA----FV--GR----LV--D-R-S-N---GD---I-AGTT-YL-N--
Sequence 2 HWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRD

Sequence 1 DHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSE
           ----L---KL--PV--PG----FF--------S----FS--ILE--F---
Sequence 2 NNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTR

Sequence 1 FEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDE
           -----R--FG----QRQ--GVIV--S-EQ-R--SR---------------
Sequence 2 RDRLQRI-FGQ---QRQ--GVIVKASEEQVRAMSRHEEGGIWPFGGESKG

Sequence 1 PFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPH
           --N-----P--SN--G---E-------QLRDLD---S---I--GA---PH
Sequence 2 TINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPH

Sequence 1 FNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPL---EVQRYRAELS
           -NSKA--I-----G----E---------------E-------QR----L-
Sequence 2 YNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASRLT

Sequence 1 EDDVFVIPAAYPFVVNATSNLNF--LAFGINAENNQRNFLAGEKDNVVRQ
           ---V--IPA--PFV--A-SN-N---L-F--NA-NN----LAG---NV--Q
Sequence 2 RGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRR-NVMNQ

Sequence 1 IERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPS
           -ER---ELAF---A--VE-----Q-E--F----P-Q---G----------
Sequence 2 LEREAKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQQGRADA------

Sequence 1 ILGALY
           ------
Sequence 2 ------



Alignment 12
Sequence 1:
Sequence 2: Allergen Pis v 3.0101, Sequence: EF116865
Sequence identity: 31.44 (138/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KTDPELKQCKHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQEEEEEEE

Sequence 1 ---------------------------------------------MMRVR
           --------------------------------------------------
Sequence 2 WGSGRGRGDEFSTHEPGEKRLSQCMKQCERQDGGQQKQLCRFRCQEKYKK

Sequence 1 FPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQNVRIRL
           ----------------------E---NP--F-----F-T-----------
Sequence 2 ERREHSYSRDEEEEEEGDEEQEEEDENPYVFEDEH-FTTRVKTEQGKVVV

Sequence 1 LQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAIL
           L--F-KRS--L--L--YR-------P-----P-H-DAD---FV--GR---
Sequence 2 LPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDADSIFFVSWGRGTI

Sequence 1 TLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKP
           T------R-S-N---GD--RI-AGT--Y-VN------L-I-KL--PVN-P
Sequence 2 TKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQPVNLP

Sequence 1 GRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQ
           G-Y--F---------S----FS---LE-------------LF-------Q
Sequence 2 GHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-LF-----EKQ

Sequence 1 QEGVIVELSKEQIRQLSRRAKSSSRKTISSEDE-PFNLRSRNPIYSNNFG
           -EG-IV--SKEQIR--SRR----S-----------FNL----P--SNN-G
Sequence 2 DEGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYG

Sequence 1 KFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDA
           --FE------P-L--LDI--S-V-I--G----P--NS-A--I-----G--
Sequence 2 QLFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEG

Sequence 1 NIELVGIKEQQQKQK-QEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNAT
           --E---------K---QE---------------D-VFV-PA--PFV--A-
Sequence 2 RLEIACPHLSSSKNSGQEKSGPSYKKLSSSIRTDSVFVVPAGHPFVTVAS

Sequence 1 SNLNF--LAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVE
           -N-N---L-F--NAE-N-R--LAG-K-N-----E----ELAF------V-
Sequence 2 GNQNLEILCFEVNAEGNIRYTLAGKK-NIIEVMEKEAKELAFKTKGEEVD

Sequence 1 RLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY
           ----KQ-E--F----P--------GR------------
Sequence 2 KVFGKQDEEFFFQG-PKWRQH-QQGRADE---------



Alignment 13
Sequence 1:
Sequence 2: Allergen Lup an 1.0101, Sequence: ACB05815
Sequence identity: 56.49 (248/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKMRVRLPMLILLLGVVFLLAASIGIAYGEKDFTKNPPKEREEEEHEPR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQPRPRQQEEQEREHRREEKHDGEPSRGRSQSEESQEEEHERRREHHRER

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EQEQQPRPQRRQEEEEEEEEWQPRRQRPQSRREEREEREQEQGSSSGSQR

Sequence 1 --MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFEN
           ------R-----------------S--------NP--F-SSN-FQT---N
Sequence 2 GGGDERRQHRERRVHREEREQEQDSRSDSRRQRNPYHF-SSNRFQTYYRN

Sequence 1 QNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFV
           -N--IR-L-RFN-R---LENL--YRI--FQSKPNT--LP-H-DADF-L-V
Sequence 2 RNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDADFILVV

Sequence 1 LSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKL
           L-GRA--T-VN-D-R--YNL--GDA-R-PAGTT-Y--NP-D-QNL---KL
Sequence 2 LNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAKL

Sequence 1 AIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFG
           AIP-N-PG---DF--S-T--QQSY--GFS-N-LE--F----EEI-RVL-G
Sequence 2 AIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLG

Sequence 1 -----EEEEQR-------QQEGVIVELSKEQIRQLSRRAKSSSRKTISSE
           -----E-E-QR-------Q-EGVIV--SK-QI--L---A-SSS-----SE
Sequence 2 DDELQENEKQRRGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSE

Sequence 1 DEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLL
           --PFNLRS--PIYSN-FG-F-EITP--NPQ--DL-I-L----INEGALLL
Sequence 2 SGPFNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLL

Sequence 1 PHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLE-----VQRYR
           PH-NSKAI-I-V--EG--N-ELVGI--QQ--Q---EE--E-----V-RY-
Sequence 2 PHYNSKAIFIVVVDEGEGNYELVGIRDQQRQQDEQEEEYEQGEEEVRRYS

Sequence 1 AELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVV
           --LS--DVF-IPA--P---NA-SNL--L-FGINA--NQRNFLAG--DNV-
Sequence 2 DKLSKGDVFIIPAGHPLSINASSNLRLLGFGINANENQRNFLAGSEDNVI

Sequence 1 RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKE----EGSKGR
           -Q--R-V-EL-FPGS--DVERL-K-Q--SYF--AQPQQ------EG--GR
Sequence 2 KQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQQQQREKEGRRGR

Sequence 1 KGPFPSILGALY
           -GP--SIL-ALY
Sequence 2 RGPISSILNALY



Alignment 14
Sequence 1:
Sequence 2: Allergen Len c 1.0101, Sequence: CAD87730
Sequence identity: 55.81 (245/439)
Sequence 1 MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQN
           --------------------------R-D--NPF-F-S-N-FQT--EN-N
Sequence 2 -------------------------SRSDQENPFIFKS-NRFQTIYENEN

Sequence 1 VRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLS
           --IRLLQRF-KRS---ENL--YR-----SKP-TI-LP---DADF-L-VLS
Sequence 2 GHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLS

Sequence 1 GRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI
           G-AILT--N--DR-S-NL--GD----PAGT--YL-N--D---L----LAI
Sequence 2 GKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI

Sequence 1 PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEE
           PVN-PG----F-LS-TQ-Q-S-L-GFS-NILE--F--E-EEI--VL--EE
Sequence 2 PVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLL-EE

Sequence 1 EEQRQQ--------------EGVIVELSKEQIRQLSRRAKSSSRKTISSE
           -EQ--Q--------------E-VIV--S-EQI--LS--AKSSS-K--SSE
Sequence 2 QEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSE

Sequence 1 DEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLL
           -EPFNLRSRNPIYSN-FGKFFEITPEKNPQL-DLDIF--SV-I-EG-LLL
Sequence 2 SEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLL

Sequence 1 PHFNSKAIVILVINEGDANIELVGIK-EQQQKQK--------QEEEPL-E
           P--NS-AIVI---NEG----ELVG---E-QQ-Q---------QEEE----
Sequence 2 PNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQ

Sequence 1 VQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGE
           VQRYRA-LS--DV-VIPA--P---NA-S-LN---FGINA-NNQRNFLAGE
Sequence 2 VQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGE

Sequence 1 KDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKG
           -DNV--QI-R-V-ELAFPGS---V-RLL--Q--S-F--AQP-Q-E-----
Sequence 2 EDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE-----

Sequence 1 RKGPFPSILGALY
           -------------
Sequence 2 -------------



Alignment 15
Sequence 1:
Sequence 2: Allergen Len c 1.0102, Sequence: CAD87731
Sequence identity: 53.08 (233/439)
Sequence 1 MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQN
           --------------------------R-D--NPF-F-S-N-FQT--EN-N
Sequence 2 -------------------------SRSDQENPFIFKS-NRFQTIYENEN

Sequence 1 VRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLS
           --IRLLQ-F-KRS---ENL--YR-----SKP-T--LP---DADF-L-VLS
Sequence 2 GHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDADFILVVLS

Sequence 1 GRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI
           G-A-LT--N--DR-S-NL--GD----PAGT--YL-N--D---L----LAI
Sequence 2 GKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI

Sequence 1 PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEE
           PVN-PG----F-LS-TQ-Q-S-L-GF---ILE--F----EEI--VL----
Sequence 2 PVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQ

Sequence 1 EEQRQ-------------QEGVIVELSKEQIRQLSRRAKSSSRKTISSED
           E---Q--------------E-VIV--S-EQI--LS--AKSSS-K--SSE-
Sequence 2 EQEPQHRRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSES

Sequence 1 EPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLP
           EPFNLRSRNPIYSN-FGKFFEITPEKNPQL-DLDIF--SV-I-EG-LLLP
Sequence 2 EPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLP

Sequence 1 HFNSKAIVILVINEGDANIELVGIKEQQQKQ------KQEEEP-LEVQRY
           --NS-AIVI---NEG----ELVG-----Q---------QEEE----VQRY
Sequence 2 NYNSRAIVIVTVNEGKGYFELVGQRNENQREENDDEEEQEEETSTQVQRY

Sequence 1 RAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNV
           RA-LS--DVFV-PA--P---NA-S-LN---FGINA-NNQRNFLAGE-DNV
Sequence 2 RAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNV

Sequence 1 VRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGP
           --QI-R-V-ELAFPGS---V-RLL--Q--S-F--AQP-Q-E---------
Sequence 2 ISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE---------

Sequence 1 FPSILGALY
           ---------
Sequence 2 ---------



Alignment 16
Sequence 1:
Sequence 2: Allergen Ana o 1.0101, Sequence: AAM73730
Sequence identity: 28.47 (125/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCM

Sequence 1 -------------------MMRVRFPLLVLLGTVFLASVCVSLKVREDEN
           ---------------------R------------------------E---
Sequence 2 RQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEEDE

Sequence 1 NPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKP
           NP--F-----F-T----------LL--F---S--L--L--YR-------P
Sequence 2 NPYVFEDED-FTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANP

Sequence 1 NTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTT
           -----P-H-DAD---FV--GR---T------R-S-N---GD---I--GT-
Sequence 2 QAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTP

Sequence 1 YYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNIL
           -Y--N------L-------PVN-PG----F---------S----FS--IL
Sequence 2 FYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEIL

Sequence 1 ETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRK
           E-------------LF-------Q--G-I---SKEQIR--SRR-------
Sequence 2 EAALKTSKDTLEK-LF-----EKQDQGTIMKASKEQIRAMSRRGEGPKIW

Sequence 1 TISSEDE-PFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDIN
           ----E----F-L----P--SN--G--FE------P-L--LD---S---I-
Sequence 2 PFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANIT

Sequence 1 EGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRY
           -G----P--NS-A--I-----G----E---------K------P------
Sequence 2 KGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSH---P-SYKKL

Sequence 1 RAELSEDDVFVIPAAYPF--VVNATSNLNFLAFGINAENNQRNFLAGEKD
           RA----D-VF--PA--PF--V-----NL----F--NAE-N-R--LAG-K-
Sequence 2 RARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-

Sequence 1 NVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRK
           N-----E----ELAF------V-----KQ-E--F-------KE----GR-
Sequence 2 NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEK--EGRA

Sequence 1 GPFPSILGALY
           -----------
Sequence 2 DE---------



Alignment 17
Sequence 1:
Sequence 2: Allergen Ana o 1.0102, Sequence: AAM73729
Sequence identity: 28.25 (124/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQ

Sequence 1 -----------------MMRVRFPLLVLLGTVFLASVCVSLKVREDENNP
           -------------------R------------------------E---NP
Sequence 2 CERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEEDENP

Sequence 1 FYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNT
           --F-----F-T----------LL--F---S--L--L--YR-------P--
Sequence 2 YVFEDED-FTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQA

Sequence 1 ILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYY
           ---P-H-DAD---FV--GR---T------R-S-N---GD---I--GT--Y
Sequence 2 FVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFY

Sequence 1 LVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILET
           --N------L-------PVN-PG----F---------S----FS--ILE-
Sequence 2 IANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEA

Sequence 1 SFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTI
           ------------LF-------Q--G-I---SKEQ-R--SRR---------
Sequence 2 ALKTSKDTLEK-LF-----EKQDQGTIMKASKEQVRAMSRRGEGPKIWPF

Sequence 1 SSEDE-PFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEG
           --E----F-L----P--SN--G--FE------P-L--LD---S---I--G
Sequence 2 TEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKG

Sequence 1 ALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRA
           ----P--NS-A--I-----G----E---------K------P------RA
Sequence 2 GMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSH---P-SYKKLRA

Sequence 1 ELSEDDVFVIPAAYPF--VVNATSNLNFLAFGINAENNQRNFLAGEKDNV
           ----D-VF--PA--PF--V-----NL----F--NAE-N-R--LAG-K-N-
Sequence 2 RIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NI

Sequence 1 VRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGP
           ----E----ELAF------V-----KQ-E--F-------KE----GR---
Sequence 2 IKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEK--EGRADE

Sequence 1 FPSILGALY
           ---------
Sequence 2 ---------



Alignment 18
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43237
Sequence identity: 53.30 (234/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MRGRVSPLMLLLGILVLASVSATQAKSPYRKTENPCAQRCLQSCQQEPDD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LKQKACESRCTKLEYDPRCVYDTGATNQRHPPGERTRGRQPGDYDDDRRQ

Sequence 1 ---------------------------------MMRVRFPLLVLLGTVFL
           --------------------------------------------------
Sequence 2 PRREEGGRWGPAEPREREREEDWRQPREDWRRPSHQQPRKIRPEGREGEQ

Sequence 1 ASVCVSLKVRED--ENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQ
           --------VRE----NNPFYF--S--F-T---NQN-RIR-LQRF--RS-Q
Sequence 2 EWGTPGSEVREETSRNNPFYF-PSRRFSTRYGNQNGRIRVLQRFDQRSKQ

Sequence 1 LENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDS
           --NL---RIVQ----PNT--LP-HADAD--L----G-A--T--N---R-S
Sequence 2 FQNLQNHRIVQIEARPNTLVLPKHADADNILVIQQGQATVTVANGNNRKS

Sequence 1 YNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSS
           -NL--G-A-RIP-G---Y--N-HD-QNL---K---PVN-PG---DFF--S
Sequence 2 FNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPAS

Sequence 1 TQAQQSYLQGFSHNILETSFHSEFEEINRVLF-----GEEEEQRQQ----
           ---Q-SYLQGFS-N-LE--F--EF-EI-RVL------GE-EE--Q-----
Sequence 2 SRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRRST

Sequence 1 -----EGVIVELSKEQIRQLSRRAKSSSRKTISSED--EPFNLRSRNPIY
           -----EGVIV--SKE----L---AKS-S-K----ED---P-NLR---P--
Sequence 2 RSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPDL

Sequence 1 SNNFGKFFEITPEK-NPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILV
           SNNFG--FE--P-K-NPQL-DLD--L--V-I-EGAL-LPHFNSKA-VI-V
Sequence 2 SNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVV

Sequence 1 INEGDANIELVGI-KEQQQKQKQEEE-------------PLEVQRYRAEL
           -N-G--N-ELV---KEQQQ----E-E---------------EV-RY-A-L
Sequence 2 VNKGTGNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARL

Sequence 1 SEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQI
           -E-DVF--PAA-P---NA-S-L--L-FGINAENN-R-FLAG-KDNV--QI
Sequence 2 KEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVIDQI

Sequence 1 ERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQK----------EEGS
           E-Q---LAFPGS---VE-L-K-QRES-FV-A-PQ------------EE--
Sequence 2 EKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKEDQEEEN

Sequence 1 KGRKGPFPSILGALY
           -G-KGP--SIL-A--
Sequence 2 QGGKGPLLSILKAFN



Alignment 19
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43238
Sequence identity: 53.99 (237/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MRGRVSPLMLLLGILVLASVSATHAKSSPYQKKTENPCAQRCLQSCQQEP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DDLKQKACESRCTKLEYDPRCVYDPRGHTGTTNQRSPPGERTRGRQPGDY

Sequence 1 ---------------------------------------MMRVRFPLLVL
           --------------------------------------------------
Sequence 2 DDDRRQPRREEGGRWGPAGPREREREEDWRQPREDWRRPSHQQPRKIRPE

Sequence 1 LGTVFLASVCVSLKVRED--ENNPFYFRSSNSFQTLFENQNVRIRLLQRF
           --------------VRE----NNPFYF--S--F-T---NQN-RIR-LQRF
Sequence 2 GREGEQEWGTPGSHVREETSRNNPFYF-PSRRFSTRYGNQNGRIRVLQRF

Sequence 1 NKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVN
           --RS-Q--NL---RIVQ---KPNT--LP-HADAD--L----G-A--T--N
Sequence 2 DQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTVAN

Sequence 1 NDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYD
           ---R-S-NL--G-A-RIP-G---Y--N-HD-QNL---K---PVN-PG---
Sequence 2 GNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFE

Sequence 1 DFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLF-----GEEEEQR
           DFF--S---Q-SYLQGFS-N-LE--F--EF-EI-RVL------GE-EE--
Sequence 2 DFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERG

Sequence 1 QQ----------EGVIVELSKEQIRQLSRRAKSSSRKTISSEDE-----P
           Q-----------EGVIV--SKE----L---AKS-S-K---SE-E-----P
Sequence 2 QRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKK--GSEEEGDITNP

Sequence 1 FNLRSRNPIYSNNFGKFFEITPEK-NPQLRDLDIFLSSVDINEGALLLPH
           -NLR---P--SNNFGK-FE--P-K-NPQL-DLD--L--V-I-EGAL-LPH
Sequence 2 INLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPH

Sequence 1 FNSKAIVILVINEGDANIELVGI-KEQQQKQKQEEEP----------LEV
           FNSKA-VI-V-N-G--N-ELV---KEQQQ----EEE------------EV
Sequence 2 FNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNREV

Sequence 1 QRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEK
           -RY-A-L-E-DVF--PAA-P---NA-S-L--L-FGINAENN-R-FLAG-K
Sequence 2 RRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDK

Sequence 1 DNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQK-------
           DNV--QIE-Q---LAFPGS---VE-L-K-Q-ES-FV-A-PQ---------
Sequence 2 DNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQSPSSP

Sequence 1 ----------EEGSKGRKGPFPSILGALY
           ----------EE---G-KGP--SIL-A--
Sequence 2 EKESPEKEDQEEENQGGKGPLLSILKAFN



Alignment 20
Sequence 1:
Sequence 2: Allergen Cor a 11, Sequence: AAL86739
Sequence identity: 31.89 (140/439)
Sequence 1 ----------------------------MMRVRFPLLVLLGTVFLASVCV
           --------------------------------------------------
Sequence 2 MLPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSE

Sequence 1 SLKVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDY
           -----E-E-NP--F-----F---------R---L--F-KRS--L------
Sequence 2 ESYGKEQEENPYVFQDEH-FESRVKTEEGRVQVLENFTKRSRLLSGIENF

Sequence 1 RIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGD
           R-------P-T---P-H-DA---LFV--GRA--T-V----R-S-N---GD
Sequence 2 RLAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGD

Sequence 1 AQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSY
           --RIPAGT--Y--N------L-I-K---PV--PG----F---------S-
Sequence 2 IIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFEAFYGAGGEDPESF

Sequence 1 LQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLS
           ---FS---LE-------E----V-FGE-----Q--G-IV--S-E-IR-LS
Sequence 2 YRAFSWEVLEAALKVRREQLEKV-FGE-----QSKGSIVKASREKIRALS

Sequence 1 RRAKSSSRK-TISSEDE-PFNLRSRNPIYSNNFGKFFEITPEKNPQLRDL
           -------R------E---P-NL----P--SN-FG---E--P----QL-DL
Sequence 2 QHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDL

Sequence 1 DIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQ
           D---S---I--G----P--NS-A--I-V--EG----E-------------
Sequence 2 DLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSY

Sequence 1 EEEPLEVQRYRAELSEDDVFVIPAAYPFVVNAT--SNLNFLAFGINAENN
           -------Q---A-L----VFV-PA--P--V-A----NL--L-F--NA--N
Sequence 2 -------QKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGN

Sequence 1 QRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQ
           -R--LAG-K-N-V---ER---ELAF------VER--K-Q----F------
Sequence 2 SRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNK

Sequence 1 QKEEGSKGRKGPFPSILGALY
           Q-EEG--G-------------
Sequence 2 QQEEGGRGGRAFE--------



Alignment 21
Sequence 1:
Sequence 2: Allergen Gly m Bd28K, Sequence: BAB21619
Sequence identity: 24.60 (108/439)
Sequence 1 MMRVRFPLLVLLGTVFLASVCVSLKVREDEN----NP-FYFRSSNSFQTL
           -------LL-LL----------------DE------P---F--SNS----
Sequence 2 ----KTTLLLLLFVLCHGVATTTMAFHDDEGGDKKSPKSLFLMSNSTR-V

Sequence 1 FENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFL
           F-------R-L-----R-------R---I------P-----P---D----
Sequence 2 FKTDAGEMRVLKSHGGRIFY----RHMHIGFISMEPKSLFVPQYLDSNLI

Sequence 1 LFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKI
           -F---G-A-L-----D------L--GD---IP-G---YLVN----Q-L--
Sequence 2 IFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHV

Sequence 1 IKLAIPVNKPG--RYDDFFLSSTQAQQSYLQGFSHNILETSFH---SEFE
           I----P----G------F---------S-L-GF---ILET-F-------E
Sequence 2 ICSIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVE

Sequence 1 EI------NRVLFGEEEEQRQQEGVIVELSKE----QIRQL------SRR
           EI----------F---------------L-K-----Q-------------
Sequence 2 EIFSKELDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEE

Sequence 1 AKSSSR--------------KTISSED---EP--FNLRS-RNPIYSNNFG
           -K--SR----------------I---D----P---NL---------N--G
Sequence 2 EKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKADFKNAYG

Sequence 1 KFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDA
           ----------P-L---DI----V----G--L-PH-N-----------G--
Sequence 2 WSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLSGYG

Sequence 1 NIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPF--VVNA
           -----G--------K------------------DVFV-P---PF--V---
Sequence 2 ELH-IGYPNGSRAMK------------TKIKQGDVFVVPRYFPFCQVASR

Sequence 1 TSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVER
           ---L-F--F---A--N---FLAG------R---------AF--S-----R
Sequence 2 DGPLEFFGFSTSARKNKPQFLAGAA-SLLRTLMGPELSAAFGVSEDTLRR

Sequence 1 LLKKQRESYFV-DAQPQQKEEGSKGRKGPFPSILGALY--------
           ----Q-E------A-----E---K------P---------------
Sequence 2 AVDAQHEAVILPSAWAAPPENAGKLKMEEEPNAIRSFANDVVMDVF



Alignment 22
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 17.54 (77/439)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTN

Sequence 1 ------------------------------------------MMRVRFPL
           --------------------------------------------------
Sequence 2 RIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYI

Sequence 1 LVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQNVRIRLLQR
           ----G-----------------------------Q-----Q---------
Sequence 2 ERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHF

Sequence 1 FNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLV
           -------L--------------P-------H------------R------
Sequence 2 REGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAG

Sequence 1 NNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRY
           N-DD-----------QR---------------Q-----------------
Sequence 2 NPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEFLA

Sequence 1 DDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEG
           D-F------A------------------------------E-E-Q--QE-
Sequence 2 DAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER

Sequence 1 VIVELSKEQIRQLSR-RAKSSSRKTISSE--DEPFNLRSRNPIYSNNFGK
           --------Q-RQ--R-R-------TI-S----E----RSR--IY----G-
Sequence 2 ESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGR

Sequence 1 FFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDAN
           ---------P-LR-L-------D-----L--PH-N--A--------G-A-
Sequence 2 INTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRAR

Sequence 1 IELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSN
           ---V-----------------V-----EL----V--IP--------A-S-
Sequence 2 VQVV-----------DDNGNTV--FDDELRQGQVLTIPQNFAVAKRAESE

Sequence 1 -LNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLL
           -----AF--N--N-Q---LAG------R-----V---AF--S-----RL-
Sequence 2 GFEWVAFKTN-DNAQISPLAG-RTSAIRALPDDVLANAFQISREEARRLK

Sequence 1 KKQRESYFV----DAQPQQKEEGSKGRKGPFPSILGALY
           ----E---V--------------S-GR------------
Sequence 2 YNRQETTLVRSSRSSSERKRRSESEGRAEA---------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.