The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Der f 3

Sequence P49275

Full FASTA alignment

Sequence name:
Query sequence:
MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISLQSSSH
FCGGSILDEYWILTAAHCVNGQSAKKLSIRYNTLKHASGGEKIQVAEIYQ
HENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQGSDVKVGDKIRVS
GWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSENMICGGDV
ANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPGVYTRVGNFV
DWIESKRSQ

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Der f 3P49275Go!259371.71.1e-104
2Eur m 3O97370Go!261319.46.3e-89
3Der p 3P39675Go!261308.98.9e-86
4Blo t 3.0101AAM10779Go!266197.33.6e-52
5Tyr p 3.0101ABZ81991Go!285169.59.1e-44
6Der f 6P49276Go!279115.51.6e-27
7Blo t 6.0101AAQ24544Go!275111.33.0e-26
8Der p 9.0101AAP57077Go!273106.77.2e-25
9Der p 9.0102AAN02511Go!261102.99.4e-24
10Can f 5.0101P09582Go!26095.51.5e-21
11Bom p 4.0101Q7M4I3Go!24385.51.5e-18
12Pol d 4.0101AAP37412Go!27782.61.3e-17
13Api m 7AAN02286Go!40570.76.9e-14
14Pol e 4.01013989146Go!24137.34.7e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Der f 3, Sequence: P49275
Sequence identity: 100.00 (259/259)
Sequence 1 MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISLQSSSH
           MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISLQSSSH
Sequence 2 MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISLQSSSH

Sequence 1 FCGGSILDEYWILTAAHCVNGQSAKKLSIRYNTLKHASGGEKIQVAEIYQ
           FCGGSILDEYWILTAAHCVNGQSAKKLSIRYNTLKHASGGEKIQVAEIYQ
Sequence 2 FCGGSILDEYWILTAAHCVNGQSAKKLSIRYNTLKHASGGEKIQVAEIYQ

Sequence 1 HENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQGSDVKVGDKIRVS
           HENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQGSDVKVGDKIRVS
Sequence 2 HENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQGSDVKVGDKIRVS

Sequence 1 GWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSENMICGGDV
           GWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSENMICGGDV
Sequence 2 GWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSENMICGGDV

Sequence 1 ANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPGVYTRVGNFV
           ANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPGVYTRVGNFV
Sequence 2 ANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPGVYTRVGNFV

Sequence 1 DWIESKRSQ
           DWIESKRSQ
Sequence 2 DWIESKRSQ



Alignment 2
Sequence 1:
Sequence 2: Allergen Eur m 3, Sequence: O97370
Sequence identity: 80.69 (209/259)
Sequence 1 --MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISLQSS
           -------IV-LLA-N-LA-PILPSSPNATIVGG-KA-AG-CPYQISLQSS
Sequence 2 MVICNAIIVLLLAFNTLANPILPSSPNATIVGGQKAKAGECPYQISLQSS

Sequence 1 SHFCGGSILDEYWILTAAHCVNGQSAKKLSIRYNTLKHASGGEKIQVAEI
           SHFCGG-ILDEYWILTAAHCVNGQ-A-KLSIRYN-LKHASGGEK--VA-I
Sequence 2 SHFCGGTILDEYWILTAAHCVNGQTASKLSIRYNSLKHASGGEKLSVAQI

Sequence 1 YQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQGSDVKVGDKIR
           YQHE-YDS-TIDND-ALIKL--PMTLDQ-NAK-V-LP-QGSDVKVGDK-R
Sequence 2 YQHEKYDSWTIDNDIALIKLQSPMTLDQKNAKSVQLPSQGSDVKVGDKVR

Sequence 1 VSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSENMICGG
           VSGWGYL-EGSYSLPS---RVDID-V-REQC--LY--AGA----NMICGG
Sequence 2 VSGWGYLKEGSYSLPSDMYRVDIDIVAREQCNKLYEEAGATITDNMICGG

Sequence 1 DVANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPGVYTRVGN
           -VA-GGVDSCQGDSGGPVVDVA--QIVGIVSWGYGCARKGYPGVYTRVG-
Sequence 2 NVADGGVDSCQGDSGGPVVDVASNQIVGIVSWGYGCARKGYPGVYTRVGS

Sequence 1 FVDWIESKRSQ
           F-DWI-SKRSQ
Sequence 2 FIDWIDSKRSQ



Alignment 3
Sequence 1:
Sequence 2: Allergen Der p 3, Sequence: P39675
Sequence identity: 79.15 (205/259)
Sequence 1 --MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISLQSS
           -------IV-LLA-N-LA-PILP-SPNATIVGG-KA-AG-CPYQISLQSS
Sequence 2 MIIYNILIVLLLAINTLANPILPASPNATIVGGEKALAGECPYQISLQSS

Sequence 1 SHFCGGSILDEYWILTAAHCVNGQSAKKLSIRYNTLKHASGGEKIQVAEI
           SHFCGG-ILDEYWILTAAHCV-GQ-A-KLSIRYN-LKH--GGEKI-VA-I
Sequence 2 SHFCGGTILDEYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKI

Sequence 1 YQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQGSDVKVGDKIR
           --HE-YDS--IDND-ALIKLK-PM-L-Q-NAK-V-LPA-GSDVKVGD--R
Sequence 2 FAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVR

Sequence 1 VSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSENMICGG
           VSGWGYL-EGSYSLPSEL-RVDI-VVSR--C--LYSKA-A-V--NMICGG
Sequence 2 VSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGG

Sequence 1 DVANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPGVYTRVGN
           DVANGG-DSCQGDSGGPVVDV---Q-VGIVSWGYGCARKGYPGVYTRVGN
Sequence 2 DVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGN

Sequence 1 FVDWIESKRSQ
           F-DWIESKRSQ
Sequence 2 FIDWIESKRSQ



Alignment 4
Sequence 1:
Sequence 2: Allergen Blo t 3.0101, Sequence: AAM10779
Sequence identity: 49.81 (129/259)
Sequence 1 ---MMILTIVVLLAANILATPILPSSPNAT-----IVGGVKAQAGDCPYQ
           ---------V-L-AA--L----------A------IVGG--A--GD-PYQ
Sequence 2 MKVLVLFCLVSLAAAGPLKDALNKAQVDAFYAEGYIVGGSNAADGDAPYQ

Sequence 1 ISLQSSSHFCGGSILDEYWILTAAHCVNGQSAKKLSIRYNTLKHASGGEK
           -SLQ--SHFCGGSI-----ILTAAHC--G-SA--L--RYNTL-H-SGG--
Sequence 2 VSLQRTSHFCGGSIIADNYILTAAHCIQGLSASSLTTRYNTLRHNSGGLT

Sequence 1 IQVAEIYQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQGSDVK
           -----I--HE-YDS-TIDND-ALI-----M----TNA----LP-QGSD-K
Sequence 2 VKASRIIGHEKYDSNTIDNDIALIQTASKMSTGTTNAQAIKLPEQGSDPK

Sequence 1 VGDKIRVSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSE
           --------GWG-L--G--SLP--LQ-V----V-R--C---Y---GA----
Sequence 2 ASSEVLITGWGTLSSGASSLPTKLQKVTVPIVDRKTCNANYGAVGAEITD

Sequence 1 NMICGGDVANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPGV
           NM-C-G----GG-D-CQGDSGGPV---A----VG-VSWGYGCA---YPGV
Sequence 2 NMFCAGILNVGGKDACQGDSGGPVA--ANGVLVGAVSWGYGCAQAKYPGV

Sequence 1 YTRVGNFVDWIESKRSQ-
           YTRVGN---WI--K----
Sequence 2 YTRVGNYISWIKGKGVPV



Alignment 5
Sequence 1:
Sequence 2: Allergen Tyr p 3.0101, Sequence: ABZ81991
Sequence identity: 46.72 (121/259)
Sequence 1 MMILTIVVLLAANILATPI---LPS---SPNATIVGGVKAQAGDCPYQIS
           M-IL-----L-----A-P----L-S---S-N--IVGG--A--GD-P-Q-S
Sequence 2 MKILLFLCFLVSVAFAKPPTIQLKSNTKSQNGFIVGGTEAVDGDAPHQVS

Sequence 1 LQSSSHFCGGSILDEYWILTAAHCVNGQSAKK---LSIRYNTLKHASGGE
           LQ--SHFCGGSI--E-WILTAAHC------------S-RYNTL---SG--
Sequence 2 LQHTSHFCGGSIISERWILTAAHCIDADDLSNPGGMSVRYNTLNLKSG-T

Sequence 1 KIQVAEIYQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQGSDV
           ---V--I--HE-Y---T-DND-AL------M-L-QTNA----LPA-G-D-
Sequence 2 LVKVKSIKVHEQYSNVTSDNDIALLETVASMNLNQTNAVAAKLPAKGNDP

Sequence 1 KVGDKIRVSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVS
           --GD----SGWG-L--G----P--LQ-V------R--C---Y--------
Sequence 2 QDGD-LFLSGWGTLHSGDTTIPTNLQKVTVPLTNRSVCAEAYTGI-VNIT

Sequence 1 ENMICGGDVANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPG
           ENM-C-G----GGVDSCQGDSGG-------K--VG-VS-G-GC----YPG
Sequence 2 ENMFCAGKMGIGGVDSCQGDSGGGAM--LNKELVGVVSFGVGCGDPKYPG

Sequence 1 VYTRVGNFVDWIESKRSQ----------------------
           VYTRV----DWIE---------------------------
Sequence 2 VYTRVSQYLDWIELSAKSSATTLVAVNITLFLTLFIGAIW



Alignment 6
Sequence 1:
Sequence 2: Allergen Der f 6, Sequence: P49276
Sequence identity: 33.98 (88/259)
Sequence 1 ----------------------MMILTIVVLLAANILATPILPSSPNATI
           -------------------------------L--N---------SP-A--
Sequence 2 MIKIFLVTILIVITVTVDARFPRSLQPKWAYLDSNEFPRSKIGDSPIAGV

Sequence 1 VGGVKAQAGDCPYQISLQSS-----SHFCGGSILDEYWILTAAHCVNGQS
           VGG--A-----P-QISL---------H-CGGS---E----TAAHC--GQ-
Sequence 2 VGGQDADLAEAPFQISLLKDYLIMKRHMCGGSLISESTVVTAAHCTYGQK

Sequence 1 AKKLSIRYNTLKHASGGE-KIQVAEIYQHENYDSMTIDNDVALIKLKTPM
           A--LS-RY-T----S-------V--I-QHE-Y-------D---I-L--P-
Sequence 2 ASSLSVRYGTNQRTSSSYGDLKVKPIIQHESYEQDQTQTDKTIIILPNPV

Sequence 1 TLDQTNAKPVPLPAQGSDVKVGDKIRVSGWGYLQEGSYSLPSELQRVDID
           ----TN-----------D---GDK----GWG--------LP--LQ-----
Sequence 2 -VPSTNVQMNEIETE--DIVDGDKVTIYGWGLTDGNGKDLPDKLQKGSMT

Sequence 1 VVSREQCDQLYSKAGADVSENMICGGDVANGGVDSCQGDSGGPVVDVATK
           -V----C--------A-----MIC--D----G---C-GDSGGP-V--A--
Sequence 2 IVGNDRCNEKWGSINA-IHPGMICALDKTQSG---CNGDSGGPLVS-ANR

Sequence 1 QIVGIVSWGYG-CARKGYPGVYTRVGNFVDWIESKRSQ
           ---GIVSWG---C----Y--V-TR-----DWI------
Sequence 2 KLTGIVSWGPSKCPPGEYMSVFTRPKYYLDWITKNIV-



Alignment 7
Sequence 1:
Sequence 2: Allergen Blo t 6.0101, Sequence: AAQ24544
Sequence identity: 31.66 (82/259)
Sequence 1 ---------------------MMILTIVVLLAANILATPILPSSPNATIV
           -------------------------------------------SP----V
Sequence 2 MNTTTMAFKLVLVLALFCAVHARFPKAIQDRWGYLDTYEYSRNSPR--VV

Sequence 1 GGVKAQAGDCPYQISLQS-----SSHFCGGSILDEYWILTAAHCVNGQSA
           GG--A-----P-QISL--------SH-CGGS--------TAAHC--GQ-A
Sequence 2 GGTDAKKAEAPFQISLMKDYLILKSHICGGSLITPQTVVTAAHCTDGQTA

Sequence 1 KKLSIRYNTLKHASGG-EKIQVAEIYQHENYDSMTIDNDVALIKLKTPMT
           --L--R--T------G---I----I-QHE-YD--TI-ND--L--L--P-T
Sequence 2 SSLINRLGTNQRSKPGIPDIKTKRIVQHEQYDPNTIENDISLLILASPIT

Sequence 1 LDQTNAKPVPLPAQGSDVKVGDKIRVSGWGYLQEGSYSLPSELQRVDIDV
           ---T--K-------------G------GWG--------LP--LQ------
Sequence 2 PSDT-VKVIAI--EETNLNGGEDVKLYGWGLTDGNTQDLPENLQVGELKI

Sequence 1 VSREQCDQLYSKAGADVSENMICGGDVANGGVDSCQGDSGGPVVDVATKQ
           VS-E-C--------------MIC-----------C-GDSGGP-V------
Sequence 2 VSQEECNAKWGEVNT-IKPGMICA---LAPSTQACNGDSGGPLV--YNGK

Sequence 1 IVGIVSWGYG-CARKGYPGVYTRVGNFVDWIESKRSQ
           --GIVSWG---C----Y--V-TR------WI------
Sequence 2 LAGIVSWGPSKCPVGEYMAVFTRPNHYLEWINANKV-



Alignment 8
Sequence 1:
Sequence 2: Allergen Der p 9.0101, Sequence: AAP57077
Sequence identity: 36.29 (94/259)
Sequence 1 ----------------------MMILTIVVLLAANILATPILPSSPNATI
           -------------------------------------------------I
Sequence 2 MKFMILFALIAIGTSVAIGEQAIRLPLPDAITEKFPWMINEPLNDERERI

Sequence 1 VGGVKAQAGDCPYQISL-QSSSHFCGGSILDEYWILTAAHCVNGQSA--K
           VGG--A--GD--YQI-L----S--CGGS-------LTAAHCV-G--A---
Sequence 2 VGGSNASPGDAVYQIALFRKDSFTCGGSLISSRTVLTAAHCVFGDEATPS

Sequence 1 KLSIRYNTLKHASGGEKIQVAEIYQHENYDSMTIDNDVALIKLKTPMTLD
           ---IRYNTL-----G--I-V--IY-H--Y-S--ID-DVA---L--P-T--
Sequence 2 YFKIRYNTLDR-TNGPPIGVSKIYRHNLYSSSPIDYDVATLILSQPFT-P

Sequence 1 QTNAKPVPLPAQGSDVKVGDKIRVSGWGYLQEGSYSLPSELQRVDIDVVS
           --NA---PL----S----G-K----GWG-L--G---LP--LQ-------S
Sequence 2 SANADIIPLTT--SEPADGTKLQITGWGRLKSGG-TLPTILQIASVTKMS

Sequence 1 REQCDQLYSKAGADVSENMICGGDVANGGVDSCQGDSGGPVVDVATKQIV
           R--C--------A-----M-C-----N----SC-GDSGGP-V-------V
Sequence 2 RTKCSSTWGSVNA-ITNRMLCAH---NSNQASCNGDSGGPLV--SNGHLV

Sequence 1 GIVSWGYG-CARKGYPGVYTRVGNFVDWIESKRSQ
           G-VSWG---C----YP--Y--V-N---WI-S----
Sequence 2 GVVSWGPSTCLSTKYPTIYSNVANLRNWIISNTV-



Alignment 9
Sequence 1:
Sequence 2: Allergen Der p 9.0102, Sequence: AAN02511
Sequence identity: 32.43 (84/259)
Sequence 1 ------------------------------------MMILTIVVLLAANI
           --------------------------------------------------
Sequence 2 ILFLRFVEEKRIIIMKFIILFALIAIGTSVAIGEQAIRLPLPDAITEKFP

Sequence 1 LATPILPSSPNATIVGGVKAQAGDCPYQISL-QSSSHFCGGSILDEYWIL
           -------------IVGG--A--GD--YQI-L----S--CGGS-------L
Sequence 2 WMINEPLNDERERIVGGSNASPGDAVYQIALFRKDSFTCGGSLISSRTVL

Sequence 1 TAAHCVNGQSAKK--LSIRYNTLKHASGGEKIQVAEIYQHENYDSMTIDN
           TAAHCV-G--A------IRYNTL-----G--I-V--IY-H--Y-S-TID-
Sequence 2 TAAHCVFGDEATPSYFKIRYNTLDR-TNGPTIGVSKIYRHNLYSSSTIDY

Sequence 1 DVALIKLKTPMTLDQTNAKPVPLPAQGSDVKVGDKIRVSGWGYLQEGSYS
           DVA---L--P-T----NA---PL----S----G-K----GWG-L--G---
Sequence 2 DVATLILSQPFT-PSANADIIPLTT--SEPADGTKLQITGWGRLKSGG-T

Sequence 1 LPSELQRVDIDVVSREQCDQLYSKAGADVSENMICGGDVANGGVDSCQGD
           LP--LQ-------SR--C--------A-----M-C-----N----SC-GD
Sequence 2 LPTILQIASVTKMSRTKCSSTWGSVNA-ITNRMLCAH---NSKQASCNGD

Sequence 1 SGGPVVDVATKQIVGIVSWGYGCARKGYPGVYTRVGNFVDWIESKRSQ
           SGGP-V--------G--SWG----------------------------
Sequence 2 SGGPLVSNG-HLVGGKFSWGP---------------------------



Alignment 10
Sequence 1:
Sequence 2: Allergen Can f 5.0101, Sequence: P09582
Sequence identity: 29.73 (77/259)
Sequence 1 MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISLQSSSH
           --------L--A--L------------I-GG--------P-Q--------
Sequence 2 ---MWFLALCLAMSLGWTGAEPHFQPRIIGGRECLKNSQPWQVAVYHNGE

Sequence 1 F-CGGSILDEYWILTAAHCVNGQSAKKLSIRYNTLKHASGGEKIQVAEIY
           F-CGG------W-LTAAHC-N------L--R-N-------G---QV----
Sequence 2 FACGGVLVNPEWVLTAAHCANSNCEVWLG-RHNLSESEDEGQLVQVRKSF

Sequence 1 QHENYDSMTI----------DNDVALIKLKTPMTLDQTNAKPVPLPAQGS
           -H--Y-----------------D--L--L--P------------LP----
Sequence 2 IHPLYKTKVPRAVIRPGEDRSHDLMLLHLEEPAKITKA-VRVMDLPKK--

Sequence 1 DVKVGDKIRVSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGAD
           ----G----VSGWG---------P--LQ-VD----S--QC---Y------
Sequence 2 EPPLGSTCYVSGWGSTDPETIFHPGSLQCVDLKLLSNNQCAKVYTQK---

Sequence 1 VSENMICGGDVANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYG-CARKG
           V---M-C-G-V--G--D-C-GDSGGP---------VGI-SWG---C----
Sequence 2 VTKFMLCAG-VLEGKKDTCKGDSGGPLI--CDGELVGITSWGATPCGKPQ

Sequence 1 YPGVYTRVGNFVDWIESKRSQ--
           -P--YTRV-----WI--------
Sequence 2 MPSLYTRVMPHLMWIKDTMKANT



Alignment 11
Sequence 1:
Sequence 2: Allergen Bom p 4.0101, Sequence: Q7M4I3
Sequence identity: 31.27 (81/259)
Sequence 1 MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISL-----
           ----------------------------VGG--A--G--P----L-----
Sequence 2 ---------------------------VVGGKPAKLGAWPWMVALGFHNY

Sequence 1 ----QSSSHFCGGSILDEYWILTAAHCVNGQSAKKLSIR-YNTLKHASGG
           -----S----CGGS-------LTAAHC----S-----I---N------G-
Sequence 2 RQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVRIADLNLKRDDDGA

Sequence 1 EKIQ--VAEIYQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQG
           --IQ--------H--Y-------D-A--KL------------P--LP---
Sequence 2 HPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEY-IRPICLPIEE

Sequence 1 S---DVKVGDKIRVSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSK
           S-------G----V-GWG-L------L---L--V---VV----C---YS-
Sequence 2 SLRNNNFIGYNPFVAGWGRLRYKG-PLSDALMEVQVPVVRNKVCKRAYS-

Sequence 1 AGADVSENMICGGDVANGGVDSCQGDSGGPVV--DVATKQIVGIVSWGYG
           ---DVS---IC-G----G--DSCQGDSGGP-------T----G-VS-G--
Sequence 2 ---DVSDTVICAG-YPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHE

Sequence 1 CARKGYPGVYTRVGNFVDWIESKRSQ-
           CA---YPGVYTRV----D---------
Sequence 2 CALPKYPGVYTRVTSYLDSFILPALKK



Alignment 12
Sequence 1:
Sequence 2: Allergen Pol d 4.0101, Sequence: AAP37412
Sequence identity: 30.50 (79/259)
Sequence 1 ------MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQIS
           ----------------A----------------IV-GV-------P----
Sequence 2 MNCGKIILLFITIIGVAKSREENCKCGWDNPSRIVNGVETEINEFPMVAR

Sequence 1 L--QSSSHFCGGSILDEYWILTAAHCVNGQSAKKLSIR----------YN
           L---S----CGG-I-----I-TAAHC---Q--K---------------Y-
Sequence 2 LIYPSPGMYCGGTIITPQHIVTAAHCL--QKYKRTNYTGIHVVVGEHDYT

Sequence 1 TLKHASGGEKIQVAEIYQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPV
           T------------AE---H-NY-S----ND-A--K-------------PV
Sequence 2 TDTETNVTKRYTIAEVTIHPNYNSH--NNDIAIVKTNERFEYSM-KVGPV

Sequence 1 PLP-AQGSDVKVGDKIRVSGWGYLQ-EGSYSLPSELQRVDIDVVSREQCD
           -LP----------------GWG-L---G--S----L--VD--V--REQC-
Sequence 2 CLPFNYMTRNLTNETVTALGWGKLRYNGQNS--KVLRKVDLHVITREQCE

Sequence 1 QLYSKAGADVSENMICGGDVANGGVDSCQGDSGGPVV--DVATKQI--VG
           --Y--A-A----N--C--DV---G-D-CQ-DSGGP-------T-----VG
Sequence 2 THYGAAIANA--NLLCTFDV---GRDACQNDSGGPILWRSPTTDNLILVG

Sequence 1 IVSWGYGCARKGYPGVYTRVGNFVDWIESKRSQ-------
           -V--G--CA----PG---RV--F---I-------------
Sequence 2 VVNFGRTCADDA-PGGNARVTSFMEFIHNATIGETYCKAD



Alignment 13
Sequence 1:
Sequence 2: Allergen Api m 7, Sequence: AAN02286
Sequence identity: 28.57 (74/259)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MIFTNNIAAFQNVVLVKKVKIVLLIFYGSIMFSMTQVNKEECDYYQNLNL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GEIYYIYNPRYPLPYSGSKCTWTITSYHRINLKCSLVEFSENKNCNAGSL

Sequence 1 ---------------------------------MMILTIVVLLAANILAT
           --------------------------------------------------
Sequence 2 TVKKNFANKYCGNITLNIESTSNKMTVILTPPGRFFCEVRPIKRVKDSTN

Sequence 1 PILPSSPNATIVGGVKAQAGDCPYQISLQSS---SHFCGGSILDEYWILT
           ----------IVGG--------P--------------CG--I------LT
Sequence 2 CNCGWKNPSRIVGGTNTGINEFPMMAGIKRTYEPGMICGATIISKRYVLT

Sequence 1 AAHCVNGQSAKKLSIRYNTLKHASGGEKI-----QVAEIYQHENYDSMTI
           AAHC-------KL-I--------S--E--------------H--YD----
Sequence 2 AAHCIIDENTTKLAIVVGEHDWSSKTETNATVLHSINKVIIHPKYDIIEK

Sequence 1 D----NDVALIKLKTPMTLDQTNAKPVPLPAQGS-DVKVGDKIRVSGWGY
           D----ND-AL-K-------------P--LP-Q---D---G----V-GWG-
Sequence 2 DDWQINDIALLKTEKDIKFGD-KVGPACLPFQHFLDSFAGSDVTVLGWGH

Sequence 1 LQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSENMICGGDVANGG
           -------L---LQ-----------C---Y---------N--C----A-G-
Sequence 2 TSFNGM-LSHILQKTTLNMLTQVECYKYYG----NIMVNAMCA--YAKGK

Sequence 1 VDSCQGDSGGPVV--DVATKQIV--GIVSWGYGCARKGYPGVYTRVGNFV
           -D-CQ-DSGGPV------TK--V--GI-SWG--C----YP---T-VG---
Sequence 2 -DACQMDSGGPVLWQNPRTKRLVNIGIISWGAECGK--YPNGNTKVGSYI

Sequence 1 DWIESKRSQ-------
           DWI-S-----------
Sequence 2 DWIVSQTPDAEYCVIE



Alignment 14
Sequence 1:
Sequence 2: Allergen Pol e 4.0101, Sequence: 3989146
Sequence identity: 14.67 (38/259)
Sequence 1 MMILTIVVLLAANILATPILPSSPNATIVGGVKAQAGDCPYQISL--QSS
           ----------------------------V-GV-------P----L-----
Sequence 2 ---------------------------LVNGVETGINEFPMMARLIYXXX

Sequence 1 SHFCGGSILDEYW--ILTAAHCVNGQSAKKLSIRYNTLKHASGGEKIQVA
           ---CGG-I-------ILTAAHCV-G-----L-----T-------------
Sequence 2 XFYCGGTIITPPFKHILTAAHCVEGFLDPTLXXXXSTTGETYDLSXXYTI

Sequence 1 EIYQHENYDSMTIDNDVALIKLKTPMTLDQTNAKPVPLPAQGSDVKVGD-
           ----H-NY-----DND-----L------------PV-LP---------D-
Sequence 2 KVTIHPNY--FDHDNDISIV-LXXXXXXXXXXVGPVCLPFNYMNRVFTDV

Sequence 1 KIRVSGWGYLQEGSYSLPSELQRVDIDVVSREQCDQLYSKAGADVSENMI
           -----GWG-------------------------C----------------
Sequence 2 TVTALGWGKXXXXXXXXXXXXXXXXLIIYFDIGCQDDPLSLVLIXXXXXX

Sequence 1 CGGDVANGGVDSCQGDSGGPVVDVATKQIVGIVSWGYGCARKGYPGVYTR
           --G---N-------------------------------------------
Sequence 2 XYGISNNPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTCSDCWPGGN

Sequence 1 VGNFVDWIESKRSQ-------
           ---------------------
Sequence 2 MRVTSYMEFIXSTVGETYCES


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.