The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Jun o 1

Sequence 15139849

Full FASTA alignment

Sequence name:
Query sequence:
MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
ENGNAAPQLTKNAGVVT

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Jun o 1CAC48400Go!367559.27.9e-161
2Jun a 1.010101P81294Go!367544.12.8e-156
3Jun v 1.0101Q9LLT1Go!367542.68.1e-156
4Jun v 1.0102AAF80164Go!367540.82.7e-155
5Cup s 1.0102AAF72626Go!367536.94.2e-154
6Cup s 1.0101AAF72625Go!367535.89.0e-154
7Cup a 1CAC37790Go!367535.11.4e-153
8Cup s 1.0103AAF72627Go!367534.91.7e-153
9Cup s 1.0104AAF72628Go!367533.64.1e-153
10Cup s 1.0105AAF72629Go!367532.11.2e-152
11Cup a 1Q9SCG9Go!346507.52.8e-145
12Cha o 1Q96385Go!375486.75.3e-139
13Cry j 1.0101P18632Go!374458.91.3e-130
14Cry j 1.0103BAB86287Go!374458.32.0e-130
15Cry j 1.0102BAA05543Go!374454.33.1e-129
16Art v 6.0101AY904433Go!396239.31.8e-64
17Amb a 1P27761Go!397238.04.4e-64
18Amb a 1AAA32669Go!397238.04.4e-64
19Amb a 2P27762Go!397235.62.3e-63
20Amb a 1P27760Go!398232.91.4e-62
21Amb a 1P27759Go!396231.05.6e-62
22Amb a 1P28744Go!392216.51.3e-57
23Pen c 32.0101ABM60783Go!29066.51.3e-12

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Jun o 1, Sequence: CAC48400
Sequence identity: 100.00 (367/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
Sequence 2 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
Sequence 2 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
Sequence 2 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
Sequence 2 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sequence 2 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
Sequence 2 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGNAAPQLTKNAGVVT
Sequence 2 ENGNAAPQLTKNAGVVT



Alignment 2
Sequence 1:
Sequence 2: Allergen Jun a 1.010101, Sequence: P81294
Sequence identity: 97.00 (356/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           MASPCL-AVLVFLCAIVSCYSDNPIDSCWRGDSNW-QNRMKLADC-VGFG
Sequence 2 MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG-FYTVTS--DNPVNPTPGTLRYGATREKALWIIFSQNMNIK
Sequence 2 SSTMGGKGGDFYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILH-LHIHGCNTS
Sequence 2 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHSLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           LGSTGITISNNHFFNHHKVMLLGHDDTYD-DKSMKVTVAFNQFGPNAGQR
Sequence 2 LGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sequence 2 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGCES-SACANWVWRSTRDAF-NGAYFVSSGK-EETNIYNSNEAFKV
Sequence 2 TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGNAAPQLTKNAGVVT
Sequence 2 ENGNAAPQLTKNAGVVT



Alignment 3
Sequence 1:
Sequence 2: Allergen Jun v 1.0101, Sequence: Q9LLT1
Sequence identity: 96.46 (354/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           MASPCL-A-LVFLCAIVSC-SDNPIDSCWRGDSNWGQNRMKLADC-VGFG
Sequence 2 MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG-FYTVTSA-DNPVNPTPGTLRYGATREK-LWIIFSQNMNIK
Sequence 2 SSTMGGKGGDFYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
Sequence 2 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLGDVLVSESIGV-PVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           LGSTGITISNNHFFNHHKVMLLGHDDTYD-DKSMKVTVAFNQFGPNAGQR
Sequence 2 LGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAP-E-YKKEV
Sequence 2 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGCESTSACANWVWRSTRDAF-NGAYFVSSGKIEETNIYNSNEAFKV
Sequence 2 TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGNAAPQLTKNAGVV-
Sequence 2 ENGNAAPQLTKNAGVVA



Alignment 4
Sequence 1:
Sequence 2: Allergen Jun v 1.0102, Sequence: AAF80164
Sequence identity: 96.19 (353/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           MASPCL-A-LVFLCAIVSC-SDNPIDSCWRGDSNWGQNRMKLADC-VGFG
Sequence 2 MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG-FYTVTSA-DNPVNPTPGTLRYGATREK-LWIIFSQNMNIK
Sequence 2 SSTMGGKGGDFYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
Sequence 2 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLGDVLVSESIGV-PVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           LGSTGITI-NNHFFNHHKVMLLGHDDTYD-DKSMKVTVAFNQFGPNAGQR
Sequence 2 LGSTGITIFNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAP-E-YKKEV
Sequence 2 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGCESTSACANWVWRSTRDAF-NGAYFVSSGKIEETNIYNSNEAFKV
Sequence 2 TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGNAAPQLTKNAGVV-
Sequence 2 ENGNAAPQLTKNAGVVA



Alignment 5
Sequence 1:
Sequence 2: Allergen Cup s 1.0102, Sequence: AAF72626
Sequence identity: 95.64 (351/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           M-SPCL-AVLVFLCAIVSCYSDNPIDSCWRGDSNW-QNRMKLADC-VGFG
Sequence 2 MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG--YTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
Sequence 2 SSTMGGKGGDIYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           L-MPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
Sequence 2 LEMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           L-STGITISNNHFFNHHKVMLLGHDDTYD-DKSMKVTVAFNQFGPNAGQR
Sequence 2 LSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYD-WNIYAIGGSSNPTILSEGNSFTAP-E-YKKEV
Sequence 2 MPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGCESTSACANWVWRSTRDAF-NGAYFVSSGK-EETNIYNSNEAFKV
Sequence 2 TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGN-APQLTKNAGVV-
Sequence 2 ENGNLAPQLTKNAGVVA



Alignment 6
Sequence 1:
Sequence 2: Allergen Cup s 1.0101, Sequence: AAF72625
Sequence identity: 95.37 (350/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           M-SPCL-AVLVFLCAIVSCYSDNPIDSCWRGDSNW-QNRMKLADC-VGFG
Sequence 2 MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG--YT-TSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
Sequence 2 SSTMGGKGGDIYTATSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
Sequence 2 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           L-STGITISNNHFFNHHKVMLLGHDDTYD-DKSMKVTVAFNQFGPNAGQR
Sequence 2 LSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYD-WNIYAIGGSSNPTILSEGNSF-AP-E-YKKEV
Sequence 2 MPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGCESTSACANWVWRSTRDAF-NGAYFVSSGK-EETNIYNSNEAFKV
Sequence 2 TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGN-APQLTKNAGVV-
Sequence 2 ENGNLAPQLTKNAGVVA



Alignment 7
Sequence 1:
Sequence 2: Allergen Cup a 1, Sequence: CAC37790
Sequence identity: 95.64 (351/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           MASPCL-AVLVFLCAIVSCYSDNPIDSCWRGDSNW-QNRMKLADCVVGFG
Sequence 2 MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           S-TMGGKGGE-YTVTS--DNPVNPTPGTLRYGATREKALWIIFSQNMNIK
Sequence 2 SLTMGGKGGEIYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           L-MPLYVAG-KTIDGRGADVHLGNGGPCLFMR--SHVILHGLHIHGCNTS
Sequence 2 LQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASHVILHGLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           LGSTGITISNNHFFNHHKVMLLGHDDTYD-D-SMKVTVAFNQFGPNAGQR
Sequence 2 LGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYD-WNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sequence 2 MPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGCESTSACANWVWR-TRDAFTNGAYFVSSGK-EETNIYNSNEAFKV
Sequence 2 TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGNAAPQLT-NAGVVT
Sequence 2 ENGNAAPQLTQNAGVVT



Alignment 8
Sequence 1:
Sequence 2: Allergen Cup s 1.0103, Sequence: AAF72627
Sequence identity: 95.37 (350/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           M-SPCL-AVLVFLCAIVSCYSDNPIDSCWRGDSNW-QNRMKLADC-VGFG
Sequence 2 MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG--YTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
Sequence 2 SSTMGGKGGDIYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIH-CNTS
Sequence 2 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHSCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSL-DCSDGLIDVT
Sequence 2 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLPDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           L-STGITISNNHFFNHHKVMLLGHDDTYD-DKSMKVTVAFNQFGPNAGQR
Sequence 2 LSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYD-WNIYAIGGSSNPTILSEGNSFTAP-E-YKKEV
Sequence 2 MPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGCESTSACANWVWRSTRDAF-NGAYFVSSGK-EETNIYNSNEAFKV
Sequence 2 TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGN-APQLTKNAGVV-
Sequence 2 ENGNLAPQLTKNAGVVA



Alignment 9
Sequence 1:
Sequence 2: Allergen Cup s 1.0104, Sequence: AAF72628
Sequence identity: 95.10 (349/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           M-SPCL-AVLVFLCAIVSCYSDNPIDSCWRGDSNW-QNRMKLADC-VGFG
Sequence 2 MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG--YTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
Sequence 2 SSTMGGKGGDIYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
Sequence 2 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLG-VLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGNVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           L-STGITISNNHFFNHHKVMLLGHDDTYD-DKSMKVTVAFNQFGPNAGQR
Sequence 2 LSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYD-WNIYAIGGSSNPTILSEGNSF-AP-E-YKKEV
Sequence 2 MPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGC-STSACANWVWRSTRDAF-NGAYFVSSGK-EETNIYNSNEAFKV
Sequence 2 TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGN-APQLTKNAGVV-
Sequence 2 ENGNLAPQLTKNAGVVA



Alignment 10
Sequence 1:
Sequence 2: Allergen Cup s 1.0105, Sequence: AAF72629
Sequence identity: 94.82 (348/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           M-SPCL-AVLVFLCAIVSCYSDNPIDSCWRGDSNW-QNRMKLADC-VGFG
Sequence 2 MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG--YTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
Sequence 2 SSTMGGKGGDIYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
Sequence 2 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLG-VLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGNVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           L-STGITISNNHFFNHHKVMLLGHDDTYD-DKSMKVTVAFNQFGPNAGQR
Sequence 2 LSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYD-WNIYAIGGSSNPTILSEGNSF-AP-E-YKKEV
Sequence 2 MPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGC-STSACANWVWRSTRDAF-NGAYFVSSGK-EETNIY-SNEAFKV
Sequence 2 TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYTSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGN-APQLTKNAGVV-
Sequence 2 ENGNLAPQLTKNAGVVA



Alignment 11
Sequence 1:
Sequence 2: Allergen Cup a 1, Sequence: Q9SCG9
Sequence identity: 90.19 (331/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           ---------------------DNPIDSCWRGDSNW-QNRMKLADCVVGFG
Sequence 2 ---------------------DNPIDSCWRGDSNWDQNRMKLADCVVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGGE-YTVTS-EDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
Sequence 2 SSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           L-MPLYVAG-KTIDGRGA-VHLGNGGPCLFMRK-SHVILHGLHIHGCNTS
Sequence 2 LQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHGLHIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
Sequence 2 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           LGSTGITISNNHFFNHHKVMLLGHDDTYD-DKSMKVTVAFNQFGPNAGQR
Sequence 2 LGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYD-WNIYAIGGSSNPTILSEGNSFTAP-ESYKKEV
Sequence 2 MPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           TKRIGCE-TSACANWVWRSTRDAFTNGAYFVSSGK-E-TNIYNSNEAFKV
Sequence 2 TKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT
           ENGNAAPQLT-NAGVV-
Sequence 2 ENGNAAPQLTQNAGVVA



Alignment 12
Sequence 1:
Sequence 2: Allergen Cha o 1, Sequence: Q96385
Sequence identity: 84.47 (310/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           MAS--L-AVLVFLCAIVSC-SDNPIDSCWRGD-NW-QNRMKLADC-VGFG
Sequence 2 MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SS-MGGKGG-FYTVTS--D-PVNP-PGTLRYGATRE--LWIIFS-N-NIK
Sequence 2 SSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           L-MPLY-AG-KTIDGRGA-VH-GNGGPCLFMR-VSHVILHGL-IHGCNTS
Sequence 2 LNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           V-G-VL-SE--GV-PVHAQDGDAITMRNVT--WIDHNSLSD-SDGL-DVT
Sequence 2 VSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           L-STG-TISNNHFFNHHKVMLLGH-D-Y--DKSMKVTVAFNQFGPNAGQR
Sequence 2 LASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGL-HVANNNYDPW-IYAIGGSSNPTILSEGNSFTAP--S-KKEV
Sequence 2 MPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           T-R-GCES-S-CANWVWRST-D-F-NGAYFVSSGK-E-TNIYN-NEAFKV
Sequence 2 TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKV

Sequence 1 ENGNAAPQLTKNAGVVT--------
           ENG-AAPQLTKNAGV-T--------
Sequence 2 ENGSAAPQLTKNAGVLTCILSKPCS



Alignment 13
Sequence 1:
Sequence 2: Allergen Cry j 1.0101, Sequence: P18632
Sequence identity: 77.93 (286/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           M-SPCL-A-LV----I-SC-SDNPIDSCWRGDSNW-QNRMKLADC-VGFG
Sequence 2 MDSPCLVALLVLSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG--YTVT---D-PVNP-PGTLRYGATR---LWIIFS-NMNIK
Sequence 2 SSTMGGKGGDLYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMP-Y-AG-KT-DGRGA-V--GNGGPC-F---VS-VI-HGLH--GC-TS
Sequence 2 LKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHGLHLYGCSTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLG-VL--ES-GVEPVH-QDGDA-T-R--TN-WIDHNS-S--SDGL-DVT
Sequence 2 VLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           L-STG-TISNN-FFNHHKVMLLGHDD-Y--DKSMKVTVAFNQFGPN-GQR
Sequence 2 LSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYDPW-IYAIGGSSNPTILSEGNSFTAP-ESYKK-V
Sequence 2 MPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           T-RIGC---S-C-NWVW-ST-D-F-NGAYFVSSGK-E--NIY---EAF-V
Sequence 2 TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNV

Sequence 1 ENGNAAPQLTKNAGVVT-------
           ENGNA-PQLTKNAGV-T-------
Sequence 2 ENGNATPQLTKNAGVLTCSLSKRC



Alignment 14
Sequence 1:
Sequence 2: Allergen Cry j 1.0103, Sequence: BAB86287
Sequence identity: 77.93 (286/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           M-SPCL-A-LVF---I-SC-SDNPIDSCWRGDSNW-QNRMKLADC-VGFG
Sequence 2 MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG--YTVT---D-PVNP-PGTLRYGATR---LWIIFS-NMNIK
Sequence 2 SSTMGGKGGDLYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMP-Y-AG-KT-DGRGA-V--GNGGPC-F---VS-VI-HGL---GC-TS
Sequence 2 LKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHGLYLYGCSTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLG-VL--ES-GVEPVH-QDGDA-T-R--TN-WIDHNS-S--SDGL-DVT
Sequence 2 VLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           L-STG-TISNN-FFNHHKVMLLGHDD-Y--DKSMKVTVAFNQFGPN-GQR
Sequence 2 LTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYDPW-IYAIGGSSNPTILSEGNSFTAP-ESYKK-V
Sequence 2 MPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           T-RIGC---S-C-NWVW-ST-D-F-NGAYFVSSGK-E--NIY---EAF-V
Sequence 2 TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNV

Sequence 1 ENGNAAPQLTKNAGVVT-------
           ENGNA-PQLTKNAGV-T-------
Sequence 2 ENGNATPQLTKNAGVLTCSLSKRC



Alignment 15
Sequence 1:
Sequence 2: Allergen Cry j 1.0102, Sequence: BAA05543
Sequence identity: 77.11 (283/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           M-SPCL-A-LVF---I-SC-SDNPIDSCWRGDSNW-QNRMKLADC-VGFG
Sequence 2 MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFG

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           SSTMGGKGG--YTVT---D-PVNP-PGTLRYGATR---LWIIFS-NMNIK
Sequence 2 SSTMGGKGGDLYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIK

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           LKMP-Y-AG-KT-DGRGA-V--GNGGPC-F---VS-VI-HGL---GC-TS
Sequence 2 LKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHGLYLYGCSTS

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT
           VLG-VL--ES-GVEPVH-QDGDA-T-R--TN-WIDHNS-S--SDGL-DVT
Sequence 2 VLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVT

Sequence 1 LGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQR
           L-STG-TISNN-FFNHHKVM-LGHDD-Y--DKSMKVTVAFNQFGPN-GQR
Sequence 2 LTSTGVTISNNLFFNHHKVMSLGHDDAYSDDKSMKVTVAFNQFGPNCGQR

Sequence 1 MPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
           MPRARYGLVHVANNNYDPW-IYAIGGSSNPTILSEGNSFTAP-ESYKK-V
Sequence 2 MPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV

Sequence 1 TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKV
           T-RIGC---S-C-NWVW-ST-D-F-NGAYFVSSGK-E--NIY---EAF-V
Sequence 2 TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNV

Sequence 1 ENGNAAPQLTKNAGVVT-------
           ENGNA-P-LT-NAGV-T-------
Sequence 2 ENGNATPHLTQNAGVLTCSLSKRC



Alignment 16
Sequence 1:
Sequence 2: Allergen Art v 6.0101, Sequence: AY904433
Sequence identity: 44.96 (165/367)
Sequence 1 -------------------------MASPCLRAVLVFLCAIVSCYSDNPI
           -------------------------------------------C---N-I
Sequence 2 MEKHYFVILFTAAFVFVGAAARADIGDELEAAQFNSTRRGLHECAAHNII

Sequence 1 DSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGEFYTVTS-AEDNPVNP
           D-CWR----W--NR--LA-C--GF---T-GG-GGE-Y-VT----DN--NP
Sequence 2 DKCWRCKADWEKNRQALAKCAQGFAKGTTGGLGGEIYVVTDCSDDNAANP

Sequence 1 TPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGN
           -PGTLR-G-T--K-LWIIF---M-IKLK--L-----KTIDGRGA-V----
Sequence 2 KPGTLRCGVTQDKPLWIIFKKDMVIKLKHELVINKDKTIDGRGANVEITC

Sequence 1 GGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEP--VHAQDGD
           GG--L----V--VI-H--HIH-------G-----------P---H--DGD
Sequence 2 GG--LTIHNVCNVIIHNIHIHDIKVTEGGIIKATDA---KPGHRHKSDGD

Sequence 1 AITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLL
           -I--------WIDH--LS---DGLIDVTLGST--TISN--F--H-K--LL
Sequence 2 GICVAGSSKIWIDHCTLSHGPDGLIDVTLGSTAVTISNCKFSHHQKILLL

Sequence 1 GHDDTYDNDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIY
           G-D-----DK-M-VTVAFN-F-----QRMPR-R-G---V-NN-Y--W--Y
Sequence 2 GADNSHVDDKKMHVTVAFNRFAEACDQRMPRCRFGFFQVVNNDYTSWGTY

Sequence 1 AIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRSTRD
           AIGGS-NPTILS-GN-F-AP----KK-V--R-----T-----W-WRS--D
Sequence 2 AIGGSANPTILSQGNRFHAPNDPMKKNVLVRADAPHTES-MKWNWRSEKD

Sequence 1 AFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVT-----
           ---NGA-FV-SG----------------E-G-A--QLT--AG--------
Sequence 2 LLENGAIFVASGCDPHLTPEQKSHLIPAEPGSAVLQLTSCAGTLKCVPGK

Sequence 1 --
           --
Sequence 2 PC



Alignment 17
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: P27761
Sequence identity: 46.05 (169/367)
Sequence 1 --------------------------MASPCLRAVLVFLCAIVSCYSDNP
           --------------------------------------------C---N-
Sequence 2 MGIKQCCYILYFTLALVALLQPVRSAEGVGEILPSVNETRSLQACEALNI

Sequence 1 IDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGEFYTVTSAEDNPV-N
           ID-CWRG---W--NR--LADC--GF---T-GGK-G--YTVTS--D--V-N
Sequence 2 IDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVAN

Sequence 1 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG
           P--GTLR--A-----LWIIF---M-I-L---L-V---KTIDGRG--V---
Sequence 2 PKEGTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEII

Sequence 1 NGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPV--HAQDG
           NGG--L----V---I-H---IH-----VL---------G--P----A-DG
Sequence 2 NGG--LTLMNVKNIIIHNINIH--DVKVLPGGMIKSNDG-PPILRQASDG

Sequence 1 DAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVML
           D-I--------WIDH-SLS---DGL-DVTLGST--TISN--F----K--L
Sequence 2 DTINVAGSSQIWIDHCSLSKSFDGLVDVTLGSTHVTISNCKFTQQSKAIL

Sequence 1 LGHDDTYDNDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNI
           LG-DDT---DK-M--TVAFN-F--N--QRMPR-R-G---V-NNNYD-W--
Sequence 2 LGADDTHVQDKGMLATVAFNMFTDNVDQRMPRCRFGFFQVVNNNYDRWGT

Sequence 1 YAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRSTR
           YAIGGSS-PTIL--GN-F-AP----KK-V--R-G-------A-W-WRS--
Sequence 2 YAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA-WNWRSDK

Sequence 1 DAFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVT----
           D---NGA-FV-SG---------S------E-G-AA--LT--AGV------
Sequence 2 DLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFSCHPG

Sequence 1 ---
           ---
Sequence 2 APC



Alignment 18
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: AAA32669
Sequence identity: 46.05 (169/367)
Sequence 1 --------------------------MASPCLRAVLVFLCAIVSCYSDNP
           --------------------------------------------C---N-
Sequence 2 MGIKQCCYILYFTLALVALLQPVRSAEGVGEILPSVNETRSLQACEALNI

Sequence 1 IDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGEFYTVTSAEDNPV-N
           ID-CWRG---W--NR--LADC--GF---T-GGK-G--YTVTS--D--V-N
Sequence 2 IDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVAN

Sequence 1 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG
           P--GTLR--A-----LWIIF---M-I-L---L-V---KTIDGRG--V---
Sequence 2 PKEGTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEII

Sequence 1 NGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPV--HAQDG
           NGG--L----V---I-H---IH-----VL---------G--P----A-DG
Sequence 2 NGG--LTLMNVKNIIIHNINIH--DVKVLPGGMIKSNDG-PPILRQASDG

Sequence 1 DAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVML
           D-I--------WIDH-SLS---DGL-DVTLGST--TISN--F----K--L
Sequence 2 DTINVAGSSQIWIDHCSLSKSFDGLVDVTLGSTHVTISNCKFTQQSKAIL

Sequence 1 LGHDDTYDNDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNI
           LG-DDT---DK-M--TVAFN-F--N--QRMPR-R-G---V-NNNYD-W--
Sequence 2 LGADDTHVQDKGMLATVAFNMFTDNVDQRMPRCRFGFFQVVNNNYDRWGT

Sequence 1 YAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRSTR
           YAIGGSS-PTIL--GN-F-AP----KK-V--R-G-------A-W-WRS--
Sequence 2 YAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA-WNWRSDK

Sequence 1 DAFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVT----
           D---NGA-FV-SG---------S------E-G-AA--LT--AGV------
Sequence 2 DLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFSCRPG

Sequence 1 ---
           ---
Sequence 2 APC



Alignment 19
Sequence 1:
Sequence 2: Allergen Amb a 2, Sequence: P27762
Sequence identity: 45.23 (166/367)
Sequence 1 --------------------------MASPCLRAVLVFLCAIVSCYSDNP
           -------------------------------L------------C---N-
Sequence 2 MGIKHCCYILYFTLALVTLVQAGRLGEEVDILPSPNDTRRSLQGCEAHNI

Sequence 1 IDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGEFYTVTSAEDNPV-N
           ID-CWR----W--NR--L--C--GFG--T-GGK-G--Y-VTS--D--V-N
Sequence 2 IDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVN

Sequence 1 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG
           P--GTLR-GAT----LWIIF---M-I-L-----V---KTIDGRGA-V-L-
Sequence 2 PKEGTLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELV

Sequence 1 NGGPCLFMRKVSHVILHGLHIHGCNTSVL-GDVLVSESIGVEPVHAQDGD
           -GG--L----V--VI-H---IH-----VL-G----S------P-H--DGD
Sequence 2 YGGITLM--NVKNVIIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGD

Sequence 1 AITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLL
           AI--------WIDH--LS---DGL-DV--GSTG-TISN--F--H-K--LL
Sequence 2 AIHVTGSSDIWIDHCTLSKSFDGLVDVNWGSTGVTISNCKFTHHEKAVLL

Sequence 1 GHDDTYDNDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIY
           G--DT---D--M-VT-A-N-F------RMPR-R-G-----NN-YD-W--Y
Sequence 2 GASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQIVNNFYDRWDKY

Sequence 1 AIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRSTRD
           AIGGSSNPTILS-GN-F-AP---YKK-V--R-G---------W-WR---D
Sequence 2 AIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQND

Sequence 1 AFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVT-----
           ---NGA-FV-SG----------------E-G---PQLT-NAGV-T-----
Sequence 2 VLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGA

Sequence 1 --
           --
Sequence 2 PC



Alignment 20
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: P27760
Sequence identity: 44.69 (164/367)
Sequence 1 ---------------------------MASPCLRAVLVFLCAIVSCYSDN
           --------------------------------L------------C---N
Sequence 2 MGIKHCCYILYFTLALVTLLQPVRSAEDVEEFLPSANETRRSLKACEAHN

Sequence 1 PIDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGEFYTVTSAEDNPV-
           -ID-CWR----W--NR--LADC--GF---T-GGK-G--YTVTS--D--V-
Sequence 2 IIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVA

Sequence 1 NPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHL
           NP--GTLR--A-----LWIIF--NM-I-L---L-V---KTIDGRG--V--
Sequence 2 NPKEGTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNI

Sequence 1 GNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQ--D
           -N-G--L----V---I-H---IH-------G--------G--P---Q--D
Sequence 2 VNAG--LTLMNVKNIIIHNINIHDIKVCPGG--MIKSNDG-PPILRQQSD

Sequence 1 GDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVM
           GDAI--------WIDH-SLS--SDGL-D-TLGS---T-SN--F--H--V-
Sequence 2 GDAINVAGSSQIWIDHCSLSKASDGLLDITLGSSHVTVSNCKFTQHQFVL

Sequence 1 LLGHDDTYDNDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWN
           LLG-DDT---DK-M--TVAFN-F-----QRMPR-R-G---V-NNNYD-W-
Sequence 2 LLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRCRFGFFQVVNNNYDRWG

Sequence 1 IYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRST
           -YAIGGSS-PTILS-GN-F-AP----KK-V--R-G---------W-WR--
Sequence 2 TYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGT-GNAESMSWNWRTD

Sequence 1 RDAFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVT---
           RD---NGA-F--SG----------------E-G-A---LT--AGV-----
Sequence 2 RDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLSCHQ

Sequence 1 ----
           ----
Sequence 2 GAPC



Alignment 21
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: P27759
Sequence identity: 43.32 (159/367)
Sequence 1 -------------------------MASPCLRAVLVFLCAIVSCYSDNPI
           -----------------------------------------------N-I
Sequence 2 MGIKHCCYILYFTLALVTLLQPVRSAEDLQEILPVNETRRLTTSGAYNII

Sequence 1 DSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGEFYTVTSAEDNPV-NP
           D-CWRG---W--NR--LADC--GFG--T-GGK-G--YTVTS--D--V-NP
Sequence 2 DGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANP

Sequence 1 TPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGN
           --GTLR-GA-----LWIIF---M-I-L-----V---KTIDGRGA-V---N
Sequence 2 KEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIIN

Sequence 1 GGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAI
           -G-------V--VI-H----H-------G----S------P----DGDAI
Sequence 2 AG--FTLNGVKNVIIHNINMHDVKVNP-GGLIKSNDGPAAPRAGSDGDAI

Sequence 1 TMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGH
           --------WIDH-SLS---DGL-D--LG-T--T-SN--F--H--V-L-G-
Sequence 2 SISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGA

Sequence 1 DDTYDNDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAI
           -D----D--M--TVAFN-F--N--QRMPR-R-G---V-NNNYD-W--YAI
Sequence 2 GDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAI

Sequence 1 GGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRSTRDAF
           GGS--PTILS-GN-F-AP-E--KK-V--R-G-E-------W-WR---D--
Sequence 2 GGSASPTILSQGNRFCAPDERSKKNVLGRHG-EAAAESMKWNWRTNKDVL

Sequence 1 TNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVT-------
           -NGA-FV-SG---------S------E-G--A--LT--AGV---------
Sequence 2 ENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC



Alignment 22
Sequence 1:
Sequence 2: Allergen Amb a 1, Sequence: P28744
Sequence identity: 42.78 (157/367)
Sequence 1 --------------------------MASPCLRAVLVFLCAIVSCYSDNP
           --------------------------------------------C---N-
Sequence 2 MGIKHCCYILYFTLALVTLLQPVRSAEDLQQILPSANETRSLTTCGTYNI

Sequence 1 IDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGEFYTVTSAEDNPV-N
           ID-CWRG---W--NR--LADC--GF---T-GGK-G--YTVTS--D--V-N
Sequence 2 IDGCWRGKADWAENRKALADCAQGFAKGTIGGKDGDIYTVTSELDDDVAN

Sequence 1 PTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLG
           P--GTLR-GA-----LWIIF---M-I-L---L-----KTIDGRGA-V---
Sequence 2 PKEGTLRFGAAQNRPLWIIFARDMVIRLDRELAINNDKTIDGRGAKVEII

Sequence 1 NGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDA
           N-G-------V---I-H----H-------G---------V-P----DGDA
Sequence 2 NAGFAIY--NVKNIIIHNIIMHDIVVNPGGLIKSHDGPPV-PRKGSDGDA

Sequence 1 ITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLG
           I--------WIDH-SLS---DGLID---GST--T-SN---F--H---LL-
Sequence 2 IGISGGSQIWIDHCSLSKAVDGLIDAKHGSTHFTVSNC-LFTQHQYLLLF

Sequence 1 HDDTYDNDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIYA
           -D---D----M--TVAFN-F--N--QRMP--R-G-V-V-NNNY--W--YA
Sequence 2 WD--FD-ERGMLCTVAFNKFTDNVDQRMPNLRHGFVQVVNNNYERWGSYA

Sequence 1 IGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRSTRDA
           -GGS--PTILS-GN-F-A-----KKEV--R-G----S---NW-WRS--D-
Sequence 2 LGGSAGPTILSQGNRFLASD--IKKEVVGRYGESAMSESINWNWRSYMDV

Sequence 1 FTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVT------
           F-NGA-FV-SG----------------E-G-A---LT--AGV--------
Sequence 2 FENGAIFVPSGVDPVLTPEQNAGMIPAEPGEAVLRLTSSAGVLSCQPGAP

Sequence 1 -
           -
Sequence 2 C



Alignment 23
Sequence 1:
Sequence 2: Allergen Pen c 32.0101, Sequence: ABM60783
Sequence identity: 19.89 (73/367)
Sequence 1 MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SSTMGGKGGEFYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIK
           ----------------------N--------G-T--------F-------
Sequence 2 -----------VGDVATGYASENGGTTGGSGGTTTTVSSYAAFTEAVSGD

Sequence 1 LKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTS
           ------V-G--------A-V----G-------K-S--IL-G----G----
Sequence 2 DAKVVFVSGKISKTADQARV----GSNTSIIGKDSNAILSGF---GVLVK

Sequence 1 VLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLS-------DCS
           ----V------GVE-V-A--GDAI------N-W-DH---S-------D--
Sequence 2 EASNVII-RNLGVEKVLADNGDAIGIQKSNNVWVDHCDVSSDRDHDKDYY

Sequence 1 DGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTY-DNDKS-MKVTVAFN
           DGLID-T------T-SN-----H-K--L-GH-D---D-DK----VT---N
Sequence 2 DGLIDITHAADYVTVSNTSIHDHWKACLIGHSDSNGDEDKGHLHVTLN-N

Sequence 1 QFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTA
           ----N---R-P--R-G--HV-N--Y-------I--------L-E-N-F--
Sequence 2 NYWYNINSRGPSFRFGTGHVYNSYYLDMS-DGINTRQGAQHLVESNTFSG

Sequence 1 PSES-YKKEVTKRIGCEST-SACANWVWRSTRDAFTNGAYFVSSGKIEET
           -----Y------------------N-----T----------V-SGK----
Sequence 2 SKKPLYSTDDGYAVANDNDFGDGENNAEKGTLTSVPYSYDLVGSGKVKDA

Sequence 1 NIYNSNEAFKVENGNAAPQLTKNAGVVT
           ----------------------------
Sequence 2 VVGTAGQTLTF-----------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.