The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Len c 1.0101

Sequence 29539109

Full FASTA alignment

Sequence name:
Query sequence:
SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLE
YKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKL
PAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGF
SKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKV
SREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEK
NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN
ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINAS
SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRL
LTNQKQSHFANAQPLQIE

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Len c 1.0101CAD87730Go!418529.21.1e-151
2Len c 1.0102CAD87731Go!415497.92.9e-142
3Lup an 1.0101ACB05815Go!611323.51.4e-89
4Ara h 1P43238Go!626303.51.5e-83
5Ara h 1P43237Go!614301.27.2e-83
6Gly m 5.0201Q9FZP9Go!559241.94.5e-65
7Gly m 5.0101O22120Go!543238.44.9e-64
8Gly m conglycininCAA35691Go!605238.45.5e-64
9Vig r 2.0201B1NPN8Go!454236.91.2e-63
10Vig r 2.0101Q198W3Go!453233.01.8e-62
11Gly m conglycininAAB01374Go!639174.78.7e-45
12Gly m conglycininAAB23463Go!439144.48.0e-36
13Cor a 11AAL86739Go!448100.91.0e-22
14Gly m conglycininAAA33947Go!21897.26.5e-22
15Jug n 2AAM54366Go!48197.21.4e-21
16Jug r 2AAF18269Go!59396.33.4e-21
17Ses i 3AAK15089Go!58593.71.9e-20
18Pis v 3.0101EF116865Go!51991.86.6e-20
19Ana o 1.0102AAM73729Go!53688.75.8e-19
20Ana o 1.0101AAM73730Go!53888.75.9e-19
21Gly m Bd28KBAB21619Go!47368.94.8e-13
22Ses i 6.0101Q9XHP0Go!45935.74.6e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Len c 1.0101, Sequence: CAD87730
Sequence identity: 100.00 (418/418)
Sequence 1 SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLE
           SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLE
Sequence 2 SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLE

Sequence 1 YKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKL
           YKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKL
Sequence 2 YKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKL

Sequence 1 PAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGF
           PAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGF
Sequence 2 PAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGF

Sequence 1 SKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKV
           SKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKV
Sequence 2 SKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKV

Sequence 1 SREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEK
           SREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEK
Sequence 2 SREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEK

Sequence 1 NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN
           NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN
Sequence 2 NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN

Sequence 1 ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINAS
           ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINAS
Sequence 2 ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINAS

Sequence 1 SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRL
           SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRL
Sequence 2 SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRL

Sequence 1 LTNQKQSHFANAQPLQIE
           LTNQKQSHFANAQPLQIE
Sequence 2 LTNQKQSHFANAQPLQIE



Alignment 2
Sequence 1:
Sequence 2: Allergen Len c 1.0102, Sequence: CAD87731
Sequence identity: 93.30 (390/418)
Sequence 1 SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLE
           SRSDQENPFIFKSNRFQTIYENENGHIRLLQ-FDKRSKIFENLQNYRLLE
Sequence 2 SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLE

Sequence 1 YKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKL
           YKSKPHT-FLPQ-TDADFILVVLSGKA-LTVLNSNDRNSFNLERGDTIKL
Sequence 2 YKSKPHTLFLPQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKL

Sequence 1 PAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGF
           PAGTIAYLANRDDNEDLRVLDLAIPVN-PGQL-SFLLSGTQNQPSFLSGF
Sequence 2 PAGTIAYLANRDDNEDLRVLDLAIPVNNPGQLESFLLSGTQNQPSFLSGF

Sequence 1 SKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKV
           -K-ILEAAFNT-YEEIEKVLLE-QEQ--QHRRSLRD-RQEI--E-VIVKV
Sequence 2 NKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSLRDRRQEINKENVIVKV

Sequence 1 SREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEK
           SREQI-ELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEK
Sequence 2 SREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEK

Sequence 1 NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN
           NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKG-FELVGQRN
Sequence 2 NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN

Sequence 1 ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINAS
           ENQ---REEND-EE-QEEET--QVQRYRA-LSPGDV-V-PAGHPVAINAS
Sequence 2 ENQ---REENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINAS

Sequence 1 SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRL
           SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRL
Sequence 2 SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRL

Sequence 1 LTNQKQSHFANAQPLQIE
           LTNQKQSHFANAQPLQIE
Sequence 2 LTNQKQSHFANAQPLQIE



Alignment 3
Sequence 1:
Sequence 2: Allergen Lup an 1.0101, Sequence: ACB05815
Sequence identity: 58.85 (246/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKMRVRLPMLILLLGVVFLLAASIGIAYGEKDFTKNPPKEREEEEHEPR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQPRPRQQEEQEREHRREEKHDGEPSRGRSQSEESQEEEHERRREHHRER

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EQEQQPRPQRRQEEEEEEEEWQPRRQRPQSRREEREEREQEQGSSSGSQR

Sequence 1 ------------------------SRSD---QENPFIFKSNRFQTIYENE
           ------------------------SRSD---Q-NP--F-SNRFQT-Y-N-
Sequence 2 GGGDERRQHRERRVHREEREQEQDSRSDSRRQRNPYHFSSNRFQTYYRNR

Sequence 1 NGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVL
           NG-IR-L-RF--R----ENLQNYR--E--SKP-T--LP---DADFILVVL
Sequence 2 NGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDADFILVVL

Sequence 1 SGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA
           -G-A--T--N---R---NLE-GD---LPAGT--Y--N-DDN--LRV--LA
Sequence 2 NGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAKLA

Sequence 1 IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEE
           IP-N-PG-L--F--S-T--Q-S--SGFSKN-LEA-FNT-YEEIE-VLL--
Sequence 2 IPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGD

Sequence 1 QE-QKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSS
           -E-Q-----R--R---Q----E-VIV-VS--QI-EL-K-A-SSS-----S
Sequence 2 DELQENEKQR--RGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPS

Sequence 1 ESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLL
           ES-PFNLRS--PIYSNKFG-F-EITP--NPQ-QDL-I-----EI-EG-LL
Sequence 2 ESGPFNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEGALL

Sequence 1 LPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTK
           LP-YNS-AI-IV-V-EG-G--ELVG-R----Q----E---E-G-EE----
Sequence 2 LPHYNSKAIFIVVVDEGEGNYELVGIRDQQRQQDEQEEEYEQGEEE----

Sequence 1 QVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAG
           -V-RY---LS-GDV--IPAGHP--INASS-L-L-GFGINA--NQRNFLAG
Sequence 2 -VRRYSDKLSKGDVFIIPAGHPLSINASSNLRLLGFGINANENQRNFLAG

Sequence 1 EEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE----
           -EDNVI-Q--R-VKEL-FPGS---V-RL--NQ-QS-FANAQP-Q------
Sequence 2 SEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQQQQREK

Sequence 1 ------------------
           ------------------
Sequence 2 EGRRGRRGPISSILNALY



Alignment 4
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43238
Sequence identity: 54.55 (228/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MRGRVSPLMLLLGILVLASVSATHAKSSPYQKKTENPCAQRCLQSCQQEP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DDLKQKACESRCTKLEYDPRCVYDPRGHTGTTNQRSPPGERTRGRQPGDY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DDDRRQPRREEGGRWGPAGPREREREEDWRQPREDWRRPSHQQPRKIRPE

Sequence 1 ----------------SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFD
           ----------------------NPF-F-S-RF-T-Y-N-NG-IR-LQRFD
Sequence 2 GREGEQEWGTPGSHVREETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFD

Sequence 1 KRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLSGKAILTVLNS
           -RS--F-NLQN-R------KP-T--LP---DAD-ILV---G-A--TV-N-
Sequence 2 QRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTVANG

Sequence 1 NDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQS
           N-R-SFNL--G-----P-G-I-Y--NR-DN--LRV-----PVN-PGQ---
Sequence 2 NNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFED

Sequence 1 FLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLE-----EQEQKSQ
           F-------Q-S-L-GFS-N-LEAAFN-E--EI--VLLE-----EQE---Q
Sequence 2 FFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQ

Sequence 1 HRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE---P
           -R-S-R-------NE-VIVKVS-E--EEL-K-AKS-SKK----E-----P
Sequence 2 RRWSTRSSEN---NEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNP

Sequence 1 FNLRSRNPIYSNKFGKFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPN
           -NLR---P--SN-FGK-FE--P-K-NPQLQDLD-----VEIKEG-L-LP-
Sequence 2 INLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPH

Sequence 1 YNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEE-TTKQV
           -NS-A-VIV-VN-G-G--ELV--R-E-QQ--R-E--E-E--EEE-----V
Sequence 2 FNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNREV

Sequence 1 QRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEE
           -RY-ARL--GDV---PA-HPVAINASS-L-L-GFGINA-NN-R-FLAG--
Sequence 2 RRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDK

Sequence 1 DNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE------
           DNVI-QI----K-LAFPGS---V--L--NQK-SHF--A-P----------
Sequence 2 DNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQSPSSP

Sequence 1 -----------------------------
           -----------------------------
Sequence 2 EKESPEKEDQEEENQGGKGPLLSILKAFN



Alignment 5
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43237
Sequence identity: 54.07 (226/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MRGRVSPLMLLLGILVLASVSATQAKSPYRKTENPCAQRCLQSCQQEPDD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LKQKACESRCTKLEYDPRCVYDTGATNQRHPPGERTRGRQPGDYDDDRRQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PRREEGGRWGPAEPREREREEDWRQPREDWRRPSHQQPRKIRPEGREGEQ

Sequence 1 ----------SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIF
           ----------------NPF-F-S-RF-T-Y-N-NG-IR-LQRFD-RSK-F
Sequence 2 EWGTPGSEVREETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQF

Sequence 1 ENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSF
           -NLQN-R-------P-T--LP---DAD-ILV---G-A--TV-N-N-R-SF
Sequence 2 QNLQNHRIVQIEARPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSF

Sequence 1 NLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGT
           NL--G-----P-G-I-Y--NR-DN--LRV-----PVN-PGQ---F-----
Sequence 2 NLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASS

Sequence 1 QNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEE-----QEQKSQHRRSLR
           --Q-S-L-GFS-N-LEAAFN-E--EI--VLLEE-----QE---Q-RRS-R
Sequence 2 RDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRRSTR

Sequence 1 DKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSE--SEPFNLRSRN
           -------NE-VIVKVS-E---EL-K-AKS-SKK----E----P-NLR---
Sequence 2 SS----DNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGE

Sequence 1 PIYSNKFGKFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIV
           P--SN-FG--FE--P-K-NPQLQDLD-----VEIKEG-L-LP--NS-A-V
Sequence 2 PDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMV

Sequence 1 IVTVNEGKGDFELVGQRNENQQ----EQREENDEEEGQEEETTKQVQRYR
           IV-VN-G-G--ELV--R-E-QQ----EQ--E--EE---EE-----V-RY-
Sequence 2 IVVVNKGTGNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYT

Sequence 1 ARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVI
           ARL--GDV---PA-HPVAINASS-L-L-GFGINA-NN-R-FLAG--DNVI
Sequence 2 ARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVI

Sequence 1 SQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE----------
           -QI----K-LAFPGS---V--L--NQ--SHF--A-P--------------
Sequence 2 DQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKEDQE

Sequence 1 ------------------
           ------------------
Sequence 2 EENQGGKGPLLSILKAFN



Alignment 6
Sequence 1:
Sequence 2: Allergen Gly m 5.0201, Sequence: Q9FZP9
Sequence identity: 55.02 (230/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEW

Sequence 1 -----------------------------------------SRSDQENPF
           ------------------------------------------R----NPF
Sequence 2 QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPF

Sequence 1 IFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIF
           -F-S-RFQT---N--GH-R-LQRF-KRS----NL--YR-LE--SKP-T--
Sequence 2 HFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLL

Sequence 1 LPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLA
           LP---DAD---V-L-G-AILT--N--DR-S-NL--GD----PAGT--Y--
Sequence 2 LPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVV

Sequence 1 NRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAF
           N-D--E-LR---LAIPVN-PG---SF-LS-TQ-Q-S-L-GFSKNILEA--
Sequence 2 NPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASY

Sequence 1 NTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELS
           -T--EEI-KVL----E---Q----L---------E-VIV--S--QI-ELS
Sequence 2 DTKFEEINKVLFGREEGQQQGEERLQ--------ESVIVEISKKQIRELS

Sequence 1 KNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDI
           K-AKSSS-K--SSE--PFNLRSR-PIYSNK-GK-FEITPEKNPQL-DLD-
Sequence 2 KHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDV

Sequence 1 FVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREE
           F---V---EG-L-LP--NS-AIV----NEG----ELVG---E-QQ-Q---
Sequence 2 FLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIK-EQQQRQ---

Sequence 1 NDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFG
           ------Q-EE----V--YRA-LS--D--VIPAG-PV--NA-SDLN---FG
Sequence 2 ------QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFG

Sequence 1 INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF
           INA-NNQRNFLAG--DNVISQI---V-ELAFPGS------L---Q--S-F
Sequence 2 INAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYF

Sequence 1 ANAQPLQIE------------------
           --AQP-Q-E------------------
Sequence 2 VDAQPQQKEEGNKGRKGPLSSILRAFY



Alignment 7
Sequence 1:
Sequence 2: Allergen Gly m 5.0101, Sequence: O22120
Sequence identity: 55.02 (230/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQK

Sequence 1 -------------------------SRSDQENPFIFKSNRFQTIYENENG
           --------------------------R----NPF-F-SNRF-T---N--G
Sequence 2 EERKQEEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFETLFKNQYG

Sequence 1 HIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLSG
           -IR-LQRF--RS----NL--YR-LE--SKP-T--LP---DAD---V-L-G
Sequence 2 RIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNG

Sequence 1 KAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIP
           -AIL---N--DR-S--L--GD----P-GT--Y--N-D-NE-LR---LAIP
Sequence 2 TAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIP

Sequence 1 VNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQE
           VN-PG---SF-LS-T--Q-S-L-GFS-NILEA---T--EEI-KVL----E
Sequence 2 VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREE

Sequence 1 QKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE
           ---Q----L---------E-VIV--S-EQI--LSK-AKSSS-K--SSE--
Sequence 2 GQQQGEQRLQ--------ESVIVEISKEQIRALSKRAKSSSRKTISSEDK

Sequence 1 PFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPN
           PFNLRSR-PIYSNK-GKFFEITPEKNPQL-DLDIF---V---EG-LLLP-
Sequence 2 PFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPH

Sequence 1 YNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQ
           -NS-AIVI---NEG----ELVG---E-QQEQ---------Q-EE----V-
Sequence 2 FNSKAIVILVINEGDANIELVGLK-EQQQEQ---------QQEEQPLEVR

Sequence 1 RYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEED
           -YRA-LS--D--VIPAG-PV--NA-S-LN----GINA-NNQRNFLAG--D
Sequence 2 KYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQD

Sequence 1 NVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE-------
           NVISQI---V-ELAFPGS---V--LL-NQ--S-F--AQP---E-------
Sequence 2 NVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRK

Sequence 1 -----------
           -----------
Sequence 2 GPLSSILRAFY



Alignment 8
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: CAA35691
Sequence identity: 55.02 (230/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE

Sequence 1 -------------------------------------SRSDQENPFIFKS
           --------------------------------------R----NPF-F-S
Sequence 2 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS

Sequence 1 NRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF
           NRF-T---N--G-IR-LQRF--RS----NL--YR-LE--SKP-T--LP--
Sequence 2 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH

Sequence 1 TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDD
           -DAD---V-L-G-AIL---N--DR-S--L--GD----P-GT--Y--N-D-
Sequence 2 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN

Sequence 1 NEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEY
           NE-LR---LAIPVN-PG---SF-LS-T--Q-S-L-GFS-NILEA---T--
Sequence 2 NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF

Sequence 1 EEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAK
           EEI-KVL----E---Q----L---------E-VIV--S-EQI--LSK-AK
Sequence 2 EEINKVLFSREEGQQQGEQRLQ--------ESVIVEISKEQIRALSKRAK

Sequence 1 SSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNS
           SSS-K--SSE--PFNLRSR-PIYSNK-GKFFEITPEKNPQL-DLDIF---
Sequence 2 SSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSI

Sequence 1 VEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEE
           V---EG-LLLP--NS-AIVI---NEG----ELVG---E-QQEQ-------
Sequence 2 VDMNEGALLLPHFNSKAIVILVINEGDANIELVGLK-EQQQEQ-------

Sequence 1 EGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAK
           --Q-EE----V--YRA-LS--D--VIPAG-PV--NA-S-LN----GINA-
Sequence 2 --QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAE

Sequence 1 NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQ
           NNQRNFLAG--DNVISQI---V-ELAFPGS---V--LL-NQ--S-F--AQ
Sequence 2 NNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQ

Sequence 1 PLQIE------------------
           P---E------------------
Sequence 2 PKKKEEGNKGRKGPLSSILRAFY



Alignment 9
Sequence 1:
Sequence 2: Allergen Vig r 2.0201, Sequence: B1NPN8
Sequence identity: 56.70 (237/418)
Sequence 1 --------------------------------------SRSDQENPFIFK
           --------------------------------------------NPF-F-
Sequence 2 MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFN

Sequence 1 SNR-FQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP
           S-R-F-T---N--GH-R-LQRFD-RSK---NL-NYR--E--SKP-T--LP
Sequence 2 SDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLP

Sequence 1 QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANR
           ---DADF-LVVL-G-A-LT--N---R-S--LE-G---K-PAGT---L-N-
Sequence 2 HHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNP

Sequence 1 DDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNT
           DDNE-LR---LA-PVN-P---Q-F-LS-T--Q-S-L-GFSKNILEA-F--
Sequence 2 DDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDS

Sequence 1 EYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKN
           ---EI--VL--E--Q--Q---------QE---E-VIV---REQI-EL-K-
Sequence 2 DIKEISRVLFGEEGQQQQ-------QGQESQQEGVIVELKREQIRELTKH

Sequence 1 AKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFV
           AKSSSKKS-SSE--PFNLR---PIYSNK-G--FEITPEKNPQL-DLD-F-
Sequence 2 AKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFI

Sequence 1 NSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREEND
           -SV--KEGSLLLP-YNS-AIVI---NEGK---ELVGQR---QQ-Q-EE--
Sequence 2 RSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQRE--QQKQQEE--

Sequence 1 EEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGIN
           ----QEE-----VQRYRA-LS--DV--IPA--PVAINA-S-LN---FGIN
Sequence 2 ----QEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGIN

Sequence 1 AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFAN
           A-NNQRNFLAGE-DNVIS-I---V----FP-S---V--L---Q--S-F--
Sequence 2 AENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVD

Sequence 1 AQPLQIE--------------
           AQP-Q-E--------------
Sequence 2 AQPEQQEREEARKGGKGPFVY



Alignment 10
Sequence 1:
Sequence 2: Allergen Vig r 2.0101, Sequence: Q198W3
Sequence identity: 54.55 (228/418)
Sequence 1 ------------------------------------SRSDQENPFIFKSN
           ----------------------------------------Q-NPF-F-S-
Sequence 2 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD

Sequence 1 R-FQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF
           R-F-T---N--GH-R---RFD-RSK---NL-NYR--E-KSKP-T--LP--
Sequence 2 RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH

Sequence 1 TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDD
           -DADF-LVVL-G-AILT--N---R-S--LE-G---K-PAGT---L-N--D
Sequence 2 ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND

Sequence 1 NEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEY
           N--LR---LAIPVN-P---Q-F-LS-T--Q-S-L-GFSKNILEA-F----
Sequence 2 NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF

Sequence 1 EEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAK
           -EI--VL--E--Q--QH--------QE---E-VIV---REQI-EL-K-AK
Sequence 2 KEIDRVLFGEERQQ-QHG----EESQE---EGVIVELKREQIRELIKHAK

Sequence 1 SSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNS
           SSS-K--SS--EPFNLR--NPIYSNKFG---EITPEKNPQL-DLD-F--S
Sequence 2 SSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISS

Sequence 1 VEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEE
           V--KEG-LLLP-YNS-AIVI---NEG----ELVG-----QQ----E----
Sequence 2 VDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLE----

Sequence 1 EGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAK
           ----------VQRYRA-LS--DV-VIPA--PVAINA-S-LN---FGINA-
Sequence 2 ----------VQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAE

Sequence 1 NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQ
           NNQRNFLAGE-DNV-S-I---V----FP-S---V--L---Q--SHF--AQ
Sequence 2 NNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQ

Sequence 1 PLQIE--------------------
           P-Q----------------------
Sequence 2 PEQQQREEGHKGRKGSLSSILGSLY



Alignment 11
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB01374
Sequence identity: 54.31 (227/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NQACHARCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQ

Sequence 1 ---SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYR
           ----R----NPF-F-S-RFQT---N--GH-R-LQRF-KRS----NL--YR
Sequence 2 REPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR

Sequence 1 LLEYKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDT
           -LE--SKP-T--LP---DAD---V-L-G-AILT--N--DR-S-NL--GD-
Sequence 2 ILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA

Sequence 1 IKLPAGT---------------IA----YLANRDDNEDLRVLDLAIPVNR
           ---PAGT---------------IA----Y--N-D--E-LR---LAIPVN-
Sequence 2 LRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNK

Sequence 1 PGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKS
           PG---SF-LS-TQ-Q-S-L-GFSKNILEA---T--EEI-KVL----E---
Sequence 2 PGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQ

Sequence 1 QHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFN
           Q----L---------E-VIV--S--QI-ELSK-AKSSS-K--SSE--PFN
Sequence 2 QGEERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFN

Sequence 1 LRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNS
           L-SR-PIYSNK-GK-FEIT---NPQL-DLD-F---V---EG-L-LP--NS
Sequence 2 LGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNS

Sequence 1 RAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYR
           -AIV----NEG----ELVG---E-QQ-Q---------Q-EE----V--YR
Sequence 2 KAIVVLVINEGEANIELVGIK-EQQQRQ---------QQEEQPLEVRKYR

Sequence 1 ARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVI
           A-LS--D--VIPAG-PV--NA-SDLN---FGINA-NNQRNFLAG--DNVI
Sequence 2 AELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVI

Sequence 1 SQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE----------
           SQI---V-ELAFP-S------L---Q--S-F--AQP-Q-E----------
Sequence 2 SQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPL

Sequence 1 --------
           --------
Sequence 2 SSILRAFY



Alignment 12
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB23463
Sequence identity: 58.61 (245/418)
Sequence 1 -------------------------SRSDQENPFIFKS-NRFQTIYENEN
           --------------------------R-D--NPF-F-S-N-FQT--EN-N
Sequence 2 MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRSSNSFQTLFENQN

Sequence 1 GHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLS
           --IRLLQRF-KRS---ENL--YR-----SKP-TI-LP---DADF-L-VLS
Sequence 2 VRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLS

Sequence 1 GKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI
           G-AILT--N--DR-S-NL--GD----PAGT--YL-N--D---L----LAI
Sequence 2 GRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI

Sequence 1 PVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLL-EE
           PVN-PG----F-LS-TQ-Q-S-L-GFS-NILE--F--E-EEI--VL--EE
Sequence 2 PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEE

Sequence 1 QEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSE
           -EQ--Q--------------E-VIV--S-EQI--LS--AKSSS-K--SSE
Sequence 2 EEQRQQ--------------EGVIVELSKEQIRQLSRRAKSSSRKTISSE

Sequence 1 SEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLL
           -EPFNLRSRNPIYSN-FGKFFEITPEKNPQL-DLDIF--SV-I-EG-LLL
Sequence 2 DEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLL

Sequence 1 PNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQ
           P--NS-AIVI---NEG----ELVG---E-QQ-Q---------QEEE----
Sequence 2 PHFNSKAIVILVINEGDANIELVGIK-EQQQKQK--------QEEEPL-E

Sequence 1 VQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGE
           VQRYRA-LS--DV-VIPA--P---NA-S-LN---FGINA-NNQRNFLAGE
Sequence 2 VQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGE

Sequence 1 EDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE-----
           -DNV--QI-R-V-ELAFPGS---V-RLL--Q--S-F--AQP-Q-E-----
Sequence 2 KDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKG

Sequence 1 -------------
           -------------
Sequence 2 RKGPFPSILGALY



Alignment 13
Sequence 1:
Sequence 2: Allergen Cor a 11, Sequence: AAL86739
Sequence identity: 36.84 (154/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MLPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSE

Sequence 1 ---SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYR
           --------ENP--F----F------E-G----L--F-KRS-------N-R
Sequence 2 ESYGKEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFR

Sequence 1 LLEYKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDT
           L------PHT---P---DA---L-V--G-A--T------R-SFN-E-GD-
Sequence 2 LAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDI

Sequence 1 IKLPAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFL
           I--PAGT--Y--NRD-NE-L-------PV--PG----F---G-----SF-
Sequence 2 IRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFEAFYGAGGEDPESFY

Sequence 1 SGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVI
           --FS---LEAA-----E--EKV---EQ---S------------------I
Sequence 2 RAFSWEVLEAALKVRREQLEKVF-GEQSKGS------------------I

Sequence 1 VKVSREQIEELSKNAKSSSKK-SVSSESE-PFNLRSRNPIYSNKFGKFFE
           VK-SRE-I--LS--------------ES--P-NL----P--SN-FG---E
Sequence 2 VKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYE

Sequence 1 ITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFEL
           --P----QLQDLD--V----I--GS---P-YNSRA--I--V-EG-G-FE-
Sequence 2 AHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEM

Sequence 1 VGQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPV
           -----------------------------Q---ARL--G-V-V-PAGHPV
Sequence 2 ACPHLSS-----------------SSGSYQKISARLRRGVVFVAPAGHPV

Sequence 1 AINASSDLNL--IGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGS
           A--AS---NL----F--NA--N-R--LAG---N------R--KELAF---
Sequence 2 AVIASQNNNLQVLCFEVNAHGNSRFPLAGK-GNIVNEFERDAKELAFNLP

Sequence 1 SREVDRLLTNQKQSHFANAQPLQIE----------
           SREV-R---NQ-Q--F------Q-E----------
Sequence 2 SREVERIFKNQDQAFFFPGPNKQQEEGGRGGRAFE



Alignment 14
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAA33947
Sequence identity: 30.38 (127/418)
Sequence 1 SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEK
           --------SK-AKSSS-K--SSE--PFNL-SR-PIYS-K-GKFFEITPEK
Sequence 2 --------SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEK

Sequence 1 NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN
           NPQL-DLDIF---V---EG-LLLP--NS-AIVI---NEG----ELVG---
Sequence 2 NPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLK-

Sequence 1 ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINAS
           E-QQEQ---------Q-EE----V--YRA-LS--D--VIPAG-PV--NA-
Sequence 2 EQQQEQ---------QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNAT

Sequence 1 SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRL
           S-LN----GINA-NNQRNFLAG--DNVISQI---V-ELAFPGS---V--L
Sequence 2 SNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKL

Sequence 1 LTNQKQSHFANAQPLQIE------------------
           L-NQ--S-F--AQP---E------------------
Sequence 2 LKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY



Alignment 15
Sequence 1:
Sequence 2: Allergen Jug n 2, Sequence: AAM54366
Sequence identity: 39.00 (163/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPE

Sequence 1 -----------SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKI
           -----------------NP--F-S-------E-E-G----L-RF--R---
Sequence 2 ASPRRESKGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFAERTEL

Sequence 1 FENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNS
           -----NYR-------P-T--LP---DA----VV--G-A-LT------R-S
Sequence 2 LRGIENYRVVILDANPNTFMLPHHKDAESVIVVTRGRATLTLVSQETRES

Sequence 1 FNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSG
           FNLE-GD-I--PAG---Y--N-D-NE-L----L--PVN-PGQ-------G
Sequence 2 FNLECGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNPGQVREYYAAG

Sequence 1 TQN-QPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKR
           ------S-L--FS--IL-AA-NT-----E------QEQ------------
Sequence 2 AKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQR-----------

Sequence 1 QEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE--PFNLRSRNPIY
           -----E-VI---S-E----LS--A-S---------S---P--L-S--P-Y
Sequence 2 -----EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSY

Sequence 1 SNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTV
           SN-FG-FFE--PE---QLQ--D--VN--EIK-G----P-YNS-A-V-V-V
Sequence 2 SNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYV

Sequence 1 NEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDV
           -EG-G--E--------Q----E-----E--EEE-T---Q---ARL--GD-
Sequence 2 VEGTGRYEMACPHVSSQSF--EDQGRREQEEEESTGRFQKVTARLARGDI

Sequence 1 LVIPAGHPVAINASSDLNL--IGFGINAKNNQRNFLAGEEDNVISQIQRP
           -VIPAGHP-AI-AS---NL---GFGIN--NNQRNFLAG-----I-Q--R-
Sequence 2 FVIPAGHPIAITASQNENLRLLGFGINGENNQRNFLAGQ-NSIINQLERE

Sequence 1 VKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE----------------
           -KEL-F-----E-------Q--S-F-------------------------
Sequence 2 AKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILGFAF

Sequence 1 -
           -
Sequence 2 F



Alignment 16
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 38.76 (162/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ

Sequence 1 -----------------------SRSDQENPFIFKSNRFQTIYENENGHI
           -----------------------------NP--F-S-------E-E-G--
Sequence 2 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV

Sequence 1 RLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLSGKA
           --L-RF--R--------NYR-------P-T--LP---DA----VV--G-A
Sequence 2 KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRA

Sequence 1 ILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVN
           -LT------R-SFNLE-GD-I--PAG---Y--N-D-NE-L----L--PVN
Sequence 2 TLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVN

Sequence 1 RPGQLQSFLLSGTQN-QPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQ
           -PGQ-------G------S-L--FS--IL-AA-NT-----E------QEQ
Sequence 2 NPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQ

Sequence 1 KSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE-
           -----------------E-VI---S-E----LS--A-S---------S--
Sequence 2 R----------------EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSG

Sequence 1 -PFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLP
           -P--L-S--P-YSN-FG-FFE--PE---QLQ--D--VN--EIK-G----P
Sequence 2 GPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVP

Sequence 1 NYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQV
           -YNS-A-V-V-V-EG-G--E--------Q--------E-E--EEE-T---
Sequence 2 HYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQE--EEESTGRF

Sequence 1 QRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGINAKNNQRNFLAG
           Q---ARL--GD--VIPAGHP-AI-AS---NL---GF-IN--NNQR-FLAG
Sequence 2 QKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG

Sequence 1 EEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE----
           ---N-I-Q--R--KEL-F-----E-------Q--S-F-------------
Sequence 2 Q-NNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGR

Sequence 1 -------------
           -------------
Sequence 2 DHPLASILDFAFF



Alignment 17
Sequence 1:
Sequence 2: Allergen Ses i 3, Sequence: AAK15089
Sequence identity: 32.54 (136/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF

Sequence 1 -------------------------------------SRSDQENPFIFKS
           --------------------------------------------P--F--
Sequence 2 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQGRGRIPYVFED

Sequence 1 NRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF
           --F-T------G--R-LQ-F--RS-------NYR-------P-T---P--
Sequence 2 QHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNH

Sequence 1 TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDD
           -DA-----V--G-----------R-S-N---GD--K--AGT-AYL-NRD-
Sequence 2 WDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDN

Sequence 1 NEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEY
           NE-L----L--PV--PG----F---G--N--SF---FS--ILEAAFNT--
Sequence 2 NERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRR

Sequence 1 EEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAK
           ---------------Q-R--------------VIVK-S-EQ----S----
Sequence 2 DRLQRIF-------GQQRQG------------VIVKASEEQVRAMSRHEE

Sequence 1 SSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNS
           --------------N-----P--SN--G---E-------QL-DLD--V--
Sequence 2 GGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSL

Sequence 1 VEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEE
           --I--G----P-YNS-A--I--V--G-G-FE-----------------E-
Sequence 2 ANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQ--GET

Sequence 1 EGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGIN
           -G---------QR---RL--G-V--IPAGHP----ASS--NL----F--N
Sequence 2 RGRP-----SYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVN

Sequence 1 AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFAN
           A-NN----LAG---NV--Q--R--KELAF----REV------Q----F--
Sequence 2 ANNNEKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFK

Sequence 1 AQPLQIE-----
           ----Q-------
Sequence 2 GPRQQQQGRADA



Alignment 18
Sequence 1:
Sequence 2: Allergen Pis v 3.0101, Sequence: EF116865
Sequence identity: 33.73 (141/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KTDPELKQCKHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQEEEEEEE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 WGSGRGRGDEFSTHEPGEKRLSQCMKQCERQDGGQQKQLCRFRCQEKYKK

Sequence 1 --------------------SRSDQENPFIFKSNRFQTIYENENGHIRLL
           -------------------------ENP--F----F-T----E-G----L
Sequence 2 ERREHSYSRDEEEEEEGDEEQEEEDENPYVFEDEHFTTRVKTEQGKVVVL

Sequence 1 QRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLSGKAILT
           --F-KRSK----L--YRL------P-----P---DAD-I--V--G----T
Sequence 2 PKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDADSIFFVSWGRGTIT

Sequence 1 VLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVNRPG
           ----N-R-S-N---GD-I---AGT--Y--N-D-NE-L----L--PVN-PG
Sequence 2 KIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQPVNLPG

Sequence 1 QLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH
           ----F---G--N--SF---FS---LEAA--T-----EK-L-E-Q------
Sequence 2 HYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-LFEKQD-----

Sequence 1 RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE-PFNL
           -------------E--IVK-S-EQI---S------S-------S---FNL
Sequence 2 -------------EGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNL

Sequence 1 RSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSR
           ----P--SN--G--FE------P-LQ-LDI-V--V-I--G----P-YNSR
Sequence 2 FKKDPSQSNNYGQLFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSR

Sequence 1 AIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYRA
           A--I--V--G-G--E--------------------GQE------------
Sequence 2 ATKIAIVVSGEGRLEIACPHLSSSKNS--------GQEK-SGPSYKKLSS

Sequence 1 RLSPGDVLVIPAGHPVAINASSDLNL--IGFGINAKNNQRNFLAGEEDNV
           ------V-V-PAGHP----AS---NL----F--NA--N-R--LAG---N-
Sequence 2 SIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKK-NI

Sequence 1 ISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE-------
           I-------KELAF-----EVD-----Q----F----------------
Sequence 2 IEVMEKEAKELAFKTKGEEVDKVFGKQDEEFFFQGPKWRQHQQGRADE



Alignment 19
Sequence 1:
Sequence 2: Allergen Ana o 1.0102, Sequence: AAM73729
Sequence identity: 32.30 (135/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQ

Sequence 1 ------------------------------------------SRSDQENP
           -----------------------------------------------ENP
Sequence 2 CERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEEDENP

Sequence 1 FIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTI
           --F----F-T----E-G---LL--F---SK----L--YRL------P---
Sequence 2 YVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAF

Sequence 1 FLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYL
           --P---DAD-I--V--G----T----N-R-S-N---GD------GT--Y-
Sequence 2 VVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYI

Sequence 1 ANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAA
           AN-D-NE-L-------PVN-PG----F---G--N--SF---FS--ILEAA
Sequence 2 ANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAA

Sequence 1 FNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEEL
           --T-----EK-L-E-Q-Q--------------------I-K-S-EQ----
Sequence 2 LKTSKDTLEK-LFEKQDQGT------------------IMKASKEQVRAM

Sequence 1 SKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGKFFEITPEKNPQLQDL
           S-------------ES---F-L----P--SNK-G--FE------P-L--L
Sequence 2 SRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKL

Sequence 1 DIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQR
           D--V----I--G----P-YNSRA--I--V--G-G--E-------------
Sequence 2 DMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSH

Sequence 1 EENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--
           --------------------RAR-----V---PAGHP-A--AS---NL--
Sequence 2 P--------------SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEI

Sequence 1 IGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQK
           --F--NA--N-R--LAG---N-I-------KELAF-----EVD-----Q-
Sequence 2 VCFEVNAEGNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQD

Sequence 1 QSHFANAQPLQIE-------
           ---F--------E-------
Sequence 2 EEFFFQGPEWRKEKEGRADE



Alignment 20
Sequence 1:
Sequence 2: Allergen Ana o 1.0101, Sequence: AAM73730
Sequence identity: 32.54 (136/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCM

Sequence 1 --------------------------------------------SRSDQE
           -------------------------------------------------E
Sequence 2 RQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEEDE

Sequence 1 NPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPH
           NP--F----F-T----E-G---LL--F---SK----L--YRL------P-
Sequence 2 NPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQ

Sequence 1 TIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIA
           ----P---DAD-I--V--G----T----N-R-S-N---GD------GT--
Sequence 2 AFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPF

Sequence 1 YLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILE
           Y-AN-D-NE-L-------PVN-PG----F---G--N--SF---FS--ILE
Sequence 2 YIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILE

Sequence 1 AAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIE
           AA--T-----EK-L-E-Q-Q--------------------I-K-S-EQI-
Sequence 2 AALKTSKDTLEK-LFEKQDQGT------------------IMKASKEQIR

Sequence 1 ELSKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGKFFEITPEKNPQLQ
           --S-------------ES---F-L----P--SNK-G--FE------P-L-
Sequence 2 AMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLE

Sequence 1 DLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQE
           -LD--V----I--G----P-YNSRA--I--V--G-G--E-----------
Sequence 2 KLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKS

Sequence 1 QREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL
           ----------------------RAR-----V---PAGHP-A--AS---NL
Sequence 2 SHP--------------SYKKLRARIRKDTVFIVPAGHPFATVASGNENL

Sequence 1 --IGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTN
           ----F--NA--N-R--LAG---N-I-------KELAF-----EVD-----
Sequence 2 EIVCFEVNAEGNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGK

Sequence 1 QKQSHFANAQPLQIE-------
           Q----F--------E-------
Sequence 2 QDEEFFFQGPEWRKEKEGRADE



Alignment 21
Sequence 1:
Sequence 2: Allergen Gly m Bd28K, Sequence: BAB21619
Sequence identity: 25.60 (107/418)
Sequence 1 -------------------------SRSDQENP-FIFKSNRFQTIYENEN
           ----------------------------D---P---F-------------
Sequence 2 KTTLLLLLFVLCHGVATTTMAFHDDEGGDKKSPKSLFLMSNSTRVFKTDA

Sequence 1 GHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLS
           G--R-L-----R--IF--------------P---F-PQ--D---I-----
Sequence 2 GEMRVLKSHGGR--IFYRHMHIGFISME--PKSLFVPQYLDSNLIIFIRR

Sequence 1 GKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI
           G-A-L------------L--GD----P-G---YL-N------L-V-----
Sequence 2 GEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSID

Sequence 1 PVNRPG--QLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLE
           P----G----QSF---G--N--S-LSGF---ILE-AFN------E-----
Sequence 2 PSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSK

Sequence 1 EQEQ-----KSQHRRSLRDKRQEITNEDVIVKVSR-----EQIEELSKNA
           E-----------H--SL--K-------D------------E--EE-----
Sequence 2 ELDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTS

Sequence 1 KSSSK---------------KSVSSESEPFNLRS-RNPIYSNKFGKFFEI
           -S--K---------------K---------NL---------N--G-----
Sequence 2 RSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKADFKNAYGWSKAL

Sequence 1 TPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELV
           -----P-L---DI-V--V----GS-L-P--N--------V--G-G-----
Sequence 2 HGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLSGYGELH-I

Sequence 1 GQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVA
           G--N--------------G-----TK--Q--------GDV-V-P---P--
Sequence 2 GYPN--------------GSRAMKTKIKQ--------GDVFVVPRYFPFC

Sequence 1 INASSD--LNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSS
           --AS-D--L---GF---A--N---FLAG-----------P----AF--S-
Sequence 2 QVASRDGPLEFFGFSTSARKNKPQFLAGAA-SLLRTLMGPELSAAFGVSE

Sequence 1 REVDRLLTNQKQSHFANAQPLQIE--------------------------
           ----R----Q----------------------------------------
Sequence 2 DTLRRAVDAQHEAVILPSAWAAPPENAGKLKMEEEPNAIRSFANDVVMDV

Sequence 1 -
           -
Sequence 2 F



Alignment 22
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 14.35 (60/418)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQS

Sequence 1 -----SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQN
           --------D------------------------L----------------
Sequence 2 EGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQ

Sequence 1 YRLLEYKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERG
           ----------------------------S-----------------L--G
Sequence 2 GLISIMVPGCAETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQG

Sequence 1 DTIKLPAGTIAYLANRDDNEDL---RVLDLAIPVNRPGQ-LQSFLL----
           D----P-G------N-D--EDL------D-----N---Q----F-L----
Sequence 2 DIVAIPSGAAHWCYN-DGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGV

Sequence 1 --SGTQNQPS------FLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQ
           --SG-Q-Q------------F----L--AFN---E-I-----EE-E----
Sequence 2 PRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEE----

Sequence 1 HRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSS--KKSVSSESEPF
           -R------R---T-----V----E--E-----------------------
Sequence 2 -RGLIVMARERMT----FVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRT

Sequence 1 NLRSRNP--IYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPN
           N--SR----I-S---G--------K-P-L---D------------L--P-
Sequence 2 NVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPD

Sequence 1 YNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQ
           -------IV-V--G------V----------R----E--------T----
Sequence 2 WSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTAR

Sequence 1 RYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEED
           --------------------------------------N-----------
Sequence 2 AGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQA

Sequence 1 NVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE
           ------------------S------------------------
Sequence 2 LKMNRGSQSFLLSPGGRRS------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.