The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Lyc e 3

Sequence 1816535

Full FASTA alignment

Sequence name:
Query sequence:
MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGC
CGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNI
PYKISPSTDCSTVQ

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Lyc e 3AAB42069Go!114165.42.7e-43
2Len c 3.0101A0AT29Go!11899.12.5e-23
3Ara h 9.0101ABX56711Go!11694.55.9e-22
4Hev b 12AAL25839Go!11694.17.8e-22
5Pru av 3Q9M5X8Go!11792.23.1e-21
6Pla or 3.0101ABY21307Go!11892.23.1e-21
7Pla a 3.0101CAL07989Go!11891.45.4e-21
8Api g 2ACV04796Go!11891.26.2e-21
9Pha v 3.0101ADC80502Go!11589.61.8e-20
10Mal d 3Q9M5X7Go!11588.05.5e-20
11Ara h 9.0201ABX75045Go!9287.65.8e-20
12Fra a 3.0101Q8VX12Go!11786.61.4e-19
13Fra a 3.0202Q4PLT6Go!11786.41.7e-19
14Rub i 3.0101Q0Z8V0Go!11786.21.9e-19
15Pha v 3.0201ADC80503Go!11886.21.9e-19
16Cor a 8AAK28533Go!11585.82.5e-19
17Mor n 3.0101P85894Go!9184.45.2e-19
18Fra a 3.0102Q4PLT9Go!11784.46.6e-19
19Fra a 3.0201Q4PLU0Go!11784.37.5e-19
20Pyr c 3Q9M5X6Go!11583.89.8e-19
21Pru du 3.0101ACN11576Go!12383.31.5e-18
22Art v 3.0202ACE07187Go!11683.11.7e-18
23Zea m 14.0101P19656-1Go!12082.33.0e-18
24Zea m 14.0102P19656-2Go!12881.65.3e-18
25Art v 3.0201EU564845Go!11481.16.7e-18
26Art v 3.0301EU564847Go!11778.93.1e-17
27Pru ar 3P81651Go!9177.56.4e-17
28Pru p 3CAB96876Go!9176.99.6e-17
29Pru p 3P81402Go!9176.99.6e-17
30Pru d 3P82534Go!9176.31.5e-16
31Hor v 1AAA32970Go!11774.18.3e-16
32Sin a 3.0101ABU95411Go!9273.31.1e-15
33Hor v 1CAA42832Go!13473.71.3e-15
34Hel a 3.0101P82007Go!11670.41.1e-14
35Tri a 14.010119846220Go!9067.28.0e-14
36Par j 1Q40905Go!13854.77.0e-10
37Par j 1O04404Go!17654.31.2e-09
38Par j 1P43217Go!13953.12.1e-09
39Par j 1.0103CAI94601Go!13952.33.6e-09
40Par j 2O04403Go!13350.71.1e-08
41Par j 2P55958Go!13349.72.1e-08
42Par j 1.0101CAA54587Go!13348.74.3e-08
43Amb a 6O04004Go!11846.61.6e-07
44Art v 3.0101P0C088Go!3730.73.2e-03
45Cas s 810998016Go!3630.53.6e-03
46Vit v 1P80274Go!3729.57.2e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 100.00 (114/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGC
           MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGC
Sequence 2 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGC

Sequence 1 CGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNI
           CGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNI
Sequence 2 CGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNI

Sequence 1 PYKISPSTDCSTVQ
           PYKISPSTDCSTVQ
Sequence 2 PYKISPSTDCSTVQ



Alignment 2
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 63.16 (72/114)
Sequence 1 MEMFGKIACFV-VFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPL
           M----K-AC-V-V-CMVV-AP-AE---SCG-VTS-L-PCL-YL-G--GP-
Sequence 2 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CCGGVK-LL-AA-T--DR--AC-CLKSAA-SI----T--AA-LPG-CG
Sequence 2 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ-
           VNIPYKIS--T-C-TV--
Sequence 2 VNIPYKISTTTNCNTVKF



Alignment 3
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 52.63 (60/114)
Sequence 1 MEMFGKIACFVVFCMVVV-APHAESLSCGEVTSGLAPCLPYL-EGRGPLG
           -----K-A-----CM--V-AP-----SCG-V-S-LAPC-P-L--G--P--
Sequence 2 -MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPP

Sequence 1 GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV
           -CC-GV-GLLGA--T--DR--AC-CLK-AA-S--G---G-AA-LPG-CGV
Sequence 2 ACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGV

Sequence 1 NIPYKISPSTDCSTVQ-
           -IPYKIS-ST-C-T---
Sequence 2 SIPYKISTSTNCATIKF



Alignment 4
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 55.26 (63/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL--
           -----K---F-V-CM-V-AP--A----CG-V-S-L-PCL-YL---GP---
Sequence 2 -MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPP

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-GV-----AAKT--DR-TAC-CLKSAA-S-KG------AGLPG-CG
Sequence 2 ATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           VNIPYKIS-ST-C-TV-
Sequence 2 VNIPYKISLSTNCATVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 50.00 (57/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG
           -------K-A--V--CMVV--P-A--L-CG-V-S-LAPC--Y--G-G---
Sequence 2 MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVP

Sequence 1 -GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-G-------AKT--DR-TAC-CLK----S--G-----AA-LPG-CG
Sequence 2 PACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           VN-PYKISPST-C-TV-
Sequence 2 VNVPYKISPSTNCATVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 53.51 (61/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL
           -------K-AC----CMV--APHAE----CG-V---L-PCL-YL---G--
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 G-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVC
           ---CC-GVK-L---AKT--DR--AC-CLK-A--SI-GI--G-AA-L-G-C
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNIPYKISPSTDCSTVQ
           GVN-PYKISP--DCS-V-
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 52.63 (60/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL
           -------K-AC----CMV--APHAE----CG-V---L-PCL--L---G--
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 G-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVC
           ---CC-GVK-L---AKT--DR--AC-CLK-A--SI-GI--G-AA-L-G-C
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNIPYKISPSTDCSTVQ
           GVN-PYKISP--DCS-V-
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 58.77 (67/114)
Sequence 1 MEMFGKIACFV-VFCMVVVAPH---AESLSCGEVTSGLAPCLPYLEGRG-
           -----K-A--V-V--MVVV--H----E-L-CG-VT--L--CL-YL-G-G-
Sequence 2 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY

Sequence 1 PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGV
           P---CCGGVKGL---AKTP-DRK-AC-CLK--A-S-KGI--G-A--LPG-
Sequence 2 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK

Sequence 1 CGVNIPYKISPSTDCSTVQ
           CG--IPY-ISPSTDCS-V-
Sequence 2 CGIRIPYPISPSTDCSRVN



Alignment 9
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 46.49 (53/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL-G
           -----K-AC-VV-CMVVV--H-A----CG-V-S-L-PC---L---G----
Sequence 2 -MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPA

Sequence 1 GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV
           GCC-GV------A----DR---C-CLK-AA----G-----A--LPG-CGV
Sequence 2 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV

Sequence 1 NIPYKISPSTDCSTVQ
           NIPYKIS-ST-C----
Sequence 2 NIPYKISTSTNCASIN



Alignment 10
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 50.00 (57/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG
           -------K-A--V--CM-V---HA----CG-VTS-LAPC--Y----G---
Sequence 2 MASSAVTKLALVVALCMAVSVAHA--ITCGQVTSSLAPCIGYVRSGGAVP

Sequence 1 -GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-G-----G-A-T--DR-TAC-CLK--A-SI-G-----AAGLPG-CG
Sequence 2 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           VN-PYKIS-ST-C-TV-
Sequence 2 VNVPYKISTSTNCATVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 49.12 (56/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYL-EGRGPLGG
           ------------------------LSCG-V-S-LAPC---L--G--P-G-
Sequence 2 ------------------------LSCGQVNSALAPCITFLTKGGVPSGP

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-GV-GLLGAAKT--DR--AC-CLK-AA-S--G---G-AA-LPG-CGV-
Sequence 2 CCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGVS

Sequence 1 IPYKISPSTDCSTVQ-
           IPYKIS-ST-C-T---
Sequence 2 IPYKISTSTNCATIKF



Alignment 12
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 45.61 (52/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-
           -------K-------C-VV--P-A----CG-V-S---PCL-Y----G---
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-G---L-G-AKT--DR--AC-CLK-AA--IKG-----AAGLPG-CG
Sequence 2 AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           V--PYKIS--T-C--V-
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 45.61 (52/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-
           -------K-------C-VV--P-A----CG-V-S---PC--Y----G---
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-G---L--AAKT--DR-T-C-CLK-A---IKG-----AAGLPG-CG
Sequence 2 AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           VN-PYKIS-ST-C--V-
Sequence 2 VNVPYKISTSTNCAAVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 47.37 (54/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-
           -------K-A-----C-VV--P-A----CG-VT---APC--Y----G---
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-GV--L---AKT--DR---C-CLK-AA-SI-G-----AAGLPG-CG
Sequence 2 AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           V--PYKIS-ST-C-TV-
Sequence 2 VSVPYKISTSTNCATVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 52.63 (60/114)
Sequence 1 MEMFGKIACFV-VFCMVVV-APHAES-LSCGEVTSGLAPCLPYLEGRGPL
           -------AC-V-V-C-VV--AP-A----SCG-VTS-LA-C-P-L---GP-
Sequence 2 -MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPV

Sequence 1 -GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVC
           ---CC-GV--L--AAKT--DR---C-CLKSAA--I-G-----A--LPG-C
Sequence 2 PASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKC

Sequence 1 GVNIPYKISPSTDCSTVQ-
           GV-IPYKIS-ST-C-T---
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 16
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 49.12 (56/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGRGPLG-
           -----K--C-V--CM-V-AP-A--SL-C------L-PC--YL---G-L--
Sequence 2 -MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPP

Sequence 1 GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV
           -CC-GV-----A--T--DR--AC-CLK--A--I-G-----AAGLPG-CGV
Sequence 2 SCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGV

Sequence 1 NIPYKISPSTDCSTVQ
           NIPYKISPST-C--V-
Sequence 2 NIPYKISPSTNCNNVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 47.37 (54/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GG
           --------------------------CG-V-S-LAPC--YL---G-----
Sequence 2 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-GV--L--AAKT--DR--AC-CLKSA-NSIKG-----AAGLPG-CGV-
Sequence 2 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS

Sequence 1 IPYKISPSTDCSTVQ
           -PYKISPSTDC--V-
Sequence 2 VPYKISPSTDCKSVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 43.86 (50/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG
           -------K-------C-VV--P-A----CG-V-S---PC--Y----G---
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP

Sequence 1 G-CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-G---L-G-AKT--DR---C-CLK-AA--IKG-----AAGLPG-CG
Sequence 2 APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           V--PYKIS--T-C--V-
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 43.86 (50/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-
           -------K-------C-VV--P-A----CG-V-S---PC--Y----G---
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-G---L--AAKT--DR---C-CLK-A---IKG-----AAGLPG-CG
Sequence 2 AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           V--PYKIS-ST-C--V-
Sequence 2 VSVPYKISTSTNCAAVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 46.49 (53/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG
           -------K-A--V--CM-V---HA----C--V---LAPC--Y----G---
Sequence 2 MASSAVIKLALVVALCMAVSVAHA--ITCSQVSANLAPCINYVRSGGAVP

Sequence 1 -GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-G-K---G-AKT--DR--AC-CLK--A-S--G---G-A--LPG-CG
Sequence 2 PACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           VN-PYKIS-ST-C-TV-
Sequence 2 VNVPYKISTSTNCATVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 50.00 (57/114)
Sequence 1 ---MEMFGKIACF--VVFCMVVVAPHA-ESLSCGEVTSGLAPCLPYLEGR
           --------K--C---V--CM-V--P-A----SCG-V---L-PC--Y----
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GPLG-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSI--KGIDTGKAAG
           G-L---CC-GV--L---A-T--DR---C-CLK-A-N-I-------G-AAG
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 LPGVCGVNIPYKISPSTDCSTVQ
           LPG-CGVNIPYKISPSTDC-T--
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK



Alignment 22
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 50.88 (58/114)
Sequence 1 --MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-
           --M-M--K--C--V-CMV-----AE-L-C--V-----PCL-YL---G---
Sequence 2 MAMKMM-KFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-GVKGL--AAKT--DR-TAC-CLK----S-K------AA-LP--CG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           VNIPYKIS--TDC--V-
Sequence 2 VNIPYKISLETDCNKVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 44.74 (51/114)
Sequence 1 ----MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG-
           --------------V-------A------SCG-V-S--APC--Y--G-G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 -PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPG
           -P--GCC-GV--L--AA-T--DR--AC-CLK-AA----G---G-AA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 VCGVNIPYKISPSTDCSTVQ
           -CGV-IPY-IS-STDCS-V-
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 24
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 43.86 (50/114)
Sequence 1 ----MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGR--
           --------------V-------A------SCG-V-S--APC--Y--G---
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPG
           GP--GCC-GV--L--AA-T--DR--AC-CLK-AA----G---G-AA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 VCGVNIPYKISPSTDCSTVQ--------
           -CGV-IPY-IS-STDCS-----------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 25
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 50.88 (58/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GG
           M-M--K--C--V-CMVV----AE-L-C--V------CL-YL---G-----
Sequence 2 MKMM-KFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPAD

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-GVKGL--AAKT--DR-TAC-CLK----S-K------AA-LP--CGVN
Sequence 2 CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVN

Sequence 1 IPYKISPSTDCSTVQ
           IPYKIS--TDC--V-
Sequence 2 IPYKISLETDCNKVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 46.49 (53/114)
Sequence 1 -MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL-
           ------K--C--V-CMVV----AES-L-C--V-----PCL-YL---G---
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-GVKGL--A-KT--DR-TAC-CLK----S-K------A--LP--CG
Sequence 2 ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCG

Sequence 1 VNIPYKISPSTDCSTVQ
           -N-PYK-S--TDC--V-
Sequence 2 LNLPYKLSLETDCNKVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 41.23 (47/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG-G
           --------------------------CG-V-S-LAPC--Y--G-G-----
Sequence 2 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-G-------A-T--DR-TAC-CLK----SI-G-----AA-LPG-CGVN
Sequence 2 CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVN

Sequence 1 IPYKISPSTDCSTVQ
           IPYKIS-ST-C-TV-
Sequence 2 IPYKISASTNCATVK



Alignment 28
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 39.47 (45/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG-G
           --------------------------CG-V-S-LAPC-PY--G-G-----
Sequence 2 ------------------------ITCGQVSSSLAPCIPYVRGGGAVPPA

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-G-------A-T--DR--AC-CLK----S--G-----AA-LPG-CGV-
Sequence 2 CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVS

Sequence 1 IPYKISPSTDCSTVQ
           IPYKIS-ST-C-TV-
Sequence 2 IPYKISASTNCATVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 39.47 (45/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG-G
           --------------------------CG-V-S-LAPC-PY--G-G-----
Sequence 2 ------------------------ITCGQVSSALAPCIPYVRGGGAVPPA

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-G-------A-T--DR--AC-CLK----S--G-----AA-LPG-CGV-
Sequence 2 CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVH

Sequence 1 IPYKISPSTDCSTVQ
           IPYKIS-ST-C-TV-
Sequence 2 IPYKISASTNCATVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 39.47 (45/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG-G
           --------------------------CG-V-S-LAPC--Y--G-G-----
Sequence 2 ------------------------ITCGQVSSNLAPCINYVKGGGAVPPA

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-G-------A-T--DR--AC-CLK----SI-G-----AA-LPG-CGVN
Sequence 2 CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVN

Sequence 1 IPYKISPSTDCSTVQ
           -PYKIS-ST-C-TV-
Sequence 2 VPYKISASTNCATVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 40.35 (46/114)
Sequence 1 -MEMFGKIACFVVFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPL
           ---------------M---AP-A---L-CG-V-S---PCL-Y--G--GP-
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           G-CC-GV--L---A----DR-T-C-CLK--A--I-------AA--P--C-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNIPYKISPSTDCSTVQ
           VN-PY-ISP--DCS---
Sequence 2 VNVPYTISPDIDCSRIY



Alignment 32
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 42.98 (49/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG-G
           ------------------------LSCG-V-S-LA-C--YL----PL--G
Sequence 2 -----------------------ALSCGTVNSNLAACIGYLTQNAPLPKG

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-GV--L---A-T--DR--AC-CL--AANS--------AA-LP--CGVN
Sequence 2 CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKACGVN

Sequence 1 IPYKISPSTDCSTVQ
           IPYKIS-ST-C--V-
Sequence 2 IPYKISKSTNCNSVR



Alignment 33
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 40.35 (46/114)
Sequence 1 -MEMFGKIACFVVFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPL
           ---------------M---AP-A---L-CG-V-S---PCL-Y--G--GP-
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           G-CC-GV--L---A----DR-T-C-CLK--A--I-------AA--P--C-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNIPYKISPSTDCSTVQ-----------------
           VN-PY-ISP--DCS--------------------
Sequence 2 VNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 34
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 40.35 (46/114)
Sequence 1 ---MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG-P
           -----M---I----V-----V-P------C--VT--L-PCLPYL---G-P
Sequence 2 MKGTSMGVAILAMIVMAQLMVHPSV-AITCNDVTGNLTPCLPYLRSGGKP

Sequence 1 LGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVC
           ---CC-G-K-LLGA--T--DR-TAC-C-K-AA---K------A--LPG-C
Sequence 2 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC

Sequence 1 GVNIPYKISPSTDCSTVQ
           G------I-P---C-T--
Sequence 2 GISTSIPINPNVNCNTIP



Alignment 35
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 36.84 (42/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGR-GPLGG
           --------------------------CG-V-S---PCL-Y--G--GP-G-
Sequence 2 ------------------------IDCGHVDSLVRPCLSYVQGGPGPSGQ

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-GVK-L---A----DR--AC-CLK--A--I-------A---P--CGVN
Sequence 2 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN

Sequence 1 IPYKISPSTDCSTVQ
           -PY-IS---DCS-V-
Sequence 2 LPYTISLNIDCSRV-



Alignment 36
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 32.46 (37/114)
Sequence 1 --------------MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAP
           --------------------------------AP--E---CG-V---L-P
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEE-TCGTVVGALMP

Sequence 1 CLPYLEGR--GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGI
           CLP---G----P--GCC-G-K-L-G--KT---R--AC-C---A------I
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI

Sequence 1 DTGKAAGLPGVCGVNIPYKISP---STDCSTVQ-------
           D-------P--CG-----K--P-----DC-T---------
Sequence 2 DGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTLGVLHYKGN



Alignment 37
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 32.46 (37/114)
Sequence 1 ---------------MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLA
           ---------------------------------AP--E---CG-V---L-
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEE-TCGTVVRALM

Sequence 1 PCLPYLEGR--GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG
           PCLP---G----P--GCC-G-K-L-G--KT---R--AC-C---A------
Sequence 2 PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD

Sequence 1 IDTGKAAGLPGVCGVNIPYKISP---STDCSTVQ----------------
           ID-------P--CG-----K--P-----DC-T------------------
Sequence 2 IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGP

Sequence 1 ----------------------------
           ----------------------------
Sequence 2 VTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 38
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 29.82 (34/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--PLG
           --------------------------CG-----L-PCLP---G----P--
Sequence 2 -----------------------QETCGTMVRALMPCLPFVQGKEKEPSK

Sequence 1 GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV
           GCC-G-K-L-G--KT---R--AC-C---A------ID-------P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 NIPYKISP---STDCSTVQ-------------------------------
           ----K--P-----DC-TV--------------------------------
Sequence 2 -VDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 39
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 28.95 (33/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--PLG
           --------------------------CG-----L-PCLP---G----P--
Sequence 2 -----------------------QETCGTMVRALMPCLPFVQGKEKEPSK

Sequence 1 GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV
           GCC-G-K-L-G--KT---R--AC-C---A------ID-------P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 NIPYKISP---STDCSTVQ-------------------------------
           ----K--P-----DC-T---------------------------------
Sequence 2 -VDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 40
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 29.82 (34/114)
Sequence 1 --------MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLE
           --------------------------AP------CG-V-----PCL----
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 G--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAA
           G----P---CC-G-K-L----KT-E----AC-C---A---I-GI-----A
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 GLPGVCGVN--IPYKISPSTDCSTVQ--------
           --P--CG-----P--I----DCS-----------
Sequence 2 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 41
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 29.82 (34/114)
Sequence 1 --------MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLE
           --------------------------AP------CG-V-----PCL----
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 G--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAA
           G----P---CC-G-K-L----KT-E----AC-C---A---I-GI-----A
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 GLPGVCGVN--IPYKISPSTDCSTVQ--------
           --P--C------P--I----DCS--Q--------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 42
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 28.07 (32/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--PLG
           ---------------------------------L-PCLP---G----P--
Sequence 2 -----------------------------MVRALMPCLPFVQGKEKEPSK

Sequence 1 GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV
           GCC-G-K-L-G--KT---R--AC-C---A------ID-------P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 NIPYKISP---STDCSTVQ-------------------------------
           ----K--P-----DC-TV--------------------------------
Sequence 2 -VDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 43
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 29.82 (34/114)
Sequence 1 ---MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL
           ----------A-------------A-S--C--V---LAPC---L-G--P-
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQEPS

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           --CC-GV--L----KT--DR---C-C-K----SI---D------L---CG
Sequence 2 KACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AYDPKRMPLLSTKCG

Sequence 1 VNIPYK-ISPSTDCSTVQ-
           V-----------DCS----
Sequence 2 VKPDFPAVDKNLDCSKLPV



Alignment 44
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 14.04 (16/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GG
           ------------------------L-C--V-----PCL-YL---G-----
Sequence 2 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD

Sequence 1 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN
           CC-GVKGL------------------------------------------
Sequence 2 CCAGVKGLND----------------------------------------

Sequence 1 IPYKISPSTDCSTVQ
           ---------------
Sequence 2 ---------------



Alignment 45
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 14.91 (17/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG---PL
           -----------------------S--C--V---L-PCL-YL---G---P-
Sequence 2 -----------------------SITCTQVSKSLMPCLTYLKSNGGSPPP

Sequence 1 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG
           G-CC-GVK------------------------------------------
Sequence 2 GTCCQGVKL-----------------------------------------

Sequence 1 VNIPYKISPSTDCSTVQ
           -----------------
Sequence 2 -----------------



Alignment 46
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 12.28 (14/114)
Sequence 1 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--PLG
           --------------------------CG-V-S-L-PC--YL---G--P-G
Sequence 2 -----------------------TVTCGQVASALSPCIDYLQKDGAVPAG

Sequence 1 GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV
           -CC-----------------------------------------------
Sequence 2 SCCXKXLSSA----------------------------------------

Sequence 1 NIPYKISPSTDCSTVQ
           ----------------
Sequence 2 ----------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.