The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ara h 8.0101

Sequence 37499626

Full FASTA alignment

Sequence name:
Query sequence:
MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPG
TIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFE
TKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYV
LANPTQY

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ara h 8.0101AAQ91847Go!157225.44.5e-61
2Gly m 4CAA42646Go!158166.52.4e-43
3Pha v 1CAA43637Go!156165.25.8e-43
4Pha v 1CAA43636Go!155163.71.7e-42
5Pha v 1P25985Go!155163.71.7e-42
6Vig r 1.0101Q2VU97Go!155159.43.3e-41
7Ara h 8.0201EF436550Go!153129.04.7e-32
8Bet v 1.1301CAA54696Go!160127.51.4e-31
9Cor a 1.0401AAD48405Go!161125.55.3e-31
10Cor a 1.0404AAG40331Go!161125.55.3e-31
11Cor a 1.0402AAG40329Go!161124.79.6e-31
12Cor a 1.0403AAG40330Go!161124.01.5e-30
13Cas s 1CAD10374Go!160121.21.0e-29
14Fag s 1.0101ACJ23864Go!160119.92.6e-29
15Fra a 1Q256S2Go!160119.14.7e-29
16Cor a 1.0301CAA96549Go!160118.95.4e-29
17Fra a 1Q3T923Go!160118.66.3e-29
18Fra a 1Q256S7Go!160118.66.3e-29
19Pru av 1O24248Go!160118.66.3e-29
20Pru p 1.0101Q2I6V8Go!160117.61.3e-28
21Mal d 1AAD26555Go!159117.11.8e-28
22Pru ar 1O50001Go!160117.11.8e-28
23Mal d 1AAD26559Go!159116.72.4e-28
24Fra a 1Q256S6Go!160116.72.4e-28
25Mal d 1AAD26546Go!159116.13.8e-28
26Mal d 1CAA88833Go!159116.13.8e-28
27Mal d 1AAD26548Go!159115.84.4e-28
28Mal d 1AAD26547Go!159115.45.9e-28
29Mal d 1CAA58646Go!159115.26.8e-28
30Mal d 1AAD26558Go!159115.08.0e-28
31Mal d 1AAD26552Go!159115.08.0e-28
32Pyr c 1O65200Go!159114.89.2e-28
33Fra a 1Q256S4Go!159114.51.1e-27
34Mal d 1AAD26554Go!159114.31.2e-27
35Mal d 1AAD26553Go!159114.31.2e-27
36Cor a 1.0201CAA96548Go!160114.11.5e-27
37Mal d 1P43211Go!158113.71.9e-27
38Bet v 1.1401CAA57497Go!160113.22.6e-27
39Bet v 1.2001CAA96543Go!160113.03.1e-27
40Bet v 1.1901CAA96542Go!160112.64.1e-27
41Bet v 1.0301CAA54481Go!160112.44.8e-27
42Bet v 1.0901CAA54488Go!160112.25.6e-27
43Bet v 1.1801CAA96540Go!160112.06.5e-27
44Que a 1.0301ABZ81046Go!160112.06.5e-27
45Bet v 1.0201CAA54421Go!160112.06.5e-27
46Bet v 1.1401P43186Go!159111.77.5e-27
47Bet v 1.at10CAA07319Go!160111.31.0e-26
48Bet v 1P43176Go!159110.91.4e-26
49Bet v 1.at42CAA07324Go!160110.91.4e-26
50Bet v 1P43184Go!159110.71.6e-26
51Bet v 1.at5CAA07329Go!160110.71.6e-26
52Bet v 1P45431Go!159110.41.8e-26
53Que a 1.0401ABZ81047Go!160110.22.1e-26
54Bet v 1.2901CAB02160Go!160110.22.1e-26
55Bet v 1.1101CAA54694Go!160110.22.1e-26
56Car b 1.0302CAB02217Go!161110.22.2e-26
57Bet v 1CAA05188Go!160110.02.5e-26
58Mal d 1CAA96535Go!160109.82.9e-26
59Bet v 1CAA05189Go!160109.82.9e-26
60Bet v 1.2801CAB02159Go!160109.63.4e-26
61Bet v 1.1501CAA96538Go!160109.63.4e-26
62Bet v 1.0101CAA33887Go!160109.63.4e-26
63Bet v 1.1501Q42499Go!160109.63.4e-26
64Bet v 1.at50CAA07326Go!160109.43.9e-26
65Bet v 1.2501CAB02156Go!160109.43.9e-26
66Mal d 1CAA96534Go!159109.14.5e-26
67Car b 1.0301CAB02216Go!161109.24.5e-26
68Bet v 1.0801CAA54487Go!160108.95.3e-26
69Bet v 1.1201CAA54695Go!159108.76.1e-26
70Bet v 1.2301CAA96545Go!160108.76.1e-26
71Bet v 1.1701CAA96539Go!160108.76.1e-26
72Bet v 1.0501CAA54483Go!160108.76.1e-26
73Bet v 1.0601CAA54484Go!160108.38.2e-26
74Bet v 1.0101P15494Go!159108.19.5e-26
75Bet v 1.at45CAA07325Go!160108.19.6e-26
76Mal d 1CAA96536Go!160107.91.1e-25
77Bet v 1.at59CAA07327Go!160107.91.1e-25
78Mal d 1CAA96537Go!160107.91.1e-25
79Bet v 1CAA05190Go!160107.91.1e-25
80Bet v 1P43183Go!159107.41.5e-25
81Bet v 1P43178Go!159107.21.7e-25
82Bet v 1.1601CAA96546Go!160107.21.7e-25
83Bet v 1.3001CAB02161Go!160107.21.7e-25
84Bet v 1.at7CAA07330Go!160107.02.0e-25
85Bet v 1.0601P43179Go!159106.82.3e-25
86Car b 1.0104CAB02207Go!160106.82.3e-25
87Bet v 1.at37CAA07323Go!160106.82.3e-25
88Car b 1.0109ABZ81040Go!160106.82.3e-25
89Car b 1.0112ABZ81043Go!160106.82.3e-25
90Bet v 1CAA05186Go!160106.62.7e-25
91Bet v 1.2401CAB02155Go!160106.62.7e-25
92Car b 1.0110ABZ81041Go!160106.62.7e-25
93Bet v 1.at8CAA07318Go!160106.62.7e-25
94Bet v 1.2101CAA96544Go!160106.33.2e-25
95Car b 1P38950Go!159106.13.7e-25
96Car b 1.0106CAB02209Go!160106.13.7e-25
97Aln g 1AAB24432Go!160106.13.7e-25
98Bet v 1.0401CAA54482Go!160105.94.3e-25
99Bet v 1.1001CAA54489Go!160105.94.3e-25
100Car b 1.0111ABZ81042Go!160105.74.9e-25
101Ost c 1.0101ADK39021Go!160105.74.9e-25
102Car b 1.0103CAB02206Go!160105.55.7e-25
103Bet v 1.2601CAB02157Go!160105.55.7e-25
104Bet v 1.0701CAA54485Go!160105.36.7e-25
105Bet v 1.2701CAB02158Go!160104.89.0e-25
106Cor a 1.0103CAA50325Go!160104.89.0e-25
107Car b 1.0105CAB02208Go!160104.89.0e-25
108Aln g 1P38948Go!159104.61.0e-24
109Car b 1.0113ABZ81044Go!160104.61.0e-24
110Bet v 1.0401P43177Go!159104.41.2e-24
111Bet v 1P43185Go!159104.41.2e-24
112Car b 1.0107CAB02213Go!160104.21.4e-24
113Bet v 1P43180Go!159103.81.9e-24
114Bet v 1.2201CAA96547Go!160103.81.9e-24
115Que a 1.0201ABZ81045Go!159103.52.2e-24
116Cor a 1.0101CAA50327Go!160103.32.6e-24
117Car b 1.0102CAA47357Go!159102.93.4e-24
118Cor a 1.0102CAA50328Go!160102.74.0e-24
119Car b 1.0108CAB02215Go!160102.06.3e-24
120Cor a 1Q08407Go!159101.87.3e-24
121Car b 1P38949Go!159101.21.1e-23
122Act c 8.0101CAM31908Go!159100.12.4e-23
123Cor a 1.0104CAA50326Go!16097.12.0e-22
124Rub i 1.0101Q0Z8U9Go!13791.86.4e-21
125Act d 8.0101CAM31909Go!15788.76.6e-20
126Bet v 1.at87CAA07328Go!12083.12.3e-18
127Bet v 1.at14CAA07320Go!12082.92.7e-18
128Lyc e 4.0101CAA75803Go!17883.13.5e-18
129Api g 1.0201P92918Go!15977.41.6e-16
130Api g 1P49372Go!15476.82.4e-16
131Dau c 1.0201AAL76932Go!15476.13.8e-16
132Pet c PR10CAA67246Go!15575.75.1e-16
133Tar o RAPAAB92255Go!15771.68.9e-15
134Dau c 1.0103CAB03715Go!15471.41.0e-14
135Dau c 1.0105CAB06416Go!15471.21.2e-14
136Dau c 1.0102BAA13604Go!15470.32.1e-14
137Dau c 1.0101AAB01092Go!16869.73.6e-14
138Dau c 1.0104CAB03716Go!15469.05.3e-14
139Fra a 1.0101Q5ULZ4Go!10058.93.8e-11
140Que a 1.0101P85126Go!5041.14.2e-06
141Vig r 6.0101Q9ZWP8Go!15534.51.3e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ara h 8.0101, Sequence: AAQ91847
Sequence identity: 100.00 (157/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPG
           MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPG
Sequence 2 MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPG

Sequence 1 TIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFE
           TIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFE
Sequence 2 TIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFE

Sequence 1 TKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYV
           TKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYV
Sequence 2 TKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYV

Sequence 1 LANPTQY
           LANPTQY
Sequence 2 LANPTQY



Alignment 2
Sequence 1:
Sequence 2: Allergen Gly m 4, Sequence: CAA42646
Sequence identity: 70.70 (111/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDDVKSVEIVEGNGGP
           MGVFTFEDEI-S-V-PA-LY-A---DAD---PK--D--KSVE-VEGNGGP
Sequence 2 MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGP

Sequence 1 GTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITF
           GTIKK-T--EDGETKF-LHK-ESIDEAN--Y-YSVVGG-ALP-TAEKITF
Sequence 2 GTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITF

Sequence 1 ETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGY
           --KLV-GPNGGS-GKLT-KY-TKGDA-P---ELK-GKAK---LF-AIE-Y
Sequence 2 DSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAY

Sequence 1 VLANPTQY
           -LA-P---
Sequence 2 LLAHPDYN



Alignment 3
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43637
Sequence identity: 70.06 (110/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKII-DDVKSVEIVEGNGG
           MGVFTFED--TS-V-PA-LY-A--KDAD-I-PK---D--KSVEIVEGNGG
Sequence 2 MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK---VEDGETKF-LHK-ESIDEAN--Y-YS-VGGVALP-TAEKIT
Sequence 2 PGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKIT

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           F--KL--GPNGGS--KL---YH-KGDA-P-E-ELK-GKAK---LF-A-E-
Sequence 2 FDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKAGKAKSDSLFKAVEA

Sequence 1 YVLANPTQY
           Y-LANP---
Sequence 2 YLLANP---



Alignment 4
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43636
Sequence identity: 67.52 (106/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDDVKSVEIVEGNGGP
           M-VFTFED--TS-V-PA-LY-A--KDAD-I-PK--D--KSVEIVEGNGGP
Sequence 2 MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGP

Sequence 1 GTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITF
           GTIKK---VEDGETKF-LHK-E-IDEAN--Y-YS-VGG-ALP-TAEKI--
Sequence 2 GTIKKISFVEDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISI

Sequence 1 ETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGY
           --KL--GPNGGS--KL--KYH-KGDA-P-E-ELK-GKAK---LF--IE-Y
Sequence 2 DSKLSDGPNGGSVVKLSIKYHSKGDAPPNEDELKAGKAKSDALFKVIEAY

Sequence 1 VLANPTQY
           -LANP---
Sequence 2 LLANP---



Alignment 5
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: P25985
Sequence identity: 69.43 (109/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKII-DDVKSVEIVEGNGG
           -GVFTFED--TS-V-PA-LY-A--KDAD-I-PK---D--KSVEIVEGNGG
Sequence 2 -GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK---VEDGETKF-LHK-ESIDEAN--Y-YS-VGGVALP-TAEKIT
Sequence 2 PGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKIT

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           F--KL--GPNGGS--KL---YH-KGDA-P-E-ELK-GKAK---LF-A-E-
Sequence 2 FDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKAGKAKSDSLFKAVEA

Sequence 1 YVLANPTQY
           Y-LANP---
Sequence 2 YLLANP---



Alignment 6
Sequence 1:
Sequence 2: Allergen Vig r 1.0101, Sequence: Q2VU97
Sequence identity: 66.24 (104/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDDVKSVEIVEGNGGP
           M-VFTF-D--TS-V-PA-LYNA--KDAD-I-PK------SVEIVEGNGGP
Sequence 2 MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVGSFQSVEIVEGNGGP

Sequence 1 GTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITF
           GTIKK---VEDGETKF-LHK-ES-DEAN--Y-YS-VGGVALP-TAEKIT-
Sequence 2 GTIKKISFVEDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITI

Sequence 1 ETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGY
           -TK---G--GGS--KLT--YH-KGDA-P-E-ELK-GKAK---LF-A-E-Y
Sequence 2 DTKISDGADGGSLIKLTISYHGKGDAPPNEDELKAGKAKSDALFKAVEAY

Sequence 1 VLANPTQY
           -LANP---
Sequence 2 LLANP---



Alignment 7
Sequence 1:
Sequence 2: Allergen Ara h 8.0201, Sequence: EF436550
Sequence identity: 54.78 (86/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDDVKSVEIVEGNGGP
           MGV-TFE-E-TS-VPPAKL--A---D-D--TPK-I----S-EIVEGNGGP
Sequence 2 MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPAIQSIEIVEGNGGP

Sequence 1 GTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITF
           GT-KK-T-VEDG-T---LHK---IDEA-Y-Y-Y---GG-------EK--F
Sequence 2 GTVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSF

Sequence 1 ETKLVEGPNGGSIGKLTLKYHTKGDAK-PDEEELKKGKAKGEGLFRAIEG
           -TKL-E---GGS--K-----HTKGDA--PDE------K-K--G-F-AIEG
Sequence 2 KTKL-EAADGGSKIKVSVTFHTKGDAPLPDEVH-QDVKQKSQGIFKAIEG

Sequence 1 YVLANPTQY
           YVL-N----
Sequence 2 YVLSN----



Alignment 8
Sequence 1:
Sequence 2: Allergen Bet v 1.1301, Sequence: CAA54696
Sequence identity: 52.87 (83/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKII-DDVKSVEIVEGNGG
           MGVF--EDE-TS---PA-L------DAD---PK-----V-S-E--EGNGG
Sequence 2 MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K---H-V--ID-AN--Y-YS---G--L--T-EKI-
Sequence 2 PGTIKKITFPEGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K-T-KYHTKGD----EEE-K-GK-KG-GLF-A-E-
Sequence 2 YEIKIVAAPGGGSILKITSKYHTKGDISLNEEEIKAGKEKGAGLFKAVEN

Sequence 1 YVLANPTQY-
           Y--A-P--Y-
Sequence 2 YLVAHPNAYN



Alignment 9
Sequence 1:
Sequence 2: Allergen Cor a 1.0401, Sequence: AAD48405
Sequence identity: 54.14 (85/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--EDE-TS--PPA-L------DAD---PK-------S-E--EGNGG
Sequence 2 MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--E-K---HKVE-ID-AN--Y-YS---G--L--T-EKI-
Sequence 2 PGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS

Sequence 1 FETKLVEGPNGG-SIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIE
           -E-K----P-GG-SI-K-T-KYHTKG-A---EEE-K-GK-K--GLF-A-E
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAVE

Sequence 1 GYVLANPTQY-
           -Y-LA-P--Y-
Sequence 2 AYLLAHPDAYC



Alignment 10
Sequence 1:
Sequence 2: Allergen Cor a 1.0404, Sequence: AAG40331
Sequence identity: 54.14 (85/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--EDE-TS--PPA-L------DAD---PK-------S-E--EGNGG
Sequence 2 MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--E-K---HKVE-ID-AN--Y-YS---G--L--T-EKI-
Sequence 2 PGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIP

Sequence 1 FETKLVEGPNGG-SIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIE
           -E-K----P-GG-SI-K-T-KYHTKG-A---EEE-K-GK-K--GLF-A-E
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAVE

Sequence 1 GYVLANPTQY-
           -Y-LA-P--Y-
Sequence 2 AYLLAHPDAYC



Alignment 11
Sequence 1:
Sequence 2: Allergen Cor a 1.0402, Sequence: AAG40329
Sequence identity: 53.50 (84/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--EDE-TS--PPA-L------DAD---PK---------E--EGNGG
Sequence 2 MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--E-K---HKVE-ID-AN--Y-YS---G--L--T-EKI-
Sequence 2 PGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS

Sequence 1 FETKLVEGPNGG-SIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIE
           -E-K----P-GG-SI-K-T-KYHTKG-A---EEE-K-GK-K--GLF-A-E
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVE

Sequence 1 GYVLANPTQY-
           -Y-LA-P--Y-
Sequence 2 AYLLAHPDTYC



Alignment 12
Sequence 1:
Sequence 2: Allergen Cor a 1.0403, Sequence: AAG40330
Sequence identity: 53.50 (84/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--EDE-TS--PPA-L------DAD---PK---------E--EGNGG
Sequence 2 MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--E-K---HKVE-ID-AN--Y-YS---G--L--T-EKI-
Sequence 2 PGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS

Sequence 1 FETKLVEGPNGG-SIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIE
           -E-K----P-GG-SI-K-T-KYHTKG-A---EEE-K-GK-K--GLF-A-E
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVE

Sequence 1 GYVLANPTQY-
           -Y-LA-P--Y-
Sequence 2 AYLLAHPDTYC



Alignment 13
Sequence 1:
Sequence 2: Allergen Cas s 1, Sequence: CAD10374
Sequence identity: 50.96 (80/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVFT-E-EITS--PP--L--A---DAD---PK------KS-EI-EGNGG
Sequence 2 MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K---H----ID-AN--Y-YSV--G-------EKI-
Sequence 2 PGTIKKITFGEGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K-T-KYHTKG-----EE----GK-K--GLF-A-E-
Sequence 2 YEIKIVASPDGGSILKNTSKYHTKGEQEIKEEKVMAGKEKAAGLFKAVEA

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 14
Sequence 1:
Sequence 2: Allergen Fag s 1.0101, Sequence: ACJ23864
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVFT-E-E-T----PA-L--A---DAD---PK------KS-EI-EG-GG
Sequence 2 MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H----ID-AN--Y------G-A---T-EKI-
Sequence 2 PGTIKKITFGEGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIA

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-KLV--P-GGSI-K-T-KYHTKGD----E---K-GK----G-F-A-E-
Sequence 2 YEIKLVASPDGGSILKSTSKYHTKGDHEIKEDQIKAGKEEASGIFKAVEA

Sequence 1 YVLANPTQY-
           Y-LANP--Y-
Sequence 2 YLLANPAAYH



Alignment 15
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S2
Sequence identity: 51.59 (81/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-T-E-E-TS--P--KL--A---DAD---PKI----VK--EI-EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--SID--N--Y-YS---G-AL----EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKID

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV--P-GG-I-K-T-KYHTKGD----EE--K-GK-K---LF--IEG
Sequence 2 YETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEG

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPSEYN



Alignment 16
Sequence 1:
Sequence 2: Allergen Cor a 1.0301, Sequence: CAA96549
Sequence identity: 50.96 (80/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--PPA-L------D-D---PK------KS-EI-EGNGG
Sequence 2 MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E------I--KVE-ID-AN--Y-YSV--G-AL----EKI-
Sequence 2 PGTIKKICFDEGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKIN

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHT-GD-----E--K-GK-K--GLF-A-EG
Sequence 2 YEIKIVASPHGGSILKSISKYHTIGDHELKDEQIKAGKEKASGLFKAVEG

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 17
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q3T923
Sequence identity: 50.96 (80/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-T-E-E-TS--P--KL--A---DAD---PKI----VK--EI-EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--SID--N--Y-YS---G-AL----EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV--P-GG---K-T-KYHTKGD----EE--K-GK-K---LF--IEG
Sequence 2 YETKLVSAPHGGTVIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPSEYN



Alignment 18
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S7
Sequence identity: 50.96 (80/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-T-E-E-TS--P--KL--A---DAD---PKI-----K--EI-EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--SID--N--Y-YS---G-AL----EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV--P-GG-I-K-T-KYHTKGD----EE--K-GK-K---LF--IEG
Sequence 2 YETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPSEYN



Alignment 19
Sequence 1:
Sequence 2: Allergen Pru av 1, Sequence: O24248
Sequence identity: 50.96 (80/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVFT-E-E-TS--PP--L--A---DAD---PKI-----K--EI-EG-GG
Sequence 2 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--SID--NY-Y-Y----G-AL--T-EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV--P-GGSI-K-T--YHTKG-----EE--K-GK-K---LF--IE-
Sequence 2 YETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIET

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKGHPDAYN



Alignment 20
Sequence 1:
Sequence 2: Allergen Pru p 1.0101, Sequence: Q2I6V8
Sequence identity: 50.32 (79/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVFT-E-E-TS--PP--L--A---DAD---PKI-----K--EI-EG-GG
Sequence 2 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--SID--N--Y-Y----G-AL----EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV--P-GGSI-K-T--YHTKGD----EE--K-GK-K---LF--IE-
Sequence 2 YETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIET

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKGHPDAYN



Alignment 21
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26555
Sequence identity: 49.68 (78/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EGNGG
Sequence 2 MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H---SIDEA-Y-Y-Y----G-AL--T-EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV----G--I------YHTKG-----EE--K-GKAK--GLF--IE-
Sequence 2 YETKLVACGSGSTIKSIS-HYHTKGNIEIKEEHVKAGKAKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKGHPDAYN



Alignment 22
Sequence 1:
Sequence 2: Allergen Pru ar 1, Sequence: O50001
Sequence identity: 49.68 (78/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVFT-E-E-TS--PP-KL--A---DAD---PK-----VK--EI-EG-GG
Sequence 2 MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GTIKK-T--E--------H-V--ID--N--Y-Y----G-AL----E-I-
Sequence 2 VGTIKKVTFGEGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIA

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           ---KLV--P-GGSI-K-T--YHTKGD----EE--K-GK-K--GLF---E-
Sequence 2 YDIKLVASPDGGSIVKTTSHYHTKGDVEIKEEQVKAGKEKAAGLFKLVEA

Sequence 1 YVLANPTQY-
           Y-LANP--Y-
Sequence 2 YLLANPDAYN



Alignment 23
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26559
Sequence identity: 50.32 (79/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--S-DEANY-Y-Y----G-AL--T-EK--
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV-----GSI-K----YHTKGD----EE--K-GK-K--GLF--IE-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKGHPDAYN



Alignment 24
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S6
Sequence identity: 50.32 (79/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MG--T-E-E-TS--P--KL--A---DAD---PKI-----K--EI-EG-GG
Sequence 2 MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--SID--N--Y-YS---G-AL----EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV--P-GG-I-K-T-KYHTKGD----EE--K-GK-K---LF--IEG
Sequence 2 YETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPSEYN



Alignment 25
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26546
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H---SIDEA-Y-Y-Y----G-AL--T-EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV----G--I------YHTKG-----EE--K-GK-K--GLF--IE-
Sequence 2 YETKLVACGSGSTIKSIS-HYHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKGHPDAYN



Alignment 26
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA88833
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H---SIDEA-Y-Y-Y----G-AL--T-EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV----G--I------YH-KG-----EE--K-GK-KG-GLF--IE-
Sequence 2 YETKLVACGSGATIKSIS-HYHPKGNIEIKEEHVKVGKEKGHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKGHPDAYN



Alignment 27
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26548
Sequence identity: 49.68 (78/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--S-DEANY-Y-Y----G-AL--T-EK--
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKL------GSI-K----YHTKGD----EE--K-GK-K--GLF--IE-
Sequence 2 YETKLMAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKGHPDAYN



Alignment 28
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26547
Sequence identity: 49.68 (78/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--S-DEANY-Y-Y----G-AL--T-EK--
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV-----GSI-K----YHTKGD----EE--K-GK-K--GLF--IE-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           -----P--Y-
Sequence 2 HLKGHPDAYN



Alignment 29
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA58646
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H---SIDEA-Y-Y-Y----G-AL--T-EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV----G--I------YHTKG-----EE--K-GK-K--GLF--IE-
Sequence 2 YETKLVACGSGSTIKSIS-HYHTKGNIEIKEEHVKVGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPDAYN



Alignment 30
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26558
Sequence identity: 49.68 (78/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--S-DEANY-Y-Y----G-AL--T-EK--
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV-----GSI-K----YHTKGD----EE----GK-K--GLF--IE-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVMAGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKGHPDAYN



Alignment 31
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26552
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EGNGG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H---SIDEA-Y-Y-Y----G-AL--T-EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV----G--I------YHTKG-----EE--K-GK-K--GLF--IE-
Sequence 2 YETKLVACGSGSTIKSIS-HYHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPDAYN



Alignment 32
Sequence 1:
Sequence 2: Allergen Pyr c 1, Sequence: O65200
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MG--TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EGNGG
Sequence 2 MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H-V-SIDEA-Y-Y-Y----G-AL--T-EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-KLV----G--I------YHTKGD----EE--K-GK-K--GLF--IE-
Sequence 2 YEAKLVASGSGSTIKSIS-HYHTKGDIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPDAYN



Alignment 33
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S4
Sequence identity: 50.96 (80/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-T-E-E-TS--P--KL--A---DAD---PKI----VK--EI-EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------HK--SID--N--Y-YS---G-AL----EKI-
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV--P-G--I-K-T-KYHTKGD----EE--K-GK-K---LF--IEG
Sequence 2 YETKLVSAPHG-TIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPSEYN



Alignment 34
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26554
Sequence identity: 48.41 (76/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H---SIDEA-Y-Y-Y----G-AL--T-E-I-
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV----G--I------YHTKG-----EE--K-GK-K--GLF--IE-
Sequence 2 YETKLVACGSGSTIKSIS-HYHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPDAYN



Alignment 35
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26553
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EGNGG
Sequence 2 MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H---SIDEA-Y-Y-Y----G-AL--T-EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV----G--I------YHTKG-----EE--K-GK-K--GLF--IE-
Sequence 2 YETKLVACGSGSTIKSIS-HYHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPDAYN



Alignment 36
Sequence 1:
Sequence 2: Allergen Cor a 1.0201, Sequence: CAA96548
Sequence identity: 49.68 (78/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-----PK-----V-SVE-VEGNGG
Sequence 2 MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----VE--D--N--Y-Y-V--G-------EKI-
Sequence 2 PGTIKKITFSEGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD---D-E--K-GK-K-EGLFRA-E-
Sequence 2 NEIKIVAAPDGGSILKISNKYHTKGDHEVDAEHIKGGKEKVEGLFRAVEA

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 37
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: P43211
Sequence identity: 48.41 (76/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GV-TFE-E-TS--PP--L--A---DAD---PKI-----K--EI-EGNGG
Sequence 2 -GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E--------H---SIDEA-Y-Y-Y----G-AL--T-EKI-
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV----G--I------YHTKG-----EE--K-GK-K--GLF--IE-
Sequence 2 YETKLVACGSGSTIKSIS-HYHTKGNIEIKEEHVKVGKEKAHGLFKLIES

Sequence 1 YVLANPTQY-
           Y----P--Y-
Sequence 2 YLKDHPDAYN



Alignment 38
Sequence 1:
Sequence 2: Allergen Bet v 1.1401, Sequence: CAA57497
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 39
Sequence 1:
Sequence 2: Allergen Bet v 1.2001, Sequence: CAA96543
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 40
Sequence 1:
Sequence 2: Allergen Bet v 1.1901, Sequence: CAA96542
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYAYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 41
Sequence 1:
Sequence 2: Allergen Bet v 1.0301, Sequence: CAA54481
Sequence identity: 48.41 (76/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 42
Sequence 1:
Sequence 2: Allergen Bet v 1.0901, Sequence: CAA54488
Sequence identity: 48.41 (76/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 43
Sequence 1:
Sequence 2: Allergen Bet v 1.1801, Sequence: CAA96540
Sequence identity: 49.04 (77/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-KLV--P-GGSI-K---KYHTKGD-----E--K--K-K-E-L-RA-E-
Sequence 2 NEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKAEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 44
Sequence 1:
Sequence 2: Allergen Que a 1.0301, Sequence: ABZ81046
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVFT-E-E--S--PPA-L--A---D-D---PK------KS-EI-EGNGG
Sequence 2 MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K---H----ID--N--Y--SV--G-AL----E---
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETK-V--P-GGSI-K-T-KY-TKGD-----E----GK-K----F-A-E-
Sequence 2 TETKIVASPDGGSIVKSTSKYQTKGDFQLTDELIRGGKEKASEVFKAVEA

Sequence 1 YVLANPTQY-
           Y--A-P--Y-
Sequence 2 YLVAHPDLYK



Alignment 45
Sequence 1:
Sequence 2: Allergen Bet v 1.0201, Sequence: CAA54421
Sequence identity: 48.41 (76/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 46
Sequence 1:
Sequence 2: Allergen Bet v 1.1401, Sequence: P43186
Sequence identity: 48.41 (76/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 47
Sequence 1:
Sequence 2: Allergen Bet v 1.at10, Sequence: CAA07319
Sequence identity: 47.77 (75/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-EG
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVEG

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 48
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43176
Sequence identity: 47.77 (75/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 49
Sequence 1:
Sequence 2: Allergen Bet v 1.at42, Sequence: CAA07324
Sequence identity: 48.41 (76/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-KLV--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 50
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43184
Sequence identity: 47.77 (75/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 51
Sequence 1:
Sequence 2: Allergen Bet v 1.at5, Sequence: CAA07329
Sequence identity: 47.77 (75/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-KLV--P-GGSI-----KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKLVATPDGGSILEISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 52
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P45431
Sequence identity: 47.77 (75/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 -GVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K-KGE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 53
Sequence 1:
Sequence 2: Allergen Que a 1.0401, Sequence: ABZ81047
Sequence identity: 46.50 (73/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDD-VKSVEIVEGNGG
           MGVFT-E---TS---PA-L--A---D-D----K------KS-EI-EGNGG
Sequence 2 MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K---H----ID--N--Y--SV--G-AL----E---
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETK-V--P-GGSI-K-T-KY-TKGD-----E----GK-K--G-F-A-E-
Sequence 2 TETKIVASPDGGSIAKSTSKYQTKGDFQLTDELIRGGKEKASGVFKAVEA

Sequence 1 YVLANPTQY-
           Y--A-P--Y-
Sequence 2 YLVAHPDLYK



Alignment 54
Sequence 1:
Sequence 2: Allergen Bet v 1.2901, Sequence: CAB02160
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 55
Sequence 1:
Sequence 2: Allergen Bet v 1.1101, Sequence: CAA54694
Sequence identity: 47.77 (75/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKII-DDVKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-----V--VE--EGNGG
Sequence 2 MGVFDYEGETTSVIPAARLFKAFILDGDNLIPKVAPQTVSCVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D--N--Y-YSV--G-A---T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHVNFKYSYSVIEGGAVGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKG------E--K--K-K-E-LFRA-E-
Sequence 2 NEIKIVPAPGGGSILKISNKYHTKGNHEMKAEQIKASKEKAEALFRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 56
Sequence 1:
Sequence 2: Allergen Car b 1.0302, Sequence: CAB02217
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-----PK-----V-SVE-VEGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----VE--D--N--Y-Y-V--G-------EKI-
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K-T-KYHTKGD-----E--K-GK---EGL----E-
Sequence 2 NEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKGGKERVEGLLKPVEA

Sequence 1 YVLANPTQY--
           Y-LA----Y--
Sequence 2 YLLAHTAEYNN



Alignment 57
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05188
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 58
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96535
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P---L--A---D-D---PKI-----KS-EI-EG-GG
Sequence 2 MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GTIKK-T--E----------V--ID--N--Y-YS---G--L----EKIT
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKIT

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKL---P-GGSI-K-T--YH-KGD----EE--K-GK-K--GLF---E-
Sequence 2 YETKLIASPDGGSIIKTTSHYHAKGDVEIKEEHVKAGKEKASGLFKLLEA

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 59
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05189
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 60
Sequence 1:
Sequence 2: Allergen Bet v 1.2801, Sequence: CAB02159
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 61
Sequence 1:
Sequence 2: Allergen Bet v 1.1501, Sequence: CAA96538
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 62
Sequence 1:
Sequence 2: Allergen Bet v 1.0101, Sequence: CAA33887
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 63
Sequence 1:
Sequence 2: Allergen Bet v 1.1501, Sequence: Q42499
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 64
Sequence 1:
Sequence 2: Allergen Bet v 1.at50, Sequence: CAA07326
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSLIPAARLFRAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 65
Sequence 1:
Sequence 2: Allergen Bet v 1.2501, Sequence: CAB02156
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 66
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96534
Sequence identity: 48.41 (76/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--PPA-L-NA---DAD---PKI----VKS-EI-EG-GG
Sequence 2 MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GTIKK----E--------H-----D--N--Y-YSV--G-A---T-EKI-
Sequence 2 VGTIKKINFGEGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKLV-----GS--K-T--YHTK-D----EE--K-GK-K---LF--IE-
Sequence 2 YETKLVAS-GSGSVIKSTSHYHTKSDVEIKEEHVKAGKEKASHLFKLIEN

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 67
Sequence 1:
Sequence 2: Allergen Car b 1.0301, Sequence: CAB02216
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-----PK-----V-SVE-VEGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----VE--D--N--Y-Y-V--G-------EKI-
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K-T-KYHTKGD-----E--K-GK---EGL----E-
Sequence 2 NEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKGGKERVEGLLKPVEA

Sequence 1 YVLANPTQY--
           Y-LA----Y--
Sequence 2 YLLAHTAEYNN



Alignment 68
Sequence 1:
Sequence 2: Allergen Bet v 1.0801, Sequence: CAA54487
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--Y-YSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--PNGGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 69
Sequence 1:
Sequence 2: Allergen Bet v 1.1201, Sequence: CAA54695
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A---D-D---PK-----V--VE--EGNGG
Sequence 2 -GVFDYEGETTSVIPAARLFKAFILDGDNLIPKVAPQAVSCVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D--N--Y-YSV--G-A---T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSYSVIEGGAVGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKG------E--K--K-K-E-LFRA-E-
Sequence 2 NEIKIVPAPGGGSILKISNKYHTKGNHEMKAEQIKASKEKAEALFRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 70
Sequence 1:
Sequence 2: Allergen Bet v 1.2301, Sequence: CAA96545
Sequence identity: 46.50 (73/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFFLDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----------V---D--N--Y-YSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFRYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD----EE--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKEEQIKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 71
Sequence 1:
Sequence 2: Allergen Bet v 1.1701, Sequence: CAA96539
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D-AN--Y-YSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGIPFKYVKDRVDEVDHANFKYSYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQIKASKEMGETLLRAVER

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 72
Sequence 1:
Sequence 2: Allergen Bet v 1.0501, Sequence: CAA54483
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--Y-YSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--PNGGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 73
Sequence 1:
Sequence 2: Allergen Bet v 1.0601, Sequence: CAA54484
Sequence identity: 47.13 (74/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--Y-YSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--PNGGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 74
Sequence 1:
Sequence 2: Allergen Bet v 1.0101, Sequence: P15494
Sequence identity: 46.50 (73/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 -GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 75
Sequence 1:
Sequence 2: Allergen Bet v 1.at45, Sequence: CAA07325
Sequence identity: 46.50 (73/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 76
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96536
Sequence identity: 45.86 (72/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P---L--A---D-D---PKI-----KS--I-EG-GG
Sequence 2 MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GTIKK-T--E----------V--ID--N--Y-YS---G--L----EKIT
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKIT

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKL---P-GGSI-K----YH-KGD----EE--K-GK-K--GLF---E-
Sequence 2 YETKLIASPDGGSIIKTNSHYHAKGDVEIKEEHVKAGKEKASGLFKLLEA

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 77
Sequence 1:
Sequence 2: Allergen Bet v 1.at59, Sequence: CAA07327
Sequence identity: 45.86 (72/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D-AN--Y-YS---G-AL--T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 78
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96537
Sequence identity: 46.50 (73/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P---L--A---D-D---PKI-----KS-EI-EG-GG
Sequence 2 MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GTIKK-T--E----------V--ID--N--Y-YS---G--L----EKIT
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKIT

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -ETKL---P-GGSI-K-T--Y--KGD----EE--K-GK-K--GLF---E-
Sequence 2 YETKLIASPDGGSIIKTTSHYRAKGDVEIKEEHVKAGKEKASGLFKLLEA

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 79
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05190
Sequence identity: 45.86 (72/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 80
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43183
Sequence identity: 46.50 (73/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 -GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--Y-YSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--PNGGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 81
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43178
Sequence identity: 46.50 (73/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 -GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--Y-YSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--PNGGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 82
Sequence 1:
Sequence 2: Allergen Bet v 1.1601, Sequence: CAA96546
Sequence identity: 45.22 (71/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L--A---D-D---PK-----V-SVE--EGNGG
Sequence 2 MGVFNYETETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D--N--Y--SV--G-A-----EK--
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-HTKGD-----E--K--K-K-EGL--A-E-
Sequence 2 NEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAEGLLKAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YHLAHSDAYN



Alignment 83
Sequence 1:
Sequence 2: Allergen Bet v 1.3001, Sequence: CAB02161
Sequence identity: 46.50 (73/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---KYHTKGD-----E--K--K---E-L-RA-E-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 84
Sequence 1:
Sequence 2: Allergen Bet v 1.at7, Sequence: CAA07330
Sequence identity: 45.22 (71/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKITFPEGSPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 85
Sequence 1:
Sequence 2: Allergen Bet v 1.0601, Sequence: P43179
Sequence identity: 46.50 (73/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 -GVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--Y-YSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--PNGGSI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 86
Sequence 1:
Sequence 2: Allergen Car b 1.0104, Sequence: CAB02207
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTDEYN



Alignment 87
Sequence 1:
Sequence 2: Allergen Bet v 1.at37, Sequence: CAA07323
Sequence identity: 45.22 (71/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 88
Sequence 1:
Sequence 2: Allergen Car b 1.0109, Sequence: ABZ81040
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 89
Sequence 1:
Sequence 2: Allergen Car b 1.0112, Sequence: ABZ81043
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 90
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05186
Sequence identity: 45.22 (71/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 91
Sequence 1:
Sequence 2: Allergen Bet v 1.2401, Sequence: CAB02155
Sequence identity: 45.22 (71/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 92
Sequence 1:
Sequence 2: Allergen Car b 1.0110, Sequence: ABZ81041
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGS--K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSVVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 93
Sequence 1:
Sequence 2: Allergen Bet v 1.at8, Sequence: CAA07318
Sequence identity: 45.22 (71/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVTTPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 94
Sequence 1:
Sequence 2: Allergen Bet v 1.2101, Sequence: CAA96544
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKASILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--Y--SV--G-A-----EK--
Sequence 2 PGTIKKISFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-HTKGD-----E--K--K-K--GL--A-E-
Sequence 2 NEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 95
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38950
Sequence identity: 45.86 (72/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A---D-----PK-----V-SVE-VEGNGG
Sequence 2 -GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----VE-ID--N--YNY-V--G--L----EK--
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KG------EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 96
Sequence 1:
Sequence 2: Allergen Car b 1.0106, Sequence: CAB02209
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 97
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: AAB24432
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L--A---D-D---PK-----V-SVE--EGNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D--N--Y--SV--G-A-----EK--
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-HTKGD-----E--K--K-K--GL--A-E-
Sequence 2 NEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 98
Sequence 1:
Sequence 2: Allergen Bet v 1.0401, Sequence: CAA54482
Sequence identity: 45.22 (71/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 99
Sequence 1:
Sequence 2: Allergen Bet v 1.1001, Sequence: CAA54489
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A----A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 100
Sequence 1:
Sequence 2: Allergen Car b 1.0111, Sequence: ABZ81042
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----E--K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 101
Sequence 1:
Sequence 2: Allergen Ost c 1.0101, Sequence: ADK39021
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK--------VE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 102
Sequence 1:
Sequence 2: Allergen Car b 1.0103, Sequence: CAB02206
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----E--K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTDEYN



Alignment 103
Sequence 1:
Sequence 2: Allergen Bet v 1.2601, Sequence: CAB02157
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-------EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 104
Sequence 1:
Sequence 2: Allergen Bet v 1.0701, Sequence: CAA54485
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 105
Sequence 1:
Sequence 2: Allergen Bet v 1.2701, Sequence: CAB02158
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK---------K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPGGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 106
Sequence 1:
Sequence 2: Allergen Cor a 1.0103, Sequence: CAA50325
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L------D-D---PK-------SVE-VEGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----K-----V---D--N--Y-Y-V--G--L----EK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEINAEEIKGAKEMAEKLLRAVET

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSAEYN



Alignment 107
Sequence 1:
Sequence 2: Allergen Car b 1.0105, Sequence: CAB02208
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----E--K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTDEYN



Alignment 108
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: P38948
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E--S--P-A-L--A---D-D---PK-----V-SVE--EGNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K-----V---D--N--Y--SV--G-A-----EK--
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-HTKGD-----E--K--K-K--GL--A-E-
Sequence 2 NEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 109
Sequence 1:
Sequence 2: Allergen Car b 1.0113, Sequence: ABZ81044
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--Y-Y-V--G--L----EK--
Sequence 2 PGTIKNITFAEGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 110
Sequence 1:
Sequence 2: Allergen Bet v 1.0401, Sequence: P43177
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 -GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 111
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43185
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A----A---D-D---PK-------SVE--EGNGG
Sequence 2 -GVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 112
Sequence 1:
Sequence 2: Allergen Car b 1.0107, Sequence: CAB02213
Sequence identity: 43.31 (68/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN----Y-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 LELKIVAAPGGGSILKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 113
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43180
Sequence identity: 43.95 (69/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E-TS--P-A-L--A-----D---PK-------SVE--EGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GG---K---KYHTKG------E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 114
Sequence 1:
Sequence 2: Allergen Bet v 1.2201, Sequence: CAA96547
Sequence identity: 45.22 (71/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V------N--Y-YSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-G-SI-K---KYHTKGD-----E--K--K--GE-L-RA-E-
Sequence 2 NEIKIVATPDGRSILKISNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSDAYN



Alignment 115
Sequence 1:
Sequence 2: Allergen Que a 1.0201, Sequence: ABZ81045
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDD-VKSVEIVEGNGG
           MGVFT-E---TS---PA-L--A---D-D----K------KS-EI-EGNGG
Sequence 2 MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK-T--E----K---H-----D--N--Y--SV--G-AL----E---
Sequence 2 PGTIKKITFGEASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K-T-KY-TKGD----EE-------K--GL--A-E-
Sequence 2 TEIKCVASPDGGSIMKSTTKYQTKGDFQLKEEQIQAAIEKAAGLLKAVEA

Sequence 1 YVLANPTQY-
           Y--A-P--Y-
Sequence 2 YLVAHPDLYK



Alignment 116
Sequence 1:
Sequence 2: Allergen Cor a 1.0101, Sequence: CAA50327
Sequence identity: 43.31 (68/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-VEGNGG
Sequence 2 MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----K-----V---D--N--Y-Y-V--G--L----EK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSAEYN



Alignment 117
Sequence 1:
Sequence 2: Allergen Car b 1.0102, Sequence: CAA47357
Sequence identity: 43.31 (68/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KG------EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 118
Sequence 1:
Sequence 2: Allergen Cor a 1.0102, Sequence: CAA50328
Sequence identity: 43.31 (68/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-VEGNGG
Sequence 2 MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----K-----V---D--N--Y-Y-V--G--L----EK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 SELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSAEYN



Alignment 119
Sequence 1:
Sequence 2: Allergen Car b 1.0108, Sequence: CAB02215
Sequence identity: 42.68 (67/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S--P-A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN----Y-V--G--L----EK--
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E---V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 LELTIVAAPGGGSILKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 120
Sequence 1:
Sequence 2: Allergen Cor a 1, Sequence: Q08407
Sequence identity: 42.68 (67/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           -GVF--E-E--S--P-A-L------D-D---PK-------SVE-VEGNGG
Sequence 2 -GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----K-----V---D--N--Y-Y-V--G--L----EK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSAEYN



Alignment 121
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38949
Sequence identity: 43.31 (68/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDDV-KSVEIVEGNGG
           -GVF--E-E--S--P-A-L------D-D---PK----V--SVE-V-GNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----KF----V---D-AN--YNY-V--G--L----EK--
Sequence 2 PGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K---K-H-KG------E--K--K---E-L-RA-E-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHTAEYN



Alignment 122
Sequence 1:
Sequence 2: Allergen Act c 8.0101, Sequence: CAM31908
Sequence identity: 44.59 (70/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-T---EI-S-VPP-KLY-A---D-D---PK------K-V-I-EG-G-
Sequence 2 MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGC

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GTIK--T--E----K-----V--ID--N--Y-Y----G--L----E-I-
Sequence 2 AGTIKEVTFGEGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           ---K-V--P-GGSI-K----Y-TKGD-K--EEE-K-GK-K----F-A-E-
Sequence 2 YHIKIVACPDGGSICKNRSIYTTKGDCKVSEEEIKLGKEKAAEIFKALEA

Sequence 1 YVLANPTQY
           Y-LANP---
Sequence 2 YLLANPDYC



Alignment 123
Sequence 1:
Sequence 2: Allergen Cor a 1.0104, Sequence: CAA50326
Sequence identity: 41.40 (65/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E--S----A-L------D-D---PK-------SVE-V-GNGG
Sequence 2 MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIK--T--E----K-----V---D--N--Y-Y-V--G--L----EK--
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVC

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGS--K---K-H-KGD-----EE-K--K---E-L-RA-E-
Sequence 2 SELKIVAAPGGGSTLKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YVLANPTQY-
           Y-LA----Y-
Sequence 2 YLLAHSAEYN



Alignment 124
Sequence 1:
Sequence 2: Allergen Rub i 1.0101, Sequence: Q0Z8U9
Sequence identity: 40.76 (64/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           ----------TS--PP-KL--A---DAD---PKI----VKSVEI-EG-GG
Sequence 2 ---------YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GT-KK----E--E-----HK----D--N--Y-YS---G-AL----EKI-
Sequence 2 VGTVKKIHLGEGTEHSYVKHKIDGLDKVNFVYSYSITEGDALGDKIEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-KLV----G-SI-K-T--YH-KG-A---EE--K-GK----GLF-----
Sequence 2 YEIKLVASGRG-SIIKTTSHYHCKGGAEIKEEQVKDGKERAAGLFKI---

Sequence 1 YVLANPTQY
           ---------
Sequence 2 ---------



Alignment 125
Sequence 1:
Sequence 2: Allergen Act d 8.0101, Sequence: CAM31909
Sequence identity: 38.85 (61/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MG--T---EI-S-----K---A---D-D-I-PK--------V---EG-GG
Sequence 2 MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GTIK--T--E----K---H-----D--N--Y-YS---G-AL----E-I-
Sequence 2 VGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALD-VFESIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           ---K-V--P-GG-I-K----Y--K-DA---EEE-K-GK----G-F---E-
Sequence 2 YHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEA

Sequence 1 YVLANPTQY
           Y-LANP---
Sequence 2 YLLANPDC-



Alignment 126
Sequence 1:
Sequence 2: Allergen Bet v 1.at87, Sequence: CAA07328
Sequence identity: 34.39 (54/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K----------------------------------
Sequence 2 NEIKIVATPDGGSILKISNN------------------------------

Sequence 1 YVLANPTQY
           ---------
Sequence 2 ---------



Alignment 127
Sequence 1:
Sequence 2: Allergen Bet v 1.at14, Sequence: CAA07320
Sequence identity: 34.39 (54/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGVF--E-E-TS--P-A-L--A---D-D---PK-------SVE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGTIKK----E----K-----V---D--N--YNYSV--G-----T-EKI-
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E-K-V--P-GGSI-K----------------------------------
Sequence 2 NEIKIVATPDGGSILKISNN------------------------------

Sequence 1 YVLANPTQY
           ---------
Sequence 2 ---------



Alignment 128
Sequence 1:
Sequence 2: Allergen Lyc e 4.0101, Sequence: CAA75803
Sequence identity: 36.31 (57/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDD-VKSVEIVEGNGG
           MGV-T---E-T-T--P--L--A---D-D---PK-----VK--E--EG-GG
Sequence 2 MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -G-IK----VE-G--K---HK---ID--N----YS---G--L----E-IT
Sequence 2 VGSIKQMNFVEGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESIT

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           ---K-----NGG---K-T--YHTKGD----EEE---G-------F-----
Sequence 2 YDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNVGRRENHEYFQGCRS

Sequence 1 YVLANPTQY-------------------
           ----------------------------
Sequence 2 IPSRESFCLRLNIDEKESGLHVRNYACT



Alignment 129
Sequence 1:
Sequence 2: Allergen Api g 1.0201, Sequence: P92918
Sequence identity: 39.49 (62/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV-----E--STV---K-Y-----D-D---PK------KSVEI-EG-GG
Sequence 2 MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GT-K-----E--E------KV--ID-A--AY-Y---GG--L----E---
Sequence 2 VGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVV

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -E---V----GG-I-K-T--Y-TKGDA---E---K----K----F-A-E-
Sequence 2 NEFVVVP-TDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEA

Sequence 1 YVLANPTQY-
           Y-LAN-----
Sequence 2 YLLANLQFLA



Alignment 130
Sequence 1:
Sequence 2: Allergen Api g 1, Sequence: P49372
Sequence identity: 36.94 (58/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDDV-KSVEIVEGNGG
           MGV-T---E-TS-V---K-------D-D---PK------KSVEI--G-GG
Sequence 2 MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           PGT-K--T----G--------------------YSV--G--L----E-I-
Sequence 2 PGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIE

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           ----LV----GGSI-K-T---HTKGDA---EE--K--------LF-A-E-
Sequence 2 NHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEA

Sequence 1 YVLANPTQY
           Y--AN----
Sequence 2 YLIAN----



Alignment 131
Sequence 1:
Sequence 2: Allergen Dau c 1.0201, Sequence: AAL76932
Sequence identity: 38.22 (60/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG
           MGV---E-E--STV---K-Y-----D-D---PK------KSVEI-EG-GG
Sequence 2 MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GT-------E--E------KV--ID-A---Y-Y---GG--L----E---
Sequence 2 VGTVRLVHLGEATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVV

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -----V----GG-I-K-T--Y-TKGDA---E---K----K----F-A-E-
Sequence 2 NQFVVVP-TDGGCIVKNTTIYNTKGDAVLPEDKVKEATEKSALAFKAVEA

Sequence 1 YVLANPTQY
           Y-LAN----
Sequence 2 YLLAN----



Alignment 132
Sequence 1:
Sequence 2: Allergen Pet c PR10, Sequence: CAA67246
Sequence identity: 35.03 (55/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDD-VKSVEIVEGNGG
           MGV---E--ITS-VP-AKL--A---D-D---P-------K--EI-EG-GG
Sequence 2 MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GT-K--T-------K----K---ID-------YS---G--L------I-
Sequence 2 VGTVKLVTLGDASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSIN

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -----V----GG-----T----TKGDA---EE--K---------F-A-E-
Sequence 2 NHLSFVPTADGGCTATSTAVFNTKGDAVVPEENIKFANDQNNLIFKAVEA

Sequence 1 YVLANPTQY
           Y-LAN----
Sequence 2 YLLAN----



Alignment 133
Sequence 1:
Sequence 2: Allergen Tar o RAP, Sequence: AAB92255
Sequence identity: 35.03 (55/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKI-IDDVKSVEIVEGNGG
           M-V--FE--ITS---P-----A---D-D-I-PK------KS----EG-GG
Sequence 2 MAVAEFE--ITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GTIK--T-----------HKV--ID--N----Y----G--L----E--T
Sequence 2 VGTIKSITYSDGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGT

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           ---K------GGS--K-------KGDAK---E-----K------F-AIE-
Sequence 2 HHLKFLPSADGGSVYKHSMVFKCKGDAKLTDENVSLMKEGLKKTFKAIET

Sequence 1 YVLANPTQY
           YV---P---
Sequence 2 YVISHPEAC



Alignment 134
Sequence 1:
Sequence 2: Allergen Dau c 1.0103, Sequence: CAB03715
Sequence identity: 35.03 (55/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGG
           MG------EITS-V---K-------D-D---PK------KSVE-V-G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GT----T--E--------------------Y---V--G--L----E-I-
Sequence 2 AGTVRIITLPEGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIE

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -----V----GGSI-K-T---HTKGDA---EE--K---A----LF-AIE-
Sequence 2 THMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEA

Sequence 1 YVLANPTQY
           Y--AN----
Sequence 2 YLIAN----



Alignment 135
Sequence 1:
Sequence 2: Allergen Dau c 1.0105, Sequence: CAB06416
Sequence identity: 37.58 (59/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGG
           MG------EITS-V---K-------D-D---PK------KSVE-V-G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GT----T--E--------------------Y---V--G--L----E-I-
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI-

Sequence 1 FETKLVEGP--NGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAI
           -ET-LV--P---GGSI-K-T---HTKGDA---EE--K---A----LF-AI
Sequence 2 -ETHLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAI

Sequence 1 EGYVLANPTQY
           E-Y--AN----
Sequence 2 EAYLIAN----



Alignment 136
Sequence 1:
Sequence 2: Allergen Dau c 1.0102, Sequence: BAA13604
Sequence identity: 34.39 (54/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGG
           MG------EITS-V---K-------D-D---PK------KSV--V-G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GT----T--E--------------------Y---V--G--L----E-I-
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIE

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           -----V----GGSI-K-T---HTKGDA---EE--K---A----LF-AIE-
Sequence 2 THMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEA

Sequence 1 YVLANPTQY
           Y--AN----
Sequence 2 YLIAN----



Alignment 137
Sequence 1:
Sequence 2: Allergen Dau c 1.0101, Sequence: AAB01092
Sequence identity: 34.39 (54/157)
Sequence 1 --------------MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIID
           --------------MG------EITS-V---K-------D-D---PK---
Sequence 2 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP

Sequence 1 DV-KSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSV
           ---KSV--V-G-GG-GT----T--E--------------------Y---V
Sequence 2 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV

Sequence 1 VGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKK
           --G--L----E-I------V----GGSI-K-T---HTKGDA---EE--K-
Sequence 2 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF

Sequence 1 GKAKGEGLFRAIEGYVLANPTQY
           --A----LF-AIE-Y--AN----
Sequence 2 ADAQNTALFKAIEAYLIAN----



Alignment 138
Sequence 1:
Sequence 2: Allergen Dau c 1.0104, Sequence: CAB03716
Sequence identity: 36.31 (57/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGG
           MG------EITS-V---K-------D-D---PK------KSV--V-G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           -GT----T--E--------------------Y---V--G--L----E-I-
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI-

Sequence 1 FETKLVEGP--NGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAI
           -ET-LV--P---GGSI-K-T---HTKGDA---EE--K--------LF-AI
Sequence 2 -ETHLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADEQNTALFKAI

Sequence 1 EGYVLANPTQY
           E-Y--AN----
Sequence 2 EAYLIAN----



Alignment 139
Sequence 1:
Sequence 2: Allergen Fra a 1.0101, Sequence: Q5ULZ4
Sequence identity: 26.11 (41/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFE
           ----------------L------------Y-Y--V-G-AL--T-EKI--E
Sequence 2 --------AFVLDADNLIPKKITFGEGSQYGYVKVEGDALSDTLEKIDYE

Sequence 1 TKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYV
           TKLV--P----I-K-T-KYHTKGD----EE--K-GK-K---LF--IEGY-
Sequence 2 TKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYL

Sequence 1 LANPTQY-
           ---P--Y-
Sequence 2 KDHPSEYN



Alignment 140
Sequence 1:
Sequence 2: Allergen Que a 1.0101, Sequence: P85126
Sequence identity: 15.29 (24/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDD-VKSVEIVEGNGG
           -GVFT-E---TS---PA-L--A---D-D----K------KS-EI-EGNGG
Sequence 2 -GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT
           P-------------------------------------------------
Sequence 2 P-------------------------------------------------

Sequence 1 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YVLANPTQY
           ---------
Sequence 2 ---------



Alignment 141
Sequence 1:
Sequence 2: Allergen Vig r 6.0101, Sequence: Q9ZWP8
Sequence identity: 23.57 (37/157)
Sequence 1 MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDD-VKSVEIVEGNGGP
           M----------S----A------KD-----PK-----VK-V---EG-GG-
Sequence 2 MVKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGV

Sequence 1 GTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPP--TAEKI
           GTI---------------------DE--------V--G--L-------K-
Sequence 2 GTILIFNFLPEVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKT

Sequence 1 TFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGL--FRA
           TF--KL-E-------------Y----D----EE-----K-----L---R-
Sequence 2 TF--KLSEIEEDKTLVNVKISYDHDSDI---EEKVTPTKTSQSTLMYLRR

Sequence 1 IEGYVLANPTQY
           -E-Y--------
Sequence 2 LERYLSNGSA--


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.