The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Gly m 6.0101

Sequence P04776

Full FASTA alignment

Sequence name:
Query sequence:
MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW
WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQG
GHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGE
DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFP
ALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER
VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANS
LLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Gly m glycinin G1AAA33966Go!495548.13.2e-157
2Gly m 6.0101P04776Go!495548.13.2e-157
3Gly m 6.0201P04405Go!485451.24.7e-128
4Gly m glycinin G2CAA68460Go!485451.24.7e-128
5Jug r 4.0101Q2TPW5Go!507255.63.6e-69
6Car i 4.0101ABW86978Go!505252.43.3e-68
7Cor a 9AAL73404Go!515231.85.5e-62
8Gly m 6.0301P11828Go!481208.07.8e-55
9Ara h 3O82580Go!507187.71.0e-48
10Ara h 3AAC63045Go!510187.71.1e-48
11Ara h 4AAD47382Go!530175.93.9e-45
12Pis v 5.0101EU410073Go!473160.91.1e-40
13Pru du 6.0101ADN39440Go!551152.44.8e-38
14Pru du 63EHK_AGo!531151.96.6e-38
15Ana o 2AAN76862Go!457134.01.3e-32
16Pru du 6.0201ADN39441Go!504131.49.2e-32
17Sin a 2.0101Q2TLW0Go!510128.09.5e-31
18Gly m 6.0401Q9SB11Go!563110.32.2e-25
19Gly m 6.0501Q7GC77Go!517106.13.8e-24
20Pis v 2.0101DQ631676Go!496103.71.9e-23
21Pis v 2.0201DQ631677Go!472102.54.1e-23
22Ses i 7.0101Q9AUD2Go!497100.81.4e-22
23Ber e 2AAO38859Go!46592.93.1e-20
24Fag e 1Q9XFM4Go!53886.82.6e-18
25Fag e 1BAA21758Go!56586.82.7e-18
26Fag e 1BAA21760Go!50482.16.2e-17
27Ses i 6.0101Q9XHP0Go!45981.96.5e-17
28Gly m Bd28KBAB21619Go!47346.14.0e-06
29Cor a 11AAL86739Go!44837.81.2e-03
30Gly m 5.0201Q9FZP9Go!55937.22.2e-03
31Gly m conglycininAAB01374Go!63936.34.7e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 100.00 (495/495)
Sequence 1 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
           MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
Sequence 2 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG

Sequence 1 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
           LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
Sequence 2 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF

Sequence 1 GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW
           GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW
Sequence 2 GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW

Sequence 1 WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQG
           WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQG
Sequence 2 WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQG

Sequence 1 GHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGE
           GHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGE
Sequence 2 GHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGE

Sequence 1 DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
           DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
Sequence 2 DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP

Sequence 1 RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFP
           RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFP
Sequence 2 RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFP

Sequence 1 ALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER
           ALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER
Sequence 2 ALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER

Sequence 1 VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANS
           VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANS
Sequence 2 VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANS

Sequence 1 LLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           LLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
Sequence 2 LLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA



Alignment 2
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 100.00 (495/495)
Sequence 1 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
           MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
Sequence 2 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG

Sequence 1 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
           LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
Sequence 2 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF

Sequence 1 GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW
           GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW
Sequence 2 GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW

Sequence 1 WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQG
           WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQG
Sequence 2 WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQG

Sequence 1 GHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGE
           GHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGE
Sequence 2 GHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGE

Sequence 1 DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
           DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
Sequence 2 DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP

Sequence 1 RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFP
           RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFP
Sequence 2 RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFP

Sequence 1 ALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER
           ALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER
Sequence 2 ALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER

Sequence 1 VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANS
           VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANS
Sequence 2 VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANS

Sequence 1 LLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           LLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
Sequence 2 LLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA



Alignment 3
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 83.64 (414/495)
Sequence 1 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
           MAKLV-SLCFLLFSGC---F--REQ-QQNECQIQKLNALKPDNRIESEGG
Sequence 2 MAKLVLSLCFLLFSGC---FALREQAQQNECQIQKLNALKPDNRIESEGG

Sequence 1 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
           -IETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQG-GIF
Sequence 2 FIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIF

Sequence 1 GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW
           GMI-PGCPST--EPQ--QQRG-S-RPQDRHQK---FREGDLIAVPTGVAW
Sequence 2 GMIFPGCPSTYQEPQESQQRGRSQRPQDRHQKVHRFREGDLIAVPTGVAW

Sequence 1 WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQ-
           WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQ-Q-
Sequence 2 WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQ

Sequence 1 GGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEG
           GG-QSQKGK-QQEEENEG--ILSGF--EFL--AF-V--QI--NLQGENE-
Sequence 2 GGSQSQKGK-QQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQGENEE

Sequence 1 EDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQR
           ED-GAIVTVKGGL-V--P-----QQ---EE----E-E-PQC---DK-CQR
Sequence 2 EDSGAIVTVKGGLRVTAPAMRKPQQ---EEDDDDEEEQPQCVETDKGCQR

Sequence 1 PRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDF
           ----QSK--RNGIDETICTMRLR-NIGQ-SSPDIYNPQAGS-TTATSLDF
Sequence 2 ----QSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDF

Sequence 1 PALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGE
           PAL--L-LSA--GSLRKNAMFVPHY-LNANSIIYALNGRAL-QVVNCNGE
Sequence 2 PALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGE

Sequence 1 RVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGAN
           RVFDGELQEG-VLIVPQNF-VAA-SQSDNFEYVSFKTND-P-IG-LAGAN
Sequence 2 RVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGAN

Sequence 1 SLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           SLLNALPEEVIQHTFNLKSQQARQ-KNNNPF-FLVPPQESQ-RAVA
Sequence 2 SLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA



Alignment 4
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 83.64 (414/495)
Sequence 1 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
           MAKLV-SLCFLLFSGC---F--REQ-QQNECQIQKLNALKPDNRIESEGG
Sequence 2 MAKLVLSLCFLLFSGC---FALREQAQQNECQIQKLNALKPDNRIESEGG

Sequence 1 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
           -IETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQG-GIF
Sequence 2 FIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIF

Sequence 1 GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW
           GMI-PGCPST--EPQ--QQRG-S-RPQDRHQK---FREGDLIAVPTGVAW
Sequence 2 GMIFPGCPSTYQEPQESQQRGRSQRPQDRHQKVHRFREGDLIAVPTGVAW

Sequence 1 WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQ-
           WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQ-Q-
Sequence 2 WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQ

Sequence 1 GGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEG
           GG-QSQKGK-QQEEENEG--ILSGF--EFL--AF-V--QI--NLQGENE-
Sequence 2 GGSQSQKGK-QQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQGENEE

Sequence 1 EDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQR
           ED-GAIVTVKGGL-V--P-----QQ---EE----E-E-PQC---DK-CQR
Sequence 2 EDSGAIVTVKGGLRVTAPAMRKPQQ---EEDDDDEEEQPQCVETDKGCQR

Sequence 1 PRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDF
           ----QSK--RNGIDETICTMRLR-NIGQ-SSPDIYNPQAGS-TTATSLDF
Sequence 2 ----QSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDF

Sequence 1 PALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGE
           PAL--L-LSA--GSLRKNAMFVPHY-LNANSIIYALNGRAL-QVVNCNGE
Sequence 2 PALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGE

Sequence 1 RVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGAN
           RVFDGELQEG-VLIVPQNF-VAA-SQSDNFEYVSFKTND-P-IG-LAGAN
Sequence 2 RVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGAN

Sequence 1 SLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           SLLNALPEEVIQHTFNLKSQQARQ-KNNNPF-FLVPPQESQ-RAVA
Sequence 2 SLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA



Alignment 5
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 47.47 (235/495)
Sequence 1 -----MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRI
           ------------L---LF-GC------R-Q-Q---CQ---L-AL-P-NRI
Sequence 2 MAKPILLSIYLFLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRI

Sequence 1 ESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQ
           E-E-G-IE-W-PNN--FQCAGVA--R-T---N-L--P-Y-N-PQ--YI--
Sequence 2 EAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIAR

Sequence 1 GKGIFGMIYPGCPSTFEEPQQPQQRGQSSR-PQDRHQKIYNFREGDLIAV
           G-GI-G---PGCP-TFEE-Q---Q-GQS----QDRHQKI--FREGD-IA-
Sequence 2 GRGITGVLFPGCPETFEESQRQSQQGQSREFQQDRHQKIRHFREGDIIAF

Sequence 1 PTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFL-
           P-GVA-W-YN----PVVA-S--DTN---NQLDQ-PR-FYLAGN---EF--
Sequence 2 PAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRNFYLAGNPDDEFRP

Sequence 1 KYQQEQGGHQSQK------GKHQQEEENEGGSILSGFTLEFLEHAFSVDK
           --QQE---H--Q-------G-H-Q-----G----SGF---FL--AF-VD-
Sequence 2 QGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNNVFSGFDADFLADAFNVDT

Sequence 1 QIAKNLQGENEGEDKGAIVTVKG-GLSVIKPPTDEQQQRPQEEEEEEEDE
           --A--LQ-EN-------IV-V-G--L-VI-P-------R---EE-E-E--
Sequence 2 ETARRLQSEND--HRRSIVRVEGRQLQVIRP-------RWSREEQEREER

Sequence 1 KPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNP
           K-----------R----------NG--ETICT-RLR-NIG--S--DIY--
Sequence 2 KERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTE

Sequence 1 QAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALN
           -AG---T--S---P-L-WL-LSAE-G-L---A--VPH-NLNA-S--YAL-
Sequence 2 EAGRISTVNSHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALR

Sequence 1 GRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKT
           GRA--QVV---G--VFD-EL-EG--L--PQNF-V--R-----FE-VSFKT
Sequence 2 GRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARNEGFEWVSFKT

Sequence 1 NDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPP
           N---M---LAG--S---ALPEEV----F------AR--K-N-----LV--
Sequence 2 NENAMVSPLAGRTSAIRALPEEVLATAFQIPREDARRLKFNRQESTLVRS

Sequence 1 QESQKRAVA-------
           --S--R----------
Sequence 2 RPSRSRSSRSERRAEV



Alignment 6
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 47.27 (234/495)
Sequence 1 MAK---LVFSLCFL---LFSGCCFAFSSREQPQQNECQIQKLNALKPDNR
           MAK---L---LC-----LF-GC------R-Q-----CQ---L-AL-P-NR
Sequence 2 MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNR

Sequence 1 IESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQ
           IE-E-G-IE-W-PN----QCAGVA--R-T---N-L--P-Y-N-PQ--YI-
Sequence 2 IEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIA

Sequence 1 QGKGIFGMIYPGCPSTFEEPQQPQQRGQSSR-PQDRHQKIYNFREGDLIA
           -G-GI-G---PGCP-TFEE-Q---Q-GQ-----QDRHQKI--FREGD-IA
Sequence 2 RGRGITGVLFPGCPETFEESQRQSQQGQRREFQQDRHQKIRHFREGDIIA

Sequence 1 VPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFL
           -P-GVA-W-YN----PVVA----DT----NQLDQ-PR-FYLAGN---EF-
Sequence 2 FPAGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNPRNFYLAGNPDDEFR

Sequence 1 -KYQQE------QGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD
           ---QQE------Q--HQ---G-H-------G----SGF--EFL--AF-VD
Sequence 2 PQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGNNVFSGFDAEFLADAFNVD

Sequence 1 KQIAKNLQGENEGEDKGAIVTVKG-GLSVIKPPTDEQQQRPQEEEEEEED
           ---A--LQ-EN-----G-IV-V-G--L-VI-P-------R---EE-E-E-
Sequence 2 TETARRLQSEND--HRGSIVRVEGRQLQVIRP-------RWSREEQEHEE

Sequence 1 EKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYN
           -K-----------R----------NG--ETICT--LR-NIG--S--DIY-
Sequence 2 RKERERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYT

Sequence 1 PQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYAL
           --AG---T--S---P-L-WL-LSAE-G-L---A--VPH-NLNA-S--YAL
Sequence 2 EEAGRISTVNSHNLPILRWLQLSAERGALYSDALYVPHWNLNAHSVVYAL

Sequence 1 NGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFK
           -GRA--QVV---G--VFD-EL-EG--L--PQNF-V--R-----FE-VSFK
Sequence 2 RGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARDEGFEWVSFK

Sequence 1 TNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVP
           TN---M---LAG--S---ALPEEV----F------AR--K-N-----LV-
Sequence 2 TNENAMVSPLAGRTSAIRALPEEVLVNAFQIPREDARRLKFNRQESTLVR

Sequence 1 PQESQKRAVA----
           ------R-------
Sequence 2 SRSRSSRSERRAEV



Alignment 7
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 47.68 (236/495)
Sequence 1 MAKLV---FSLCFL-LFSGCC-FAFSSREQPQQ--NECQIQKLNALKPDN
           MAKL----FSLC-L-LF-GC-------R-Q-Q----EC----LNAL-P-N
Sequence 2 MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTN

Sequence 1 RIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYI
           RIE-E---IE-W--N---FQCAGVA--R-T---N-L--P-Y-N-P--IYI
Sequence 2 RIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYI

Sequence 1 QQGKGIFGMIYPGCPSTFEEPQQPQQRGQ------SSRP-QDRHQKIYNF
           --G-GI-G---PGCP-TFE-PQQ--Q-GQ------S-R--QDRHQKI--F
Sequence 2 ERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHF

Sequence 1 REGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAG
           REGD-IA-P-GVA-W-YN--D-PVV-VS---TN---NQLD--PR-FYLAG
Sequence 2 REGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAG

Sequence 1 NQEQEFLKYQQEQGGHQSQKGKH------QQEEENEGGSILSGFTLEFLE
           N---E-----Q-Q-G-------H-------QE---EG----SGF--EFL-
Sequence 2 NPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEFLA

Sequence 1 HAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE
           -AF-VD---A--LQ--N-------IV-V-G-L-V--P----Q----QE--
Sequence 2 DAFNVDVDTARRLQS-NQDKRRN-IVKVEGRLQVVRPERSRQEWERQERQ

Sequence 1 EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSS
           E-E--------------QR--G-------NG--ETIC--RLR-NI---S-
Sequence 2 ERESEQ-------ERERQRRQGGRGRDV-NGFEETICSLRLRENICTRSR

Sequence 1 PDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANS
           -DIY--Q-G---T--S---P-L-WL-LSAE-G-L------VPH-NLNA-S
Sequence 2 ADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHS

Sequence 1 IIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFE
           --YA--GRA--QVV--NG--VFD-EL--G-VL--PQNF-VA-R--S--FE
Sequence 2 VVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFE

Sequence 1 YVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF
           -V-FKTND---I--LAG--S---ALP--V----F------AR--K-N---
Sequence 2 WVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYNRQE

Sequence 1 KFLVPPQESQKRAVA----------
           --LV----S----------------
Sequence 2 TTLVRSSRSSSERKRRSESEGRAEA



Alignment 8
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 86.26 (427/495)
Sequence 1 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
           MAKLV-SLCFLLFSGCCFAFS-REQPQQNECQIQ-LNALKPDNRIESEGG
Sequence 2 MAKLVLSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGG

Sequence 1 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
           -IETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTN-PQEIYIQQG-GIF
Sequence 2 FIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIF

Sequence 1 GMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAW
           GMI-PGCPSTFEEPQQ----GQSSRPQDRHQKIY-FREGDLIAVPTG-A-
Sequence 2 GMIFPGCPSTFEEPQQ---KGQSSRPQDRHQKIYHFREGDLIAVPTGFAY

Sequence 1 WMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQ--QE
           WMYNNEDTPVVAVS-IDTNS--NQLDQMPRRFYLAGNQEQEFL-YQ----
Sequence 2 WMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQ

Sequence 1 QGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENE
           QGG-QSQKGK-QQEEENEGGSILSGF--EFLEHAF-VD-QI---LQGENE
Sequence 2 QGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFVVDRQIVRKLQGENE

Sequence 1 GEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQ
           -E-KGAIVTVKGGLSVI-PPT-EQQQRP-EEE------KP-C--KDKHCQ
Sequence 2 EEEKGAIVTVKGGLSVISPPTEEQQQRPEEEE------KPDCDEKDKHCQ

Sequence 1 RPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLD
           ----SQS---RNGIDETICTMRLRHNIGQTSSPDI-NPQAGS-TTATSLD
Sequence 2 ----SQS---RNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLD

Sequence 1 FPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNG
           FPALSWL-LSA-FGSLRKNAMFVPHYNLNANSIIYALNGRAL-QVVNCNG
Sequence 2 FPALSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNG

Sequence 1 ERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGA
           ERVFDGELQEG-VLIVPQNF-VAARSQSDNFEYVSFKTND-P-IG-LAGA
Sequence 2 ERVFDGELQEGQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGA

Sequence 1 NSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           NSLLNALPEEVIQ-TFNL--QQARQ-KNNNPF-FLVPP-ESQ-R-VA
Sequence 2 NSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSFLVPPKESQRRVVA



Alignment 9
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 59.80 (296/495)
Sequence 1 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
           ----------------------R-QP--N-CQ-Q-LNA--PDNRIESEGG
Sequence 2 ----------------------RQQPEENACQFQRLNAQRPDNRIESEGG

Sequence 1 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
           -IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-G-F
Sequence 2 YIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYF

Sequence 1 GMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDRHQKIYNFR
           G-I-PGCP---EEP-----R-QS-RP--------------D-HQK---F-
Sequence 2 GLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFD

Sequence 1 EGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGN
           EGDLIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-LAGN
Sequence 2 EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN

Sequence 1 QEQEFLKYQQE--QG----------GHQSQ----------KGKHQ-----
           -EQEFL-YQQ---Q-------------QSQ-----------G-H------
Sequence 2 TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERA

Sequence 1 -QEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAIVTV
           -QEEENEGG-I-SGFT-EFLE-AF-VD--QI--NL-GE-E-E--GAIVTV
Sequence 2 GQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTV

Sequence 1 KGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSR
           -GGL----P-------R--EEEE--EDE-------D----R-RG--S--R
Sequence 2 RGGLRILSP---DRKRRADEEEEYDEDEYEY----DEEDRR-RGRGSRGR

Sequence 1 RNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLS
           -NGI-ETICT-----NIG---SPDIYNPQAGS--TA--L----L-WL--S
Sequence 2 GNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPS

Sequence 1 AEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQE
           AE-G-L--NA-FV-HYN-NA-SIIY-L-GRA--QVV--NG-RV-D-ELQE
Sequence 2 AEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE

Sequence 1 GRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEE
           G-VL-VPQNF-VA--SQS-NFEYV-FKT---P-I--LAG-NS----LPEE
Sequence 2 GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEE

Sequence 1 VIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           V------L---QARQ-KNNNPFKF-VPP-----RAVA
Sequence 2 VVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA



Alignment 10
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 59.80 (296/495)
Sequence 1 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
           --------------------S-R-QP--N-CQ-Q-LNA--PDNRIESEGG
Sequence 2 -------------------ISFRQQPEENACQFQRLNAQRPDNRIESEGG

Sequence 1 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
           -IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-G-F
Sequence 2 YIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYF

Sequence 1 GMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDRHQKIYNFR
           G-I-PGCP---EEP-----R-QS-RP--------------D-HQK---F-
Sequence 2 GLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFD

Sequence 1 EGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGN
           EGDLIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-LAGN
Sequence 2 EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN

Sequence 1 QEQEFLKYQQEQG------------GHQSQ----------KGKHQ-----
           -EQEFL-YQQ-----------------QSQ-----------G-H------
Sequence 2 TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERA

Sequence 1 -QEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAIVTV
           -QEEENEGG-I-SGFT-EFLE-AF-VD--QI--NL-GE-E-E--GAIVTV
Sequence 2 GQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTV

Sequence 1 KGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSR
           -GGL----P-------R--EEEE--EDE-------D----R-RG--S--R
Sequence 2 RGGLRILSP---DRKRRADEEEEYDEDEYEY----DEEDRR-RGRGSRGR

Sequence 1 RNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLS
           -NGI-ETICT-----NIG---SPDIYNPQAGS--TA--L----L-WL--S
Sequence 2 GNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPS

Sequence 1 AEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQE
           AE-G-L--NA-FV-HYN-NA-SIIY-L-GRA--QVV--NG-RV-D-ELQE
Sequence 2 AEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE

Sequence 1 GRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEE
           G-VL-VPQNF-VA--SQS-NFEYV-FKT---P-I--LAG-NS----LPEE
Sequence 2 GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEE

Sequence 1 VIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           V------L---QARQ-KNNNPFKF-VPP-----RAVA
Sequence 2 VVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA



Alignment 11
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 60.40 (299/495)
Sequence 1 MAKLV---FSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIES
           MAKL----F--CFL--------F--R-QP--N-CQ-Q-LNA--PDNRIES
Sequence 2 MAKLLELSFCFCFLVLGASSISF--RQQPEENACQFQRLNAQRPDNRIES

Sequence 1 EGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGK
           EGG-IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-
Sequence 2 EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGR

Sequence 1 GIFGMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDRHQKIY
           G-FG-I-PGCPST-EEP-Q---R-QS-RP-------------QD-HQK--
Sequence 2 GYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVH

Sequence 1 NFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYL
           -F-EGDLIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-L
Sequence 2 RFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNL

Sequence 1 AGNQEQEFLKYQQE--QGGHQS--------------------QKGKHQ--
           AGN-EQEFL-YQQ---Q----S----------------------G-H---
Sequence 2 AGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRR

Sequence 1 ----QEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAI
           ----QEEE-EGG-I-SGFT-EFLE-AF-VD--QI--NL-GENE-E--GAI
Sequence 2 ERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAI

Sequence 1 VTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQS
           VTV-GGL----P----------EEEE--ED---Q---------R-RGS--
Sequence 2 VTVRGGLRILSP---DGTRGADEEEEYDED---QYEYHEQDGRRGRGSRG

Sequence 1 KSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWL
           ----NGI-ETICT-----NIG---SP-IY-PQ---------L----L-WL
Sequence 2 GG--NGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWL

Sequence 1 RLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGE
           -LSAE-G-L--NA-FVPHYN-NA-SIIYAL-GRA--QVV--NG-RV-D-E
Sequence 2 GLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEE

Sequence 1 LQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNAL
           LQEG-VL-VPQNF-VA--SQS-NFEYV-FKT---P-I---AG-NS----L
Sequence 2 LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNL

Sequence 1 PEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           PEEV------L---QARQ-KNNNPFKF-VPP-----RAVA
Sequence 2 PEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA



Alignment 12
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 47.68 (236/495)
Sequence 1 ---MAKLVFSLCFL-LFSGCCFAFSSREQ-PQQNECQIQKLNALKPDNRI
           ------L--S-C-L-LF-GC-----SR-Q--QQNECQI--L-AL-PDNR-
Sequence 2 MANPSLLSLSVCLLILFHGC---LASRQQGQQQNECQIDQLDALEPDNRV

Sequence 1 ESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQ
           E-E-G--ETW-PN---F-CAGVA--R-T---N-LR-P-Y-N-P---YI--
Sequence 2 EYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVE

Sequence 1 GKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVP
           G-G--G---PGCP-T---PQQ-QQ-GQSSR-QD-HQKI--FR-GD-IA-P
Sequence 2 GEGMTGTLIPGCPETYQAPQQGQQHGQSSRFQDKHQKIQRFRKGDIIALP

Sequence 1 TGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKY
           -GVA-W-YN----PVV-V---D-----NQLD--PR-F-LAGN-E-EF---
Sequence 2 AGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQQ

Sequence 1 QQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQG
           QQ-Q-------G--Q---------I--GF----L---F-V-----K-LQ-
Sequence 2 QQQQS-----RGRRQSQQKSCN-NIFCGFDTKILAEVFQVEQSLVKQLQ-

Sequence 1 ENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDK
           -NE----GAIV-VKG-L-VI-PP---Q--R--E-EEE-E-E-----G-D-
Sequence 2 -NEKDNRGAIVKVKGDLQVIRPPR-RQSERGFESEEESEYERGR-RGRD-

Sequence 1 HCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTAT
           --------------NG--ETICTM-L--NI---S--DIY-P--G--T---
Sequence 2 --------------NGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLN

Sequence 1 SLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVN
           SL--P-L-WL-LSAE-G-L--NA--VPH-N-NA-SI-Y---G-A--QVV-
Sequence 2 SLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVD

Sequence 1 CNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTL
           --G--VFDGE--EG----VPQNF-V--R-----FE--SFKTND--MI--L
Sequence 2 NFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPL

Sequence 1 AGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           AG--S-L-A-PEEV----F------AR-IK-NN----L---Q-SQ-----
Sequence 2 AGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDD

Sequence 1 -
           -
Sequence 2 A



Alignment 13
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 46.87 (232/495)
Sequence 1 MAK-LVFSLCFLL-FSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESE
           MAK--VFSLC-LL-F-GC--A--S---PQ-N-CQ---L-A--PDNRI--E
Sequence 2 MAKAFVFSLCLLLVFNGCLAARQSQLSPQ-NQCQLNQLQAREPDNRIQAE

Sequence 1 GGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKG
           -G-IETWN-N---FQCAGVA-SR-T--RN-L--PSY-N-PQ-IYI-QG-G
Sequence 2 AGQIETWNFNQEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRG

Sequence 1 IFGMIYPGCPSTFEEPQQP-------------------------------
           --G----GCP-TFEE-QQ--------------------------------
Sequence 2 VLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQ

Sequence 1 --------------------QQRGQSSRPQ--------DRHQKIYNFREG
           --------------------QQ-GQ--RPQ--------DRHQK----REG
Sequence 2 QERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDRHQKTRRIREG

Sequence 1 DLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQE
           D--A-P-GVA-W-YN--D---VAV------S--NQLDQ-PR-FYLAGN-E
Sequence 2 DVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPE

Sequence 1 QEFLKY---QQEQGGHQSQKGKHQQ--------EEENEGGSILSGFTLEF
           -EF------Q--Q-G-Q---G-HQQ--------E----G----SGF----
Sequence 2 NEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQL

Sequence 1 LEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQE
           L--A--V----A-NLQG-N-------I--V-G-L----PP------R---
Sequence 2 LAQALNVNEETARNLQGQNDNRNQ--IIRVRGNLDFVQPP------RGRQ

Sequence 1 EEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQT
           E-E-EE----Q--------Q---G-Q-----NG--ET-C--RL--NIG--
Sequence 2 EREHEERQQEQLQ-QERQQQ---GGQLMA--NGLEETFCSLRLKENIGNP

Sequence 1 SSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNA
           ---DI--P-AG---T--S---P-L--LRLSAE-G----N----PH-N-NA
Sequence 2 ERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNA

Sequence 1 NSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDN
           -S--Y---G-A--QVVN-NG----D-E-Q-G---IVPQN--V--------
Sequence 2 HSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQG

Sequence 1 FEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNN
           FEY--FKT-----I-TLAG--S-L-ALP-EV----------QARQ-K-N-
Sequence 2 FEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNR

Sequence 1 PFKFLVPPQESQKRAVA
           -----------Q-RAV-
Sequence 2 QETIALSSSQ-QRRAVV



Alignment 14
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 43.43 (215/495)
Sequence 1 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG
           ------------------A--S---PQ-N-CQ---L-A--PDNRI--E-G
Sequence 2 ------------------ARQSQLSPQ-NQCQLNQLQAREPDNRIQAEAG

Sequence 1 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF
           -IETWN-N---FQCAGVA-SR-T--RN-L--PSY-N-PQ-IYI-QG-G--
Sequence 2 QIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVL

Sequence 1 GMIYPGCPSTFEEPQQP---------------------------------
           G----GCP-TFEE-QQ----------------------------------
Sequence 2 GAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQE

Sequence 1 ------------------QQRGQSSRPQ--------DRHQKIYNFREGDL
           ------------------QQ-GQ--RPQ--------DRHQK----REGD-
Sequence 2 RQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDV

Sequence 1 IAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQE
           -A-P-GVA-W-YN--D---VAV------S--NQLDQ-PR-FYLAGN-E-E
Sequence 2 VAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENE

Sequence 1 FLKY---QQEQGGHQSQKGKHQQ--------EEENEGGSILSGFTLEFLE
           F------Q--Q-G-Q---G-HQQ--------E----G----SGF----L-
Sequence 2 FNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLA

Sequence 1 HAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE
           -A--V----A-NLQG-N-------I--V-G-L----PP---Q-----E--
Sequence 2 QALNVNEETARNLQGQNDNRNQ--IIQVRGNLDFVQPPRGRQEREHEERQ

Sequence 1 EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSS
           -E------Q--G-----------------NG--ET-C--RL--NIG----
Sequence 2 QEQLQQERQQQGEQLMA------------NGLEETFCSLRLKENIGNPER

Sequence 1 PDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANS
           -DI--P-AG---T--S---P-L--LRLSAE-G----N----PH-N-NA-S
Sequence 2 ADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHS

Sequence 1 IIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFE
           --Y---G-A--QVVN-NG----D-E-Q-G---IVPQN--V--------FE
Sequence 2 VVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFE

Sequence 1 YVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF
           Y--FKT-----I-TLAG--S-L-ALP-EV----------QARQ-K-N---
Sequence 2 YFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQE

Sequence 1 KFLVPPQESQKRAVA
           ---------Q-RAV-
Sequence 2 TIALSSSQ-QRRAVV



Alignment 15
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 47.47 (235/495)
Sequence 1 MAKLVFSLCFL-LFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEG
           ------S-CFL-LF-GC--A-S--E--QQ-ECQI--L-AL-PDNR-E-E-
Sequence 2 -----LSVCFLILFHGC-LA-SRQEWQQQDECQIDRLDALEPDNRVEYEA

Sequence 1 GLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGI
           G--E-W-PN---F-CAGVAL-R-T---N-L--P-Y-N-PQ-IY--QG-G-
Sequence 2 GTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGM

Sequence 1 FGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVA
           -G--YPGCP-T---PQQ--Q-GQS-R-QDRHQKI--FR-GD-IA-P-GVA
Sequence 2 TGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVA

Sequence 1 WWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQ
           -W-YN----PVV-V---D-----NQLD--PR-F-LAGN----F---QQ--
Sequence 2 HWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQ--

Sequence 1 GGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEG
           --HQS------------G----SGF--E-L--AF-VD----K-L--E---
Sequence 2 --HQSR-----------GRNLFSGFDTELLAEAFQVDERLIKQLKSED--

Sequence 1 EDKGAIVTVKGG-LSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQ
           ---G-IV-VK---L-VI-P----Q--R--E-EEE-EDEK-----------
Sequence 2 -NRGGIVKVKDDELRVIRP-SRSQSERGSESEEESEDEK-----------

Sequence 1 RPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLD
           R--G-----R-NGI-ETICTMRL--NI------DIY-P--G--TT--SL-
Sequence 2 RRWGQ----RDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLN

Sequence 1 FPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNG
           -P-L-WL-LS-E-G-L-KNA---PH-NLN--SIIY---G----QVV---G
Sequence 2 LPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFG

Sequence 1 ERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGA
           -RVFDGE--EG--L-VPQNF-V--R-----FE--SFKTND--M---LAG-
Sequence 2 NRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGR

Sequence 1 NSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA-
           -S-L---PEEV----F------AR-IK-NN----L-----S-------
Sequence 2 TSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA



Alignment 16
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 43.43 (215/495)
Sequence 1 MAKLVFSLCFLL-FSGCCFAFSSREQ--PQQNECQIQKLNALKPDNRIES
           --------C-LL-F-GC-----SR-----Q--E-Q---L-A--PDN-I-S
Sequence 2 --------CLLLLFNGC---LASRQHIFGQNKEWQLNQLEAREPDNHIQS

Sequence 1 EGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGK
           E-G--E-WNP----FQ-AGVA--R-T---N-L--PSY-N-PQ-IYI--G-
Sequence 2 EAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGR

Sequence 1 GIFGMIYPGCPSTFE--EPQQ--PQQRGQSSRP-----------------
           G--G---PGC--TFE---PQQ---QQ--Q--RP-----------------
Sequence 2 GVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQ

Sequence 1 QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLD
           QDRHQKI---REGD-IA-P-GVA-W-YNN---P-VAVS--D-N---NQLD
Sequence 2 QDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLD

Sequence 1 QMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTL
           Q-PRRFYLAGN---EF----Q-QG--Q-Q----QQ-----G--I-SGF--
Sequence 2 QVPRRFYLAGNPQDEF--NPQQQGRQQQQQ---QQGQQGNGNNIFSGFDT

Sequence 1 EFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRP
           --L--A--V----A-NLQG---------IV-V-G-L----P-------R-
Sequence 2 QLLAQALNVNPETARNLQGQDD--NRNEIVRVQGQLDFVSPFSRSAGGRG

Sequence 1 QEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIG
           --E---EE-------------Q---G-------NG--ET-C--RL--NIG
Sequence 2 DQERQQEEQQSQREREEKQREQEQQGGGGQD--NGVEETFCSARLSQNIG

Sequence 1 QTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNL
           --S--D-YNPQ-G----------P-L--LRLSAE-G-L--NA---PH---
Sequence 2 DPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHT

Sequence 1 NANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQS
           NAN---YA--G-A--QVVN-NG----D-E--EG-----PQN--V------
Sequence 2 NANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASN

Sequence 1 DNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKN
           --FEY-SF-T-------TLAG--S-L-ALP-EV-Q--F----Q-AR--K-
Sequence 2 EGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY

Sequence 1 NNPFKFLV----PPQESQKRAVA-
           N-----L-----PP----------
Sequence 2 NRQESRLLSATSPPRGRLMSILGY



Alignment 17
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 39.39 (195/495)
Sequence 1 ----MAKLVFSLCFLLFSGCCFAFSSREQPQQ--NECQIQKLNALKPDNR
           -------LV-----LL----C-A--S---P-Q----C----L--L-P---
Sequence 2 MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTEV

Sequence 1 IESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQ
           I-SE-G--E-W--N-----CAGV---R-------L--P-----P---Y--
Sequence 2 IKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSSPFISYVV

Sequence 1 QGKGIFGMIYPGCPSTF--EEP---QQPQQRGQSSRP-------------
           QG-GI-G---PGC--TF----P---QQ-QQ-GQ-----------------
Sequence 2 QGMGISGRVIPGCAETFMDSQPMQGQQGQQQGQQGQQGQQGQQGQQGQQG

Sequence 1 ------------------------QDRHQKIYNFREGDLIAVPTGVAWWM
           -------------------------D-HQK----R-GD-IA---G-A-W-
Sequence 2 QQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHGDAIAMTPGSAQWI

Sequence 1 YNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGH
           YN--D-P---VS-ID-----NQLD--PR-F-LAGN--Q---------G--
Sequence 2 YNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQ---------GSS

Sequence 1 QSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDK
           Q-Q----QQ---N----ILSGF----L--A---D---A--LQ--N-----
Sequence 2 QQQ----QQQQQN----ILSGFDPQVLAQALKIDVRLAQELQ--NQQDKR

Sequence 1 GAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRG
           G-IV-VKG---V--PP------R---E-E--------------H---PRG
Sequence 2 GNIVRVKGPFQVVRPPL-----RQAYESEQW-----------RH---PRG

Sequence 1 SQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPAL
           -------NG--ETIC-MR---NI------DIY-P--G-VT---S---P-L
Sequence 2 PPQSPQDNGLEETICSMRTHENIDDPARADIYKPNLGRVTSVNSYTLPIL

Sequence 1 SWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVF
           ---RLSA--G-L---AM--P-YN-NAN-I-Y---G-A-IQVVN-NG--V-
Sequence 2 QYIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQARIQVVNDNGQNVL

Sequence 1 DGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLL
           D---Q-G-----PQ-F-----SQ--NFE--SFKTN---MI-TLAG--S-L
Sequence 2 DQQVQKGQLVVIPQGFAYVVQSQ-NNFEWISFKTNANAMISTLAGRTSAL

Sequence 1 NALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA------
           -ALP-EVI----------AR-IK-N-----L------Q-----------
Sequence 2 RALPLEVITNAYQISLEEARKIKFNTLETTLTRARGGQQPQLIEEIVEV



Alignment 18
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 48.89 (242/495)
Sequence 1 ----MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIE
           ----------SLC-LL-S--CFA-SS------NECQ---LNAL-PD-R-E
Sequence 2 MGKPFTLSLSSLCLLLLSSACFAISSS---KLNECQLNNLNALEPDHRVE

Sequence 1 SEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQG
           SEGGLI-TWN-------CAGV--S--TLNRN-L--PSY---P--I-I-QG
Sequence 2 SEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQG

Sequence 1 KGIFGMIYPGCPSTFEEPQ-QPQQRGQSSRPQ---DRHQKIYNFREGDLI
           KG--G---PGCP-TFEEPQ-Q---RG--S--Q---D-HQKI--F-EGD--
Sequence 2 KGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVL

Sequence 1 AVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEF
           --P-GV--W-YN--D-PVVA-S--DT----NQLDQ-PR-FYLAGN---E-
Sequence 2 VIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEY

Sequence 1 ---LKYQQEQGGHQSQK-GKHQQEEENEGGSILSGFTLEFLEHAFSVDKQ
           ------QQ-Q--H---K-G-HQQEEE-EGGS-LSGF---FL---F-----
Sequence 2 PETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNED

Sequence 1 IAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQ---------------
           IA--LQ----------IVTV-GGLSVI-P---EQQ---------------
Sequence 2 IAEKLQSPDD--ERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQI

Sequence 1 -----------QRPQEEEEEEEDEKPQ----CKGKDKHCQ----------
           ------------R-Q-E-E-E---KP-------GK----Q----------
Sequence 2 PSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDE

Sequence 1 -----------------RPRGSQSKSR----RNGIDETICTMRLRHNIGQ
           -----------------RPR------R----RNG--E-ICT--L--NI--
Sequence 2 DQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIAR

Sequence 1 TSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLN
           -S--D-YNP-AG---T--SL--PAL----LSA----L-KN----PH-NLN
Sequence 2 PSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLN

Sequence 1 ANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSD
           ANS-IY---G-----VVNC-G--VFDGEL--G--L-VPQNFVVA------
Sequence 2 ANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQ

Sequence 1 NFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNN
           -FEY--FKT--------L--------A-P-EV--H--NL---Q----K--
Sequence 2 GFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSELKYE

Sequence 1 NPFKFLVPPQESQKRAVA---
           -----LV-P---Q--------
Sequence 2 GNWGPLVNPESQQGSPRVKVA



Alignment 19
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 47.88 (237/495)
Sequence 1 -----MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRI
           -----------SLC-LL-S--CFA--S------NECQ---LNAL-PD-R-
Sequence 2 MGKPFFTLSLSSLCLLLLSSACFAITSS---KFNECQLNNLNALEPDHRV

Sequence 1 ESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQ
           ESEGGLIETWN------QCAGV--S--TLNRN-L--PSY---PQ-I---Q
Sequence 2 ESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQ

Sequence 1 GKGIFGMIYPGCPSTFEEPQQPQ-QRGQSSRP--QDRHQKIYNFREGDLI
           GKG--G---PGCP-TFE-PQQ----RG--S----QD-HQKI--F-EGD--
Sequence 2 GKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDVL

Sequence 1 AVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGN---QE
           --P-GV--W-YN--D-PVVA-S--DT----NQLDQ-PR-FYLAGN-----
Sequence 2 VIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEH

Sequence 1 QEFLKYQQEQGGHQSQK-GKHQQEEENEGGSILSGFTLEFLEHAFSVDKQ
           -E----QQ-Q--H---K-G-HQQ-EE-EGGS-LSGF---FL---F-----
Sequence 2 PETMQQQQQQKSHGGRKQGQHQQQEE-EGGSVLSGFSKHFLAQSFNTNED

Sequence 1 IAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQ---------------
           -A--L-----------IVTV-GGLSVI-P---EQ----------------
Sequence 2 TAEKLRSPDD--ERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPS

Sequence 1 ---QRP---QEEEEEEEDEKPQCKGKDKHCQRP-RGSQSKSR------RN
           ----RP-----E--E-EDE-------D---QRP-R--Q---R------RN
Sequence 2 YPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRN

Sequence 1 GIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAE
           G--E-ICTM-L--NI---S--D-YNP-AG---T--SL--PAL----LSA-
Sequence 2 GVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQ

Sequence 1 FGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGR
           ---L--N----PH-NLNANS-IY---G-----VVNC-G--VFDGEL--G-
Sequence 2 YVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQ

Sequence 1 VLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVI
           -L-VPQNFVVA--------EYV-FKT-----------------A-P-EV-
Sequence 2 LLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYI---KDVFRAIPSEVL

Sequence 1 QHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA
           ----NL---Q-RQ-K-------LV-P---------
Sequence 2 SNSYNLGQSQVRQLKYQGNSGPLVNP---------



Alignment 20
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 42.02 (208/495)
Sequence 1 ---MAKLVFSLCFLLFSGCCFA-------FSSREQPQ--QNECQIQKLNA
           ------L-FSL-FLL---C-FA----------R-Q-Q--Q--CQIQ-LNA
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 LKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGP
           L-P--RIESE-G--E-W--N----QCA-VA--R-T-----L--PSY-N-P
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAP

Sequence 1 QEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQ-DRHQKIYNFR
           ---Y--QG-GI-G---PGCP-TF-E--Q---R---S------HQK-----
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQSRSRSERSQQSGEQHQKVRPIQ

Sequence 1 EGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGN
           EGD-IA-P-GVA-W-YNN-----V-V---D----ENQLDQ--R-F-L-G-
Sequence 2 EGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGS

Sequence 1 QEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDK
           --QE-----Q-----QSQ-----Q--------ILS-F--E-L---F--D-
Sequence 2 PQQEIQGSGQSRSRSQSQSSRRGQQGQ-QSNNILSAFDEEILAQSFNIDT

Sequence 1 QIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEK
           Q-A--LQ-E------G-IV-V---L-V--P---EQ-Q-----E-EEE-E-
Sequence 2 QLARRLQKEKR--QRGIIVRVQEDLEVLSPHRQEQEQ-----EYEEERER

Sequence 1 PQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQ
           -Q-------------------RNG--ET-CTM-L--NI---S--D-YNP-
Sequence 2 RQ-------------------RNGLEETFCTMTLKYNINDPSRADVYNPR

Sequence 1 AGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNG
           -G-V-----L--P-L--L-LSA--G-L---A---PH-N-NA-SI-Y---G
Sequence 2 GGRVSSVNALNLPILRFLQLSAKKGVLHRDAILAPHWNVNAHSIVYITRG

Sequence 1 RALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTN
           ---IQ-V--NGE-VFD-E--EG----VPQNF-V--R--SD-FE-VSFKTN
Sequence 2 NGRIQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDKFEWVSFKTN

Sequence 1 DTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQ
           -------LAG--S---ALP--VI---F------AR--K----------P-
Sequence 2 GLSQTSQLAGRVSVFRALPLDVIKNSFDISREDARRLKESRSETTIFAPG

Sequence 1 ESQKRAVA---------------
           -S--R------------------
Sequence 2 SSSQRKSQSERERQREREEREIH



Alignment 21
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 42.02 (208/495)
Sequence 1 ---MAKLVFSLCFLLFSGCCFA-------FSSREQPQ--QNECQIQKLNA
           ------L-FSL-FLL---C-FA----------R-Q-Q--Q--CQIQ-LNA
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 LKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGP
           L-P--RIESE-G--E-W--N----QCA-VA--R-T-----L--PSY-N-P
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAP

Sequence 1 QEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQ------DRHQK
           ---Y--QG-GI-G---PGCP-TF-E--Q-Q-R-Q-SR----------HQK
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQSQSRSQHSRSERSQQSGEQHQK

Sequence 1 IYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRF
           ----REGD-IA-P-GVA-W-YNN-----V-V---D----ENQLDQ--R-F
Sequence 2 VRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKF

Sequence 1 YLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHA
           -L-G---QE-------QGG-QS---------------ILS-F--E-L---
Sequence 2 VLGGSPQQEI------QGGGQSWSQSRSSRKGQQSNNILSAFDEEILAQS

Sequence 1 FSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEE
           F--D-Q--K-LQ-E------G-IV-VK--L-V--P---------Q--E-E
Sequence 2 FNIDTQLVKKLQREEK--QRGIIVRVKEDLQVLSP---------QRQEKE

Sequence 1 EEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPD
           --D------------------------NG--ET-CTM-L--NI---S--D
Sequence 2 YSD------------------------NGLEETFCTMTLKLNINDPSRAD

Sequence 1 IYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSII
           -YNP--G-VT----L--P-L--L-LS-E-G-L--NA---PH-N-NA-SI-
Sequence 2 VYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIV

Sequence 1 YALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYV
           Y---G----Q-V--NGE-VFD-E--EG----VPQNF-V--R--SD-FE-V
Sequence 2 YITRGNGRMQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDGFEWV

Sequence 1 SFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNN-NPFK
           SFKTN----I--LAG--S----LP--VIQ--F------A---K-------
Sequence 2 SFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISREDAWNLKESRSEMT

Sequence 1 FLVPPQESQKRAVA
           ---P---SQ-----
Sequence 2 IFAPGSRSQRQRN-



Alignment 22
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 38.18 (189/495)
Sequence 1 ------------------MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQ
           ------------------------------------------------C-
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR

Sequence 1 IQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRP
           ---L-A--P--R-ESE-GL-E-W--NN--F-CAGVA--R-------L--P
Sequence 2 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP

Sequence 1 SYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQK
           -Y-N-PQ--Y---G-GI-G---PGC--TFE---QP-Q-----R--DRHQK
Sequence 2 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQ-DRRRRFMDRHQK

Sequence 1 IYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRF
           ---FR-GD--A-P-G---W-YNN---P---V---DT----NQLDQ--R-F
Sequence 2 VRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHF

Sequence 1 YLAGNQEQEFLKYQQEQGGHQSQKGKHQQE-EENEGGSILSGFTLEFLEH
           -LAGN-----------QGG-QS--G--Q-E----E---I--GF--E-L--
Sequence 2 FLAGNP----------QGGRQSYFGRPQTEKQQGETKNIFNGFDDEILAD

Sequence 1 AFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEE
           AF-VD-Q-A--L-G-------G-IV-----L----P----------EEEE
Sequence 2 AFGVDVQTARRLKGQDDL--RGRIVRAER-LDIVLPG---------EEEE

Sequence 1 EEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSP
           E-----P------------------S--NG--ET-CT--LR-N-------
Sequence 2 ERWERDPY-----------------SGANGLEETLCTAKLRENLDEPARA

Sequence 1 DIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSI
           D-YNP--G------SL--P-LSWLRLSAE-G-L--N----PH-NLNA-SI
Sequence 2 DVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSI

Sequence 1 IYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAAR-SQSDNFE
           IY---G----QVV---G--VFDG---EG---IVPQN-VVA-R-SQ----E
Sequence 2 IYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLE

Sequence 1 YVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF
           --SFKTND--M---LAG--S---A-PEEV-----------AR--K-N---
Sequence 2 WISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREE

Sequence 1 KFLVPPQESQKRAVA----------------------
           -------------------------------------
Sequence 2 SRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM



Alignment 23
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 41.21 (204/495)
Sequence 1 MAKL-VFSL-CFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESE
           MAKL---SL--FLLF--CC-A----EQ----EC-IQ-L-A--P--R-E-E
Sequence 2 MAKLFLLSLGIFLLFH-CCLAIE-YEQEELYECRIQRLTAQEPQYRLEAE

Sequence 1 GGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKG
           -G--E-W------F-CAGVA--R-T-----L--P-YTN-P---Y--QG-G
Sequence 2 AGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRG

Sequence 1 IFGMIYPGCPSTFEEPQQPQ----QRGQSSRPQDRHQKIYNFREGDLIAV
           I-G---PGCP-TF----Q-Q----Q-----R-QD-HQK------GD-IA-
Sequence 2 ILGVLMPGCPETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAI

Sequence 1 PTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLK
           P-GVA-W-YN--D---V-V----T-S--NQLDQ-PR-F-LAGN-------
Sequence 2 PAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQ----R

Sequence 1 YQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHA--FSVDKQIAKN
           -Q---G------G--Q----N-------GF--E-L-----F--D---A--
Sequence 2 SQKQRGERYGLRGGQQILADN----VFKGFNMEALADVLGFGMDTETARK

Sequence 1 LQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKG
           --GE------G-IV-V--GL-VI-PP------R--EE-E--E--------
Sequence 2 VRGEDD--QRGHIVRVEQGLKVIRPP------RIREELEQQEG-------

Sequence 1 KDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVT
           ---------G-------NG--ETIC------NI------D-YNP-AG--T
Sequence 2 ---------GGY-----NGLEETICSATFIQNIDNPAEADFYNPRAGRLT

Sequence 1 TATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQ
           T--SL--P-L--L-LSA--G-L--NAM--P---LNANS--YA--G-A--Q
Sequence 2 TVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQ

Sequence 1 VVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMI
           -V---GE-VFD--L-EG----VPQNFVV-----S--FE-V-F-TND----
Sequence 2 IVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALF

Sequence 1 GTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPP-QESQK
           -T-AG--S-L---P--V------L----AR-IK-N-----L--P---S--
Sequence 2 STAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRG

Sequence 1 RAVA
           RA-A
Sequence 2 RASA



Alignment 24
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 35.56 (176/495)
Sequence 1 ---MAKLVFSLCFLLFSGCCFAF-----SSREQPQ------QNECQIQKL
           ------L-FSLC----S-C-----------R--P-------Q--C-IQ-L
Sequence 2 MSTKLILSFSLCLMVLS-CSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRL

Sequence 1 NALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTN
           -A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N
Sequence 2 TASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSN

Sequence 1 GPQEIYIQQGKGIFGMIYPGCPSTF------EEPQ-QPQQR------GQS
           -P------QG-G--G---PGCP-TF------E-P--Q--QR------G-S
Sequence 2 APYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGES

Sequence 1 SRPQ-----------------------------DRHQKIYNFREGDLIAV
           SR-------------------------------D-HQKI---R-GD-I--
Sequence 2 SRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPS

Sequence 1 PTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQ----
           P-GV--W--NN-D---------D-NS--NQLD---R-F-LAG---Q----
Sequence 2 PAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRED

Sequence 1 EFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAF-SVDKQI
           -----Q----G---Q----Q--E------ILSGF--E-L---F--VD---
Sequence 2 RRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQET

Sequence 1 AKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQ
           ---L-GEN-----G-IV-------------D-----P-E-EEE---E---
Sequence 2 ISKLRGEND--QRGFIVQAR----------DLKLRVPEEYEEELQRERGD

Sequence 1 CKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAG
           ---------R-RG----S--NG-----C----R-N----S--D--NP-AG
Sequence 2 ---------RKRGGSGRS--NGLEQAFCNLKFRQNVNRPSRADVFNPRAG

Sequence 1 SVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRA
           ---T--S---P-L----LSA----L-KNA---P--NLNA-S--Y---G--
Sequence 2 RINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEG

Sequence 1 LIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDT
           --QVV---G--VFD---Q-G--L-VPQ-F-V---------E-V--K--D-
Sequence 2 RVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDN

Sequence 1 PMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQES
           ------AG--S-L-A-P-EV-----------A---KN---------P--S
Sequence 2 AITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQS

Sequence 1 QKRAVA------
           ------------
Sequence 2 RDEKERERFSIV



Alignment 25
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 34.34 (170/495)
Sequence 1 ---MAKLVFSLCFLLFSGCCFAF-----SSREQP----QQ--NECQIQKL
           ------L-FSLC----S-C-----------R--P----QQ----C--Q-L
Sequence 2 MSTKLILSFSLCLMVLS-CSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRL

Sequence 1 NALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTN
           -A--P--R--SE-G--E-W------F-CAG----R-------L--PSY-N
Sequence 2 TASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSN

Sequence 1 GPQEIYIQQGKGIFGMIYPGCPSTFE---EPQQPQ-QRGQSSRPQ-----
           -P------QG-G--G---PGCP-TF----E---PQ-QR-Q-SR-------
Sequence 2 APYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEES

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQ

Sequence 1 -------------DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVS
           -------------D-HQKI---R-GD-I--P-GV--W--N--D-------
Sequence 2 RTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISIT

Sequence 1 IIDTNSLENQLDQMPRRFYLAGNQEQ----EFLKYQQEQGGHQSQKGKHQ
           --D-NS--NQLD---R-F-LAG---Q---------Q----G---Q-----
Sequence 2 LYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESD

Sequence 1 QEEENEGGSILSGFTLEFLEHAF-SVDKQIAKNLQGENEGEDKGAIVTVK
           --E------IL-GF--E-L---F--VD------L-G-N-----G-IV---
Sequence 2 DDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDND--QRGFIVQAR

Sequence 1 GGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRR
           ----------D-----P-E-EEE---E------------R-RG----S--
Sequence 2 ----------DLKLRVPEEYEEELQRERGD---------RKRGGSGRS--

Sequence 1 NGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSA
           NG-----C------N----S--D--NP-AG---T--S---P-L----LSA
Sequence 2 NGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSA

Sequence 1 EFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEG
           ----L-KNA---P--NLNA-S--Y---G----QVV---G--VFD---Q-G
Sequence 2 QHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG

Sequence 1 RVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEV
           --L-VPQ-F-V---------E-V--K--D-------AG--S-L-A-P-EV
Sequence 2 QILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEV

Sequence 1 IQHTFNLKSQQARQIKNN-NPFKFLVPPQESQKRAVA--
           -----------A---KN---------P-Q----------
Sequence 2 LANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF



Alignment 26
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 34.95 (173/495)
Sequence 1 ---MAKLVFSLCFLLFSGCCFA-------------FSSREQPQ-QNECQI
           ------L-FSLC----S--C-A----------------R-Q-Q-Q--C-I
Sequence 2 MSTKLILSFSLCLMVLS--CSAQLWPWQKGQGSRPHHGRQQHQFQHQCDI

Sequence 1 QKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPS
           Q-L-A--P--R--SE-G--E-W------F-C-G----R-------L--PS
Sequence 2 QRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPS

Sequence 1 YTNGPQEIYIQQGKGIFGMIYPGCPSTFE---EPQQPQ-QRGQSSRPQ--
           Y-N-P------QG-G--G---PGCP-TF----E---PQ-QRG--SR----
Sequence 2 YSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSES

Sequence 1 -------DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNS
           -------D-HQKI---REGD-I--P-GV--W--N--------V---D-NS
Sequence 2 EEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANS

Sequence 1 LENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSI
           ---QLD---R-F-LAG----E------E-G----Q-------E---G--I
Sequence 2 YHKQLDENVRSFFLAGQSQRE----TREEGSDR-QSRESDDDEALLGANI

Sequence 1 LSGFTLEFLEHAF-SVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPT
           LSGF--E-L---F--VD------L-GEN-----G-IV-------------
Sequence 2 LSGFQDEILHELFRDVDRETISKLRGEND--QRGFIVQAQ----------

Sequence 1 DEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTM
           D-----PQ--EEE-E-E------------R-RG-----R-NG-----C--
Sequence 2 DLKLRVPQDFEEEYERERGD---------RRRGQGGSGRSNGVEQGFCNL

Sequence 1 RLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAM
           --R-N----------NP-AG---T--S---P-L--L-LSA----L-KNA-
Sequence 2 KFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAI

Sequence 1 FVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFV
           --P--NLNA-S--Y---G----QVV---G--VFD---Q-G--L-VPQ-F-
Sequence 2 IGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFA

Sequence 1 VAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQ
           V---------E-V--K-----------G--S-L-A-P-EV----------
Sequence 2 VVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTK

Sequence 1 QARQIKNNNPFKFLVPPQESQKRAVA------
           -A---KN---------P--S------------
Sequence 2 EAYKLKNGRQEVEVFRPFQSRDEKERERFSIV



Alignment 27
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 34.14 (169/495)
Sequence 1 --MAKLVFSLCFLLFSGCCFAFSSREQ--PQQNECQIQKLNALKPDNRIE
           ----K----L---L------A---RE----Q---C--Q------P--RI-
Sequence 2 MVAFKFLLALSLSLLVSAAIA-QTREPRLTQGQQCRFQRISGAQPSLRIQ

Sequence 1 SEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQG
           SEGG--E-W------FQCAG----R-T---N-L--P-Y---P---YI--G
Sequence 2 SEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERG

Sequence 1 KGIFGMIYPGCPSTFE--EPQQPQQRGQSSRPQDR------HQKIYNFRE
           -G------PGC--T------Q----R---S--QDR------HQK----R-
Sequence 2 QGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQ

Sequence 1 GDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQ
           GD--A-P-G-A-W-YN------VAVSI-D-N-L-NQLDQ--R-FYLAG--
Sequence 2 GDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGV

Sequence 1 EQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQ
           ------------G-Q-Q-----Q---N----I---F--E-L--AF-V---
Sequence 2 PR---------SGEQEQQAR--QTFHN----IFRAFDAELLSEAFNVPQE

Sequence 1 IAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKP
           -----Q-E-E----G-IV------------------RP-EEE-E-E----
Sequence 2 TIRRMQSEEE--ERGLIVMARERMTFV---------RPDEEEGEQE----

Sequence 1 QCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQA
           -------H----RG-Q-----NG--ET-CTM--R-N-------DI---QA
Sequence 2 -------H----RGRQLD---NGLEETFCTMKFRTNVESRREADIFSRQA

Sequence 1 GSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGR
           G-V--------P-L----LSAE-G-L--NA---P--------I-Y---G-
Sequence 2 GRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGD

Sequence 1 ALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTND
           A--QVV--NG----------G----VPQ-----AR-----FE-V-FKT--
Sequence 2 AQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTG

Sequence 1 TPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIK-NNNPFKFLVPPQ
           -PM---LAG--S---A-P--VI---------QA---K-N-----FL--P-
Sequence 2 SPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPG

Sequence 1 ESQKRAVA
           --------
Sequence 2 GRRS----



Alignment 28
Sequence 1:
Sequence 2: Allergen Gly m Bd28K, Sequence: BAB21619
Sequence identity: 19.39 (96/495)
Sequence 1 -MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEG
           ----L---------------------------------------------
Sequence 2 KTTLLLLLFVLCHGVATTTMAFHDDEGGDKKSPKSLFLMSNSTRVFKTDA

Sequence 1 GLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGI
           G----------------------------L--P-Y------I-I--G---
Sequence 2 GEMRVLKSHGGRIFYRHMHIGFISMEPKSLFVPQYLDSNLIIFIRRGEAK

Sequence 1 FGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVA
           -G-IY---------------R------------------GDL---P-G-A
Sequence 2 LGFIY--------DDELAERR---------------LKTGDLYMIPSGSA

Sequence 1 WWMYN-NEDTPVVAVSIID-TNSLENQLDQMPRRFYLAGNQEQEFLKYQQ
           ----N--E---------ID---SL-----Q----FY--G-----------
Sequence 2 FYLVNIGEGQRLHVICSIDPSTSLGLETFQ---SFYIGG-----------

Sequence 1 EQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNL-QGE
           ---G--S--------------S-LSGF----LE-AF-------------E
Sequence 2 ---GANSH-------------SVLSGFEPAILETAFNESRTVVEEIFSKE

Sequence 1 NEG-----EDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCK
           --G------D--A-------L---K-----Q--------EE-E-EK----
Sequence 2 LDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSR

Sequence 1 GKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSV
           ---K------G-------N----T--------N-------D--N----S-
Sequence 2 SWRKLLETVFGKVNEKIEN--KDTAGSPA-SYNLYDDKKADFKNAYGWSK

Sequence 1 TTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALI
           --------P-LS----------L----M--PH-N---------L-G----
Sequence 2 ALHGG-EYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLSGYGEL

Sequence 1 QVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDN-FEYVSFKTN---
           -----NG-R--------G-V--VP--F--------D---E---F-T----
Sequence 2 HIGYPNGSRAMKTKIKQGDVFVVPRYFPFCQVASRDGPLEFFGFSTSARK

Sequence 1 DTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNN------PFK
           --P----LAGA-SLL--L--------F-------R------------P--
Sequence 2 NKPQF--LAGAASLLRTLMGPELSAAFGVSEDTLRRAVDAQHEAVILPSA

Sequence 1 FLVPPQESQKRAVA------------------
           ---PP----K----------------------
Sequence 2 WAAPPENAGKLKMEEEPNAIRSFANDVVMDVF



Alignment 29
Sequence 1:
Sequence 2: Allergen Cor a 11, Sequence: AAL86739
Sequence identity: 18.79 (93/495)
Sequence 1 -------MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDN
           ---------K-----C---------------Q------------------
Sequence 2 MLPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSE

Sequence 1 RIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYI
           ------------------F--------------------S------E---
Sequence 2 ESYGKEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFR

Sequence 1 QQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQK--IYNFREGDL
           -------------------E-------G-------R--K----N---GD-
Sequence 2 LAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDI

Sequence 1 IAVPTGVAWWMYN-NEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQ
           I--P-G----M-N--E------V-I----S-----------FY-AG----
Sequence 2 IRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFEA----FYGAGGEDP

Sequence 1 EFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIA
           E---------------------------S----F--E-LE-A--V-----
Sequence 2 E---------------------------SFYRAFSWEVLEAALKVRREQL

Sequence 1 KNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQC
           ----GE-----KG---------S--K----------Q-EE----------
Sequence 2 EKVFGE---QSKG---------SIVKASREKIRALSQHEE----------

Sequence 1 KGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGS
           -G-------P-G--S----N----------L-H-------P---N-Q-G-
Sequence 2 -GPPR--IWPFGGESSGPIN----------LLHK-----HPSQSN-QFGR

Sequence 1 VTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRAL
           ---A---D---L--L-L---F----K--M--P-YN--A--I-----G---
Sequence 2 LYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGF

Sequence 1 IQVV------NCNGERVFDGELQEGRVLIVPQNFVVAA-RSQSDNFEYVS
           ---------------------L--G-V---P----VA---SQ--N-----
Sequence 2 FEMACPHLSSSSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLC

Sequence 1 FKTNDTPMIG-TLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKF
           F--N--------LAG-----N----------FNL-S-----I--N----F
Sequence 2 FEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLPSREVERIFKNQDQAF

Sequence 1 LVP-PQESQKRAVA------
           --P-P---Q-----------
Sequence 2 FFPGPNKQQEEGGRGGRAFE



Alignment 30
Sequence 1:
Sequence 2: Allergen Gly m 5.0201, Sequence: Q9FZP9
Sequence identity: 18.59 (92/495)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPH

Sequence 1 -----------------------------------------------MAK
           --------------------------------------------------
Sequence 2 QEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEW

Sequence 1 LVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIE
           --------------------E---Q-------------------------
Sequence 2 QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPF

Sequence 1 TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMI
           --N-----------------L-R---R-----N-----------------
Sequence 2 HFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLL

Sequence 1 YPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMY
           -P----------------------------YN---GD---VP-G------
Sequence 2 LPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVV

Sequence 1 N-NEDTPVVAVSI-IDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGG
           N---D---------I--N---------P-RF------E--FL---Q-Q--
Sequence 2 NPDNDENLRMITLAIPVNK--------PGRF------ESFFLSSTQAQQ-

Sequence 1 HQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGE
           -----------------S-L-GF----LE---------I-K-L-G--EG-
Sequence 2 -----------------SYLQGFSKNILEASYDTKFEEINKVLFGREEGQ

Sequence 1 DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
           --G---------------------R-QE----E---K-Q-----KH----
Sequence 2 QQG-------------------EERLQESVIVEISKK-QIRELSKH----

Sequence 1 RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFP
           ----S-SR------TI-------N------P-IY----G-----T----P
Sequence 2 --AKSSSRK-----TISSEDKPFNL-RSRDP-IYSNKLGKLFEITPEKNP

Sequence 1 ALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGE-
           -L--L------------A-F-PH-N--A--------G-A-I--V------
Sequence 2 QLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQ

Sequence 1 ------------RVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTN
           ------------R----EL-E------P----V-----SD------F--N
Sequence 2 QRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD-LNFFAFGIN

Sequence 1 -DTPMIGTLAGA-NSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVP
           --------LAG---------P--V----F-------------------V-
Sequence 2 AENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVD

Sequence 1 PQESQKRAVA---------------
           -Q--QK-------------------
Sequence 2 AQPQQKEEGNKGRKGPLSSILRAFY



Alignment 31
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB01374
Sequence identity: 18.59 (92/495)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NQACHARCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPH

Sequence 1 ---------MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKP
           --------------------------------E---Q-------------
Sequence 2 QPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQ

Sequence 1 DNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEI
           --------------N-----------------L-R---R-----N-----
Sequence 2 REPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR

Sequence 1 YIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDL
           -------------P----------------------------YN---GD-
Sequence 2 ILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA

Sequence 1 IAVPTGVAWWMYN---NEDTPVVAVS---IIDTNSLEN-QLDQMPRRFYL
           --VP-G------N----E-----A------------EN------------
Sequence 2 LRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNK

Sequence 1 AGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFS
           -G--E--FL---Q-Q-------------------S-L-GF----LE----
Sequence 2 PGRFESFFLSSTQAQQ------------------SYLQGFSKNILEASYD

Sequence 1 VD-KQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEE
           -----I-K-L-G--EG---G---------------------R-QE----E
Sequence 2 TKFEEINKVLFGREEGQQQG-------------------EERLQESVIVE

Sequence 1 EDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDI
           ---K-Q-----KH--------S-SR------TI-------N-G--S---I
Sequence 2 ISKK-QIRELSKH------AKSSSRK-----TISSEDKPFNLG--SRDPI

Sequence 1 YNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIY
           Y----G-----T----P-L--L------------A-F-PH-N--A-----
Sequence 2 YSNKLGKLFEITQRN-PQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLV

Sequence 1 ALNGRALIQVVNCNGE-------------RVFDGELQEGRVLIVPQNFVV
           ---G-A-I--V------------------R----EL-E------P----V
Sequence 2 INEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPV

Sequence 1 AARSQSDNFEYVSFKTN-DTPMIGTLAGA-NSLLNALPEEVIQHTFNLKS
           -----SD------F--N--------LAG---------P--V----F----
Sequence 2 MVNATSD-LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSA

Sequence 1 QQARQIKNNNPFKFLVPPQESQKRAVA---------------
           ---------------V--Q--QK-------------------
Sequence 2 KDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.