The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 127
Allergen Scientific Name Fel d 1
Allergen Species - Systematic Name Felis domesticus
Allergen Species - Common Name cat (saliva)
Allergen Common source animals
Allergen Common name
Allergen Keywords cat-1; AG4
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Fel d 1 - References
ID Reference
Pubmed ID: 1946388
Morgenstern JP, Griffith IJ, Brauer AW, Rogers BL, Bond JF, Chapman MD, Kuo MC, Amino acid sequence of Fel dI, the major allergen of the domestic cat: protein sequence analysis and cDNA cloning. Proc Natl Acad Sci U S A. 1991 Nov 1;88(21):9690-4.
Pubmed ID: 1572548
Griffith IJ, Craig S, Pollock J, Yu XB, Morgenstern JP, Rogers BL. Expression and genomic structure of the genes encoding FdI, the major allergen from the domestic cat. Gene. 1992 Apr 15;113(2):263-8.
Pubmed ID: 1712068
Duffort OA, Carreira J, Nitti G, Polo F, Lombardero M. Studies on the biochemical structure of the major cat allergen Felis domesticus I. Mol Immunol. 1991 Apr-May;28(4-5):301-9.
Pubmed ID: 6747135
Leitermann K, Ohman JL Jr. Cat allergen 1: Biochemical, antigenic, and allergenic properties. J Allergy Clin Immunol. 1984 Aug;74(2):147-53.
Pubmed ID: 1946388
Morgenstern JP, Griffith IJ, Brauer AW, Rogers BL, Bond JF, Chapman MD, Kuo MC. Amino acid sequence of Fel dI, the major allergen of the domestic cat: protein sequence analysis and cDNA cloning. Proc Natl Acad Sci U S A. 1991 Nov 1;88(21):9690-4.
Fel d 1 - Protein Sequences
Source Link to source
SwissProt P30438
SwissProt P30439
SwissProt P30440
GenBank 395407
GenBank 163827
GenBank 1364212
GenBank 1364213
GenBank 163825
Fel d 1 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
127 178 1PUO 25-JUN-03 X-ray diffraction resolution 1.85 A
127 214 2EJN 2007-03-19 X-ray diffraction resolution 1.64 A
127 294 1ZKR 2005-05-04 X-ray diffraction resolution 1.64 A fused chain1, chain 2
1ZKR.pdb


Fel d 1 - Sequence Search :
Sequence Header Sequence
Fel d 1
SDAP Sequence ID: 137
SDAP Allergen ID: 127
MKGACVLVLLWAALLLISGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fel d 1
SDAP Sequence ID: 138
SDAP Allergen ID: 127
MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fel d 1
SDAP Sequence ID: 139
SDAP Allergen ID: 127
MRGALLVLALLVTQALGVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGR
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fel d 1
SDAP Sequence ID: 769
SDAP Allergen ID: 127
MRGALLVLALLVTQALGVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMIAINEYCMGEAVQNTVEDLKLNTLGR
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fel d 1
SDAP Sequence ID: 770
SDAP Allergen ID: 127
MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSLLDKIYTSPLC
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fel d 1
SDAP Sequence ID: 771
SDAP Allergen ID: 127
VRRSPSTLPYCCGHSRDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fel d 1
SDAP Sequence ID: 772
SDAP Allergen ID: 127
EGGLCSRASLGCLALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fel d 1
SDAP Sequence ID: 773
SDAP Allergen ID: 127
MKGARVLVLLWAALLLIWGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSLLDKIYTSPLC
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Fel d 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Fel d 1 84.6 0.67 1PUO_A 100 92 109 18 - 109 1 - 92 0 191 Download (SI: 139)
Fel d 1 90.6 0.67 1ZKR_A 98.571 70 92 23 - 92 2 - 71 2.8026e-45 144 Download (SI: 137)
Fel d 1 81.55 0.61 1PUO_A 92.391 92 107 18 - 107 1 - 92 0 171 Download (SI: 769)
Fel d 1 86.9 0.74 1ZKR_A 100 70 88 19 - 88 2 - 71 1.4013e-45 144 Download (SI: 770)
Fel d 1 87.35 0.75 1ZKR_A 98.571 70 88 19 - 88 2 - 71 2.8026e-45 143 Download (SI: 138)
Fel d 1 87.35 0.76 1ZKR_A 97.143 70 88 19 - 88 2 - 71 4.2039e-44 140 Download (SI: 771)
Fel d 1 85.3 0.68 1ZKR_A 97.143 70 92 23 - 92 2 - 71 2.38221e-44 141 Download (SI: 772)
Fel d 1 90.35 0.66 1ZKR_A 100 70 92 23 - 92 2 - 71 0 145 Download (SI: 773)
Fel d 1 - Alphafold Theoretical Model Structure
Model Structure
773_relaxed_rank_1_model_4.pdb


Coverage Plddt
Fel d 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P30438 Click here to process the data
P30439 Click here to process the data
P30440 Click here to process the data
395407 Click here to process the data
163827 Click here to process the data
1364212 Click here to process the data
1364213 Click here to process the data
163825 Click here to process the data
Fel d 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
137 127 1 92 1 92 PF01099 Uteroglobin Domain CL0370 Uteroglobin family
138 127 14 88 2 88 PF01099 Uteroglobin Domain CL0370 Uteroglobin family
139 127 24 90 24 90 PF09252 Feld-I_B Domain CL0370 Allergen Fel d I-B chain
769 127 24 85 24 88 PF09252 Feld-I_B Domain CL0370 Allergen Fel d I-B chain
770 127 14 88 2 88 PF01099 Uteroglobin Domain CL0370 Uteroglobin family
771 127 7 88 5 88 PF01099 Uteroglobin Domain CL0370 Uteroglobin family
772 127 11 92 4 92 PF01099 Uteroglobin Domain CL0370 Uteroglobin family
773 127 1 92 1 92 PF01099 Uteroglobin Domain CL0370 Uteroglobin family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Fel d 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.