The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ses i 7.0101

Sequence Q9AUD2

Full FASTA alignment

Sequence name:
Query sequence:
MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDRHQKV
RQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFF
LAGNPQGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVDVQTARR
LKGQDDLRGRIVRAERLDIVLPGEEEEERWERDPYSGANGLEETLCTAKL
RENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVA
PHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVA
KRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDE
ARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ses i 7.0101Q9AUD2Go!497715.81.4e-207
2Pis v 2.0201DQ631677Go!472342.33.6e-95
3Cuc ma 4.0101P13744Go!480334.29.8e-93
4Ber e 2AAO38859Go!465325.73.4e-90
5Ana o 2AAN76862Go!457313.41.7e-86
6Ses i 6.0101Q9XHP0Go!459269.04.0e-73
7Zan b 2.03QYS16039Go!389259.23.1e-70
8Zan b 2.02QYU76044Go!383252.82.5e-68
9Sin a 2.0101Q2TLW0Go!510214.98.5e-57
10Pis v 2.0101DQ631676Go!496207.71.2e-54
11Zan b 2.0101QYU76045Go!389194.01.3e-50
12Zan b 2.0102QYU76046Go!388191.47.6e-50
13Jug r 4.0101Q2TPW5Go!507178.29.7e-46
14Car i 4.0101ABW86978Go!505177.51.5e-45
15Fag e 1Q9XFM4Go!538176.72.8e-45
16Fag e 1BAA21758Go!565175.95.3e-45
17Jug n 4.0101A0A1L6K371Go!510175.27.7e-45
18Cor a 9AAL73404Go!515171.41.1e-43
19Pis v 5.0101EU410073Go!473168.86.0e-43
20Pru du 6.0201ADN39441Go!504161.88.1e-41
21Pru du 6.0101ADN39440Go!551161.61.0e-40
22Pru du 63EHK_AGo!531160.32.4e-40
23Fag e 1BAA21760Go!504157.31.8e-39
24Gly m 6.0401Q9SB11Go!563140.03.4e-34
25Gly m 6.0501Q7GC77Go!517138.58.9e-34
26Gly m glycinin G1AAA33966Go!495128.58.7e-31
27Gly m 6.0101P04776Go!495128.58.7e-31
28Gly m 6.0301P11828Go!481127.22.1e-30
29Ara h 3O82580Go!507122.94.1e-29
30Ara h 3AAC63045Go!510122.94.1e-29
31Ara h 4AAD47382Go!530117.71.7e-27
32Gly m glycinin G2CAA68460Go!485116.33.8e-27
33Gly m 6.0201P04405Go!485116.33.8e-27
34Gly m Bd28KBAB21619Go!47347.32.2e-06
35Coc n 1.0101A0A0S3B0K0Go!49045.01.1e-05
36Ses i 3AAK15089Go!58543.83.1e-05

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 100.00 (497/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
Sequence 2 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDRHQKV
           HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDRHQKV
Sequence 2 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDRHQKV

Sequence 1 RQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFF
           RQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFF
Sequence 2 RQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFF

Sequence 1 LAGNPQGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVDVQTARR
           LAGNPQGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVDVQTARR
Sequence 2 LAGNPQGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVDVQTARR

Sequence 1 LKGQDDLRGRIVRAERLDIVLPGEEEEERWERDPYSGANGLEETLCTAKL
           LKGQDDLRGRIVRAERLDIVLPGEEEEERWERDPYSGANGLEETLCTAKL
Sequence 2 LKGQDDLRGRIVRAERLDIVLPGEEEEERWERDPYSGANGLEETLCTAKL

Sequence 1 RENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVA
           RENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVA
Sequence 2 RENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVA

Sequence 1 PHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVA
           PHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVA
Sequence 2 PHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVA

Sequence 1 KRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDE
           KRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDE
Sequence 2 KRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDE

Sequence 1 ARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           ARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
Sequence 2 ARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM



Alignment 2
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 49.30 (245/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           M---SLLSF-----LL-----AQ---EQ----Q--Q-QQQ---Q--T-C-
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQI--EQVVNSQ--QRQQQQRFQ--TQCQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A-EP--R-ESEAG-TEFWD-N--Q--CA-VA--R--IQ-RGLL-P
Sequence 2 IQNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQP-------RQDRRRRF
           -YNNAP-L-YVV-G-GI-G-V-PGC-ETF----Q--------R--R----
Sequence 2 SYNNAPELVYVVQGSGIHGAVFPGCPETFQEESQSQSRSQHSRSERSQQS

Sequence 1 MDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLD
           ---HQKVR--R-GDI-ALPAG---W-YNNG---L--VAL-D-GN--NQLD
Sequence 2 GEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLD

Sequence 1 QTFRHFFLAGNPQ----GGRQSYFGRPQTEKQQGETKNIFNGFDDEILAD
           Q--R-F-L-G-PQ----GG-QS--------K-Q----NI---FD-EILA-
Sequence 2 QYLRKFVLGGSPQQEIQGGGQSWSQSRSSRKGQ-QSNNILSAFDEEILAQ

Sequence 1 AFGVDVQTARRLKGQDDLRGRIVRA-ERLDIVLPGEEEEERWERDPYSGA
           -F--D-Q----L------RG-IVR--E-L----P---E-E------YS--
Sequence 2 SFNIDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQRQEKE------YSD-

Sequence 1 NGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSA
           NGLEET-CT--L--N---P-RADVYNP-GGR--S-N-L-LP-L--L-LS-
Sequence 2 NGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRFLQLSV

Sequence 1 EKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREG
           EKGVLY-N---APHWN-NAHSI-YITRG-GR-Q-V---G-SVFD---REG
Sequence 2 EKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIREG

Sequence 1 QLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEE
           QL--VPQN--V-KRAS-D-G-EW-SFKTN--A--SQLAGR-S--R--P--
Sequence 2 QLVVVPQNFAVVKRASSD-GFEWVSFKTNGLAKISQLAGRISVMRGLPLD

Sequence 1 VVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEY
           V-------SR--A--LK--R-E---F---SR----R--------------
Sequence 2 VIQNSFDISREDAWNLKESRSEMTIFAPGSRSQRQRN-------------

Sequence 1 VLDVIKSMM
           ---------
Sequence 2 ---------



Alignment 3
Sequence 1:
Sequence 2: Allergen Cuc ma 4.0101, Sequence: P13744
Sequence identity: 46.28 (230/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           MA--SL--F-------I-G---Q---------Q-----QQH--Q----CR
Sequence 2 MARSSLFTF-LCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPRACR

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           -E-L-AQ-P--R-E-EA--TE-WD--N--F-CAGV---R--I-P-GLLLP
Sequence 2 LENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDRHQKV
           ---NAP-L--V--G-GI-G--IPGCAET---D----Q-----F-D-HQK-
Sequence 2 GFSNAPKLIFVAQGFGIRGIAIPGCAETYQTDLRRSQSAGSAFKDQHQKI

Sequence 1 RQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFF
           R-FR-GD-L--PAG---W-YN-G---L------DT-N-ANQ-D---R-F-
Sequence 2 RPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVANQIDPYLRKFY

Sequence 1 LAGNPQGGRQSY--FGRPQTEKQQGE-TKNIFNGFDDEILADAFGVDVQT
           LAG-P-----------R-------GE---NIF-GF-DE-L--AF--D---
Sequence 2 LAGRPEQVERGVEEWERSSRKGSSGEKSGNIFSGFADEFLEEAFQIDGGL

Sequence 1 ARRLKGQDDLRGRIVRA-ERLDIVLPGEEEEERWERDPY-----SGANGL
           -R-LKG-DD-R-RIV---E-----LP---EEER--R--Y--------NGL
Sequence 2 VRKLKGEDDERDRIVQVDEDFEVLLPEKDEEER-SRGRYIESESESENGL

Sequence 1 EETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKG
           EET-CT--L--N-----RADV-NP-GGRIS--N--TLP-L---RLSAE-G
Sequence 2 EETICTLRLKQNIGRSVRADVFNPRGGRISTANYHTLPILRQVRLSAERG

Sequence 1 VLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLI
           VLY-N--VAPH---N-HS--Y-TRG--R-QVV---G-SVFDG-VREGQ--
Sequence 2 VLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEVREGQVL

Sequence 1 IVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVM
           --PQN-VV-KRAS-D-G-EWI-FKTNDNA-T--LAGR-S--R--P--V--
Sequence 2 MIPQNFVVIKRAS-DRGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVLS

Sequence 1 TAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLD
           --Y--SR-EA-RLKY---E-RV-S--------------------------
Sequence 2 NMYRISREEAQRLKYGQQEMRVLSPGRSQGRRE-----------------

Sequence 1 VIKSMM
           ------
Sequence 2 ------



Alignment 4
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 45.27 (225/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           -----------------------L-----F------------------CR
Sequence 2 ------------------MAKLFLLSLGIFLLFHCCLAIEYEQEELYECR

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           --RLTAQEP--R-E-EAG--E-WD---QQF-CAGVAA-RN-I-P-GLLLP
Sequence 2 IQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQ-----PRQDRRRRFMD
           -Y-NAP-L-YV--GRGI-G---PGC-ETF----Q----------R-RF-D
Sequence 2 VYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGSREQEEERGRFQD

Sequence 1 RHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQT
           -HQKV-----GDI-A-PAG--LW-YN-G-E-L-TV----T----NQLDQ-
Sequence 2 QHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQN

Sequence 1 FRHFFLAGNPQGGRQSYFGRPQTEK-QQGETKNIFNGFDDEILADA--FG
           -RHFFLAGN-Q--------R------QQ----N-F-GF--E-LAD---FG
Sequence 2 PRHFFLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFG

Sequence 1 VDVQTARRLKGQDDLRGRIVRAER-LDIVLPGEEEEERWERDPYSGANGL
           -D--TAR---G-DD-RG-IVR-E--L----P----EE--E-----G-NGL
Sequence 2 MDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREE-LEQQEGGGYNGL

Sequence 1 EETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKG
           EET-C-A----N-D-PA-AD-YNP--GR----NSL--P-L--L-LSA-KG
Sequence 2 EETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKG

Sequence 1 VLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLI
           VLY-N---AP-W-LNA-S--Y--RG--R-Q-V-H-G--VFD---REGQ--
Sequence 2 VLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMV

Sequence 1 IVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVM
           -VPQN-VV-K-A----G-EW--F-TNDNA--S--AGR-S--R--P--V--
Sequence 2 VVPQNFVVVKQAGS-RGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLA

Sequence 1 TAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLD
           -AY--S--EARR-K-NR-E---F---SR-S--R-S---------------
Sequence 2 NAYRLSQEEARRIKLNRDEAVLFQPGSR-SRGRASA--------------

Sequence 1 VIKSMM
           ------
Sequence 2 ------



Alignment 5
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 46.88 (233/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ----------------------------------L-S-Q----Q----C-
Sequence 2 ----------------------LSVCFLILFHGCLASRQE--WQQQDECQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           --RL-A-EP--R-E-EAG--E-WD-N--QF-CAGVA-VR--IQP-GLLLP
Sequence 2 IDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRR-RFMDRHQK
           -Y-NAPQL-YVV-G-G--G---PGC-ET-----Q-RQ-----RF-DRHQK
Sequence 2 QYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQK

Sequence 1 VRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHF
           -R-FR-GDI-A-PAG---W-YN-G--P--TV-LLD--N--NQLD-T-R-F
Sequence 2 IRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKF

Sequence 1 FLAGNPQGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVDVQTAR
           -LAGNP----Q------Q----Q----N-F-GFD-E-LA-AF-VD-----
Sequence 2 HLAGNPKDVFQ------QQQQHQSRGRNLFSGFDTELLAEAFQVDERLIK

Sequence 1 RLKGQDDLRGRIVRA--ERLDIVLP--------------GEEEEERW-ER
           -LK--D--RG-IV------L----P---------------E-E--RW--R
Sequence 2 QLKSEDN-RGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQR

Sequence 1 DPYSGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLS
           D-----NG-EET-CT--L-EN---PARAD-Y-P--GR---LNSL-LP-L-
Sequence 2 D-----NGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILK

Sequence 1 WLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFD
           WL-LS-EKGVLY-N-LV-PHWNLN-HSIIY---G-G--QVV---G--VFD
Sequence 2 WLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFD

Sequence 1 GVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAI
           G-VREGQ---VPQN--V-KRA---E--EWISFKTND-AMTS-LAGR-S--
Sequence 2 GEVREGQMLVVPQNFAVVKRA-REERFEWISFKTNDRAMTSPLAGRTSVL

Sequence 1 RAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYM
           --MPEEV---A-Q-SR--AR--K-N-------S--S--------------
Sequence 2 GGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA------

Sequence 1 PKPFEYVLDVIKSMM
           ---------------
Sequence 2 ---------------



Alignment 6
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 37.83 (188/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ------------------------------------------L-----CR
Sequence 2 ---------------MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCR

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           --R-----P--R--SE-G-TE-WD----QF-CAG--A-R--I-P-GL-LP
Sequence 2 FQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETF---------ERDTQPRQDRRR
           -Y---P-L-Y--RG-G------PGCAET----------ER-----Q--R-
Sequence 2 NYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRG

Sequence 1 RFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQ
           ---D-HQKV---RQGDI-A-P-G---W-YN-G-E-L--V---D-----NQ
Sequence 2 SVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQ

Sequence 1 LDQTFRHFFLAGN-PQGGRQSYFGRPQTEKQQGET-KNIFNGFDDEILAD
           LDQ-FR-F-LAG--P--G-Q--------E-Q---T--NIF--FD-E-L--
Sequence 2 LDQKFRAFYLAGGVPRSGEQ--------EQQARQTFHNIFRAFDAELLSE

Sequence 1 AFGVDVQTARRLKGQDDLRGRIVRA-ERLDIVLPGEEEEERWERDPYSGA
           AF-V---T-RR-------RG-IV-A-ER---V-P-EEE-E---R------
Sequence 2 AFNVPQETIRRMQSEEEERGLIVMARERMTFVRPDEEEGEQEHRG-RQLD

Sequence 1 NGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSA
           NGLEET-CT-K-R-N------AD------GR--------LP-L----LSA
Sequence 2 NGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSA

Sequence 1 EKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREG
           EKG-LY-N-LV-P-W----H-I-Y-TRG----QVV-H-G-------V--G
Sequence 2 EKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQG

Sequence 1 QLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEE
           ----VPQ-Y----RA----G-EW--FKT----M-S-LAG--S-IRAMP--
Sequence 2 EMFVVPQYYTSTARAGNN-GFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQ

Sequence 1 VVMTAYQVSRDEARRLKYNR-EESRVFSSTSRYSWPRSSRPMSYMPKPFE
           V----YQ-S---A--LK-NR---S---S---R-S----------------
Sequence 2 VITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS----------------

Sequence 1 YVLDVIKSMM
           ----------
Sequence 2 ----------



Alignment 7
Sequence 1:
Sequence 2: Allergen Zan b 2.03, Sequence: QYS16039
Sequence identity: 44.47 (221/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---------------EAG-TEFWD-NNQQ--CA-VA--R--IQ--GLL-P
Sequence 2 ---------------EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQD-----RRRRFMD
           -Y-N-P-L-YVV-GRGI-G-VIPGC-ET-----Q--Q---------R--D
Sequence 2 AYTNTPELFYVVQGRGIHGAVIPGCPETYQDEQQQQQSFSYPSEGSRSQD

Sequence 1 RHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQT
           -HQKVRQ-R-GDI-ALP-G---W-YNNG---L--VAL-D-GN--NQLDQ-
Sequence 2 QHQKVRQIREGDIIALPTGSAHWIYNNGQSQLVLVALVDVGNSDNQLDQY

Sequence 1 FRHFFLAGNPQ----GGRQSYFGRPQTEKQQGETK----NIFNGFDDEIL
           FR-F-L-GNPQ----G--QS--GR-Q-----G-------NIFNGFD---L
Sequence 2 FRKFYLGGNPQPQLQGTSQSQGGRYQERLGGGDSSRRSANIFNGFDERLL

Sequence 1 ADAFGVDVQTARRLKGQDDLRGRIVRAERLDIVLPGEEEEERWERDPYSG
           A-AF-V-----RRL------RG-I-R-E----VL------E--E-DPY--
Sequence 2 AEAFNVNPELIRRLQRPQMQRGIIIRVEEEFRVLTPQRGQESYESDPYGR

Sequence 1 ANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLS
           -NG-EETLCT--LR-N---P-RADVYNP--GR----N-L-LPVL-WL-LS
Sequence 2 YNGVEETLCTMRLRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLS

Sequence 1 AEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVRE
           AEKG-LY-N-L-APHWNLNAHSI-YITRG-GR-Q-V---G--VFDG--RE
Sequence 2 AEKGNLYKNALTAPHWNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIRE

Sequence 1 GQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPE
           GQLI-VPQ---V-KRAS---GLEWISFKTND-AMT-QLAGR-S--RA-P-
Sequence 2 GQLIVVPQGFAVVKRAS-NRGLEWISFKTNDYAMTNQLAGRVSVLRALPL

Sequence 1 EVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFE
           -V------------------------------------------------
Sequence 2 DVIQN---------------------------------------------

Sequence 1 YVLDVIKSMM
           ----------
Sequence 2 ----------



Alignment 8
Sequence 1:
Sequence 2: Allergen Zan b 2.02, Sequence: QYU76044
Sequence identity: 42.86 (213/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---------------EAG-TEFWD-NN-Q--CA-VA--R--IQ--GLL-P
Sequence 2 ---------------EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFE--RDTQPRQDRRRRFMDRHQ
           -Y-N---L-YVV-GRGI-G-V-PGC-ET-------Q--Q----R--D-HQ
Sequence 2 AYTNTAELFYVVQGRGIHGAVFPGCPETYQDQQQQQSYQSQGSRSQDQHQ

Sequence 1 KVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRH
           KVRQ-R-GDI-ALP-G---W-YNNGG--L--VAL-D-GN--NQLDQ-FR-
Sequence 2 KVRQIREGDIIALPTGAAHWIYNNGGSQLVLVALVDVGNSDNQLDQYFRK

Sequence 1 FFLAGNPQGGRQSYFGRPQTEKQQG--------ETKNIFNGFDDEILADA
           F-L-GNPQ---Q----R-Q----QG-----------N-FNGFD---LADA
Sequence 2 FYLGGNPQPELQGTSQRQQGGGYQGSQGGGGGSRRGNMFNGFDERLLADA

Sequence 1 FGVDVQTARRLKGQDDLRGRIVRAER-LDIVLP--GEEEEERWERDPYSG
           F-V-----RRL------RG-IVR-E-------P--G-E-E---E-D----
Sequence 2 FNVNPELIRRLQRPQMQRGIIVRVEEEFRVLSPQRGQEQEQEQEQD---C

Sequence 1 ANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLS
           -NG-EET-CT-KLR-N---P-RADVYNP-GGR----N---LPVL-WL-LS
Sequence 2 DNGVEETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLS

Sequence 1 AEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVRE
           AEKG-LY-N-L--PHWNLN-HSI-YITRGSGR-Q-V---G--VF-G--RE
Sequence 2 AEKGNLYQNALTSPHWNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIRE

Sequence 1 GQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPE
           GQLI--PQ---V-K-AS---GLEWI-FKTNDNAMT-QLAGR-S--RA-P-
Sequence 2 GQLIVIPQGFAVVKKAS-NRGLEWIAFKTNDNAMTNQLAGRVSVMRALPL

Sequence 1 EVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFE
           -V------------------------------------------------
Sequence 2 DV------------------------------------------------

Sequence 1 YVLDVIKSMM
           ----------
Sequence 2 ----------



Alignment 9
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 40.44 (201/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ---------------L---L-A---------------------Q----C-
Sequence 2 ------------MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACN

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L----PT----SEAG--E-WD-N--Q--CAGV---R-VIQ--GL-LP
Sequence 2 LDNLDVLQPTEVIKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRR--------
           -----P---YVV-G-GI-G-VIPGCAETF--D-QP-Q-------------
Sequence 2 TFFSSPFISYVVQGMGISGRVIPGCAETFM-DSQPMQGQQGQQQGQQGQQ

Sequence 1 ------------------------------------FMDRHQKVRQFRQG
           ------------------------------------F-D-HQKV---R-G
Sequence 2 GQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHG

Sequence 1 DILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFFLAGNPQ
           D--A---G---W-YN-G--PLI-V-L-D--N--NQLD---R-F-LAGN-Q
Sequence 2 DAIAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQ

Sequence 1 GGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVDVQTARRLKGQDD
           -G------------QQ----NI--GFD---LA-A---DV--A--L--Q-D
Sequence 2 QG--------SSQQQQQQQQNILSGFDPQVLAQALKIDVRLAQELQNQQD

Sequence 1 LRGRIVRAER-LDIVLPGEE---EEERWE--RDPYSGA--NGLEETLCTA
           -RG-IVR-------V-P------E-E-W---R-P------NGLEET-C--
Sequence 2 KRGNIVRVKGPFQVVRPPLRQAYESEQWRHPRGPPQSPQDNGLEETICSM

Sequence 1 KLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGL
           ---EN-D-PARAD-Y-P--GR--S-NS-TLP-L---RLSA--G-L-----
Sequence 2 RTHENIDDPARADIYKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSAM

Sequence 1 VAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYV
           V-P--N-NA--I-Y-T-G--R-QVV---G--V-D--V--GQL---PQ---
Sequence 2 VLPKYNMNANEILYCTQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGFA

Sequence 1 VAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSR
           -----SQ----EWISFKTN-NAM-S-LAGR-SA-RA-P-EV---AYQ-S-
Sequence 2 YVVQ-SQNN-FEWISFKTNANAMISTLAGRTSALRALPLEVITNAYQISL

Sequence 1 DEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           -EAR--K-N--E-------------------------------------
Sequence 2 EEARKIKFNTLETTLTRARGGQQPQLIEEIVEV----------------



Alignment 10
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 50.50 (251/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           M---SLLSF-----LL-----AQ---EQ----Q--Q-QQQ---Q--T-C-
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQI--EQVVNSQ--QRQQQQRFQ--TQCQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A-EP--R-ESEAG-TEFWD-N--Q--CA-VA--R--IQ-RGLL-P
Sequence 2 IQNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPR--QDRRRRFMDRHQ
           -Y-NAP-L-YVV-G-GI-G-V-PGC-ETF----Q-R----R-------HQ
Sequence 2 SYDNAPELVYVVQGSGIHGAVFPGCPETFQEESQSRSRSERSQQSGEQHQ

Sequence 1 KVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRH
           KVR----GD--ALPAG---W-YNNG---L--VAL-D-GN--NQLDQ--R-
Sequence 2 KVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRK

Sequence 1 FFLAGNPQ----GGRQSYFGRPQTEK----QQGE-TKNIFNGFDDEILAD
           F-L-G-PQ----G--QS---R-Q-------QQG----NI---FD-EILA-
Sequence 2 FVLGGSPQQEIQGSGQSR-SRSQSQSSRRGQQGQQSNNILSAFDEEILAQ

Sequence 1 AFGVDVQTARRLKGQDDLRGRIVRA-ERLDIVLPG--EEEEERWERDPYS
           -F--D-Q-ARRL------RG-IVR--E-L----P---E-E-E--E-----
Sequence 2 SFNIDTQLARRLQKEKRQRGIIVRVQEDLEVLSPHRQEQEQEYEEERERR

Sequence 1 GANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRL
           --NGLEET-CT--L--N---P-RADVYNP-GGR-SS-N-L-LP-L--L-L
Sequence 2 QRNGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRFLQL

Sequence 1 SAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVR
           SA-KGVL-R----APHWN-NAHSI-YITRG-GR-Q-V---G-SVFD---R
Sequence 2 SAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIR

Sequence 1 EGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMP
           EGQL--VPQN--V-KRAS-D---EW-SFKTN----TSQLAGR-S--RA-P
Sequence 2 EGQLVVVPQNFAVVKRASSDK-FEWVSFKTNGLSQTSQLAGRVSVFRALP

Sequence 1 EEVVMTAYQVSRDEARRLKYNREESRVF---SSTSRYSWPRSSRPMSYMP
           --V-------SR--ARRLK--R-E---F---SS--R-S-----R------
Sequence 2 LDVIKNSFDISREDARRLKESRSETTIFAPGSSSQRKSQSERERQREREE

Sequence 1 KPFEYVLDVIKSMM
           --------------
Sequence 2 REIH----------



Alignment 11
Sequence 1:
Sequence 2: Allergen Zan b 2.0101, Sequence: QYU76045
Sequence identity: 42.86 (213/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---------------EAG-TEFWD-NN-Q--CA-VA--R--IQ-RGLL-P
Sequence 2 ---------------EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETF--ERDTQPRQDRRRRFMDRHQ
           -Y-N---L-YVV-GRGI-G-V-PGC-ET-------Q--Q----R--D-HQ
Sequence 2 SYTNTAELFYVVQGRGIHGAVFPGCPETYQDQQQQQSHQSEGSRSQDQHQ

Sequence 1 KVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRH
           KVRQ-R-GDI-A-P-G---W-YNNG---L--VAL-D-GN--NQLDQ--R-
Sequence 2 KVRQLREGDIVAVPTGSAHWIYNNGQSQLVLVALVDVGNSDNQLDQYLRK

Sequence 1 FFLAGNPQGGRQSYF---GRPQTEKQQGETK-------NIFNGFDDEILA
           F---GNPQ---Q-Y----G-------QGE---------NIFNGFD---LA
Sequence 2 FYIGGNPQQELQGYSQSQGSRSYQGSQGEGSSRRSSGGNIFNGFDERLLA

Sequence 1 DAFGVDVQTARRLKGQDDLRGRIVRAER-LDIVLPGEEEEERWERDPYSG
           DAF-V-----RRL------RG-IVR-E--L----P----E---E------
Sequence 2 DAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRPQRGQEQEQEQEFRGR

Sequence 1 ANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLS
           -NGLEET-CT-KL--N---P--ADVYNP-GGRIS--NS--LPVL-W--LS
Sequence 2 DNGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLS

Sequence 1 AEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVRE
           AEKG-LY-N---APHWNLN-HS--Y-TRGSGR-Q-V---G--V-DG---E
Sequence 2 AEKGNLYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKE

Sequence 1 GQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPE
           GQLI-VPQ-Y-V-KRAS---GLEWISFKTNDNA-TSQLAGR-S-IRA-P-
Sequence 2 GQLIVVPQGYAVLKRAS-NQGLEWISFKTNDNAETSQLAGRNSVIRALPL

Sequence 1 EVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFE
           -V------------------------------------------------
Sequence 2 DVIQN---------------------------------------------

Sequence 1 YVLDVIKSMM
           ----------
Sequence 2 ----------



Alignment 12
Sequence 1:
Sequence 2: Allergen Zan b 2.0102, Sequence: QYU76046
Sequence identity: 43.26 (215/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---------------EAG-TEFWD-NN-Q--CA-VA--R--IQ-RGLL-P
Sequence 2 ---------------EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETF--ERDTQPRQDRRRRFMDRHQ
           -Y-N---L-YVV-GRGI-G-V-PGC-ET-------Q--Q----R--D-HQ
Sequence 2 SYTNTAELFYVVQGRGIHGAVFPGCPETYQDQQQQQSHQSEGSRSQDQHQ

Sequence 1 KVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRH
           KVRQ-R-GDI-A-P-G---W-YNNG---L--VAL-D-GN--NQLDQ--R-
Sequence 2 KVRQLREGDIVAMPTGSAHWIYNNGQSQLVLVALVDVGNSDNQLDQYLRK

Sequence 1 FFLAGNPQGGRQSYF---GRPQTEKQQGETK-------NIFNGFDDEILA
           F---GNPQ---Q-Y----G-------QGE---------NIFNGFD---LA
Sequence 2 FYIGGNPQQELQGYSQSQGSRSYQGSQGEGGSRRSSGGNIFNGFDERLLA

Sequence 1 DAFGVDVQTARRLKGQDDLRGRIVRAER-LDIVLP--GEEEEERWERDPY
           DAF-V-----RRL------RG-IVR-E--L----P--GE-E-E---R---
Sequence 2 DAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRPQRGEQEQEQEFR---

Sequence 1 SGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLR
           ---NGLEET-CT-KL--N---P--ADVYNP-GGRIS--NS--LPVL-W--
Sequence 2 GRDNGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQ

Sequence 1 LSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVV
           LSAEKG-LY-N---APHWNLN-HS--Y-TRGSGR-Q-V---G--V-DG--
Sequence 2 LSAEKGNLYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQI

Sequence 1 REGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAM
           -EGQLI-VPQ-Y-V-K-AS---GLEWISFKTNDNA-TSQLAGR-S-IRA-
Sequence 2 KEGQLIVVPQGYAVLKKAS-NQGLEWISFKTNDNAETSQLAGRNSVIRAL

Sequence 1 PEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKP
           P--V----------------------------------------------
Sequence 2 PLDVIQN-------------------------------------------

Sequence 1 FEYVLDVIKSMM
           ------------
Sequence 2 ------------



Alignment 13
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 53.32 (265/497)
Sequence 1 MALTSLLSFFI-VVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDC
           MA---LLS--------L--G--AQ--G-Q---------QQQ--------C
Sequence 2 MAKPILLSIYLFLIVALFNGCLAQSGGRQ---------QQQFG-----QC

Sequence 1 RVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLL
           ---RL-A-EPT-R-E-EAG--E-WD-NNQQF-CAGVA-VR--I-P-GLLL
Sequence 2 QLNRLDALEPTNRIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLL

Sequence 1 PHYNNAPQLLYVVRGRGIQGTVIPGCAETFERDT-QPRQDRRRRFM-DRH
           P-Y-NAPQL-Y--RGRGI-G---PGC-ETFE----Q--Q---R-F--DRH
Sequence 2 PQYSNAPQLVYIARGRGITGVLFPGCPETFEESQRQSQQGQSREFQQDRH

Sequence 1 QKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFR
           QK-R-FR-GDI-A-PAG---W-YN-G--P-----LLDT-N-ANQLDQ--R
Sequence 2 QKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPR

Sequence 1 HFFLAGNPQG-----GRQSYFG-RPQTEKQQ----------GETKNIFNG
           -F-LAGNP-------G-Q-Y---R-Q---QQ----------G---N-F-G
Sequence 2 NFYLAGNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNNVFSG

Sequence 1 FDDEILADAFGVDVQTARRLKGQDDLRGRIVRAE--RLDIVLP--GEEEE
           FD---LADAF-VD--TARRL----D-R--IVR-E---L----P----EE-
Sequence 2 FDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQ

Sequence 1 ERWER--------------DPYSGA---NGLEETLCTAKLRENLDEPARA
           ER-ER------------------G----NGLEET-CT--LREN---P-RA
Sequence 2 EREERKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRA

Sequence 1 DVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSI
           D-Y----GRIS--NS-TLPVL-WL-LSAE-G-LY---L--PHWNLNAHS-
Sequence 2 DIYTEEAGRISTVNSHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSV

Sequence 1 IYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLE
           -Y--RG----QVV---G--VFD---REGQL---PQN--V-KRA---EG-E
Sequence 2 VYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRA-RNEGFE

Sequence 1 WISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREE
           W-SFKTN-NAM-S-LAGR-SAIRA-PEEV--TA-Q--R--ARRLK-NR-E
Sequence 2 WVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIPREDARRLKFNRQE

Sequence 1 SRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           S----S--R-S--RSSR--------------------
Sequence 2 STLVRS--RPSRSRSSRSERRAEV-------------



Alignment 14
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 53.52 (266/497)
Sequence 1 MALTSLLSFFI--VVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTD
           MA---LLS---------L--G--AQ--G------------QQHK------
Sequence 2 MAKPILLSIYLCLIIVALFNGCLAQSGG-----------RQQHKFG---Q

Sequence 1 CRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLL
           C---RL-A-EPT-R-E-EAG--E-WD-N-QQ--CAGVA-VR--I-P-GLL
Sequence 2 CQLNRLDALEPTNRIEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLL

Sequence 1 LPHYNNAPQLLYVVRGRGIQGTVIPGCAETFERDT-QPRQDRRRRFM-DR
           LPHY-NAPQL-Y--RGRGI-G---PGC-ETFE----Q--Q--RR-F--DR
Sequence 2 LPHYSNAPQLVYIARGRGITGVLFPGCPETFEESQRQSQQGQRREFQQDR

Sequence 1 HQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTF
           HQK-R-FR-GDI-A-PAG---W-YN-G--P-----LLDT-N-ANQLDQ--
Sequence 2 HQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNP

Sequence 1 RHFFLAGNPQG-----GRQSYFG-RPQTEKQQ-----GETK-----NIFN
           R-F-LAGNP-------G-Q-Y---R-Q---QQ-----GE-------N-F-
Sequence 2 RNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGNNVFS

Sequence 1 GFDDEILADAFGVDVQTARRLKGQDDLRGRIVRAE--RLDIVLPG-----
           GFD-E-LADAF-VD--TARRL----D-RG-IVR-E---L----P------
Sequence 2 GFDAEFLADAFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREE

Sequence 1 EEEEERWERD-----------PYSGA---NGLEETLCTAKLRENLDEPAR
           -E-EER-ER---------------G----NGLEET-CT--LREN---P-R
Sequence 2 QEHEERKERERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSR

Sequence 1 ADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHS
           AD-Y----GRIS--NS--LP-L-WL-LSAE-G-LY---L--PHWNLNAHS
Sequence 2 ADIYTEEAGRISTVNSHNLPILRWLQLSAERGALYSDALYVPHWNLNAHS

Sequence 1 IIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGL
           --Y--RG----QVV---G--VFD---REGQL---PQN--V-KRA--DEG-
Sequence 2 VVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRA-RDEGF

Sequence 1 EWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNRE
           EW-SFKTN-NAM-S-LAGR-SAIRA-PEEV---A-Q--R--ARRLK-NR-
Sequence 2 EWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQIPREDARRLKFNRQ

Sequence 1 ESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           ES----S-SR-S--RS-R--------------------
Sequence 2 ESTLVRSRSRSS--RSERRAEV----------------



Alignment 15
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 45.47 (226/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQH--KLQARTD
           M-----LSF-----L-----SAQL-------WQ--Q----H----Q----
Sequence 2 MSTKLILSFSLC--LMVLSCSAQL-----LPWQKGQRSRPHHGHQQFQHQ

Sequence 1 CRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLL
           C---RLTA-EP--R--SEAG-TE-WD-----F-CAG--AVR-VIQP-GLL
Sequence 2 CDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLL

Sequence 1 LPHYNNAPQLLYVVRGRGIQGTVIPGCAETFE-----------RDTQPRQ
           LP-Y-NAP----V--GRG-QG-V-PGC-ETF------------RD---RQ
Sequence 2 LPSYSNAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQ

Sequence 1 ---------DRRRR---------------------FM--DRHQKVRQFRQ
           ---------D-R-R---------------------F---D-HQK----R-
Sequence 2 SESGESSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRD

Sequence 1 GDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFFLAGNP
           GD----PAG---W--NNG---LI---L-D-----NQLD---R-FFLAG--
Sequence 2 GDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQS

Sequence 1 QGGRQSYFGRPQT-----EKQQGETK--------NIFNGFDDEILADAF-
           ---R-------QT-------Q--E----------NI--GF-DEIL---F-
Sequence 2 KQSREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFR

Sequence 1 GVDVQTARRLKGQDDLRGRIVRAERLDIVLPGEEEEE-RWERDPY----S
           -VD--T---L-G--D-RG-IV-A--L----P-E-EEE---ER-------S
Sequence 2 NVDQETISKLRGENDQRGFIVQARDLKLRVPEEYEEELQRERGDRKRGGS

Sequence 1 G-ANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLR
           G--NGLE---C--K-R-N---P-RADV-NP--GRI----S--LP-L----
Sequence 2 GRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQ

Sequence 1 LSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVV
           LSA---VLY-N----P-WNLNAHS--Y-TRG-GR-QVVG--GRSVFD--V
Sequence 2 LSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNV

Sequence 1 REGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAM
           --GQ---VPQ---V---A---EGLEW---K--DNA-TS--AG--S--RA-
Sequence 2 QRGQILVVPQGFAVVLKAGR-EGLEWVELKNDDNAITSPIAGKTSVLRAI

Sequence 1 PEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKP
           P-EV----Y--S--EA-RLK--R-E--VF------------R--------
Sequence 2 PVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV----

Sequence 1 FEYVLDVIKSMM
           ------------
Sequence 2 ------------



Alignment 16
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 45.27 (225/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHK--LQARTD
           M-----LSF-----L-----SAQL-------W---Q----H----Q----
Sequence 2 MSTKLILSFSLC--LMVLSCSAQL-----LPWRKGQRSRPHRGHQQFHHQ

Sequence 1 CRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLL
           C-V-RLTA-EP--R--SEAG-TE-WD-----F-CAG--AVR-VIQP-GLL
Sequence 2 CDVQRLTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLL

Sequence 1 LPHYNNAPQLLYVVRGRGIQGTVIPGCAETFE-----------RDTQPRQ
           LP-Y-NAP----V--GRG-QG-V-PGC-ETF------------RD---RQ
Sequence 2 LPSYSNAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQ

Sequence 1 ------------------------DRRRR------FM-------------
           ------------------------D-R-R------F--------------
Sequence 2 SESEESSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEE

Sequence 1 -------------------DRHQKVRQFRQGDILALPAGLTLWFYNNGGE
           -------------------D-HQK----R-GD----PAG---W--N-G--
Sequence 2 FSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDN

Sequence 1 PLITVALLDTGNAANQLDQTFRHFFLAGNPQGGRQSYFGRPQT-----EK
           -LI---L-D-----NQLD---R-FFLAG-----R-------QT-------
Sequence 2 DLISITLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDR

Sequence 1 QQGETK--------NIFNGFDDEILADAF-GVDVQTARRLKGQDDLRGRI
           Q--E----------NI--GF-DEIL---F--VD--T---L-G--D-RG-I
Sequence 2 QSRESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFI

Sequence 1 VRAERLDIVLPGEEEEE-RWER-DPYSG----ANGLEETLCTAKLRENLD
           V-A--L----P-E-EEE---ER-D---G-----NGLE---C--K---N--
Sequence 2 VQARDLKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVN

Sequence 1 EPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNL
           -P-RADV-NP--GRI---NS--LP-L----LSA---VLY-N----P-WNL
Sequence 2 RPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNL

Sequence 1 NAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQ
           NAHS--Y-TRG-GR-QVVG--GRSVFD--V--GQ---VPQ---V---A--
Sequence 2 NAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGR

Sequence 1 DEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLK
           -EGLEW---K--DNA-TS--AG--S--RA-P-EV----Y--S--EA-RLK
Sequence 2 -EGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLK

Sequence 1 YNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           --R-E--VF------------R--------------------
Sequence 2 NGRQEVEVFLPFQSRDEKERERF-------------------



Alignment 17
Sequence 1:
Sequence 2: Allergen Jug n 4.0101, Sequence: A0A1L6K371
Sequence identity: 52.72 (262/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           MA---LLS-------L--G--AQ--G------------QQ--------C-
Sequence 2 MAKPILLSISLCLVALVNGCLAQSGG-----------RQQPRFG---ECK

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           --RL-A-EP--R-E-EAG--E-WD-NNQQF-CAGVA-VR--I-P-GLLLP
Sequence 2 LKRLVALEPSNRIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRR------RFM
           -Y-NAPQLLY-V-GRGI-G---PGC-ETFE---Q--Q-R-R-------F-
Sequence 2 QYSNAPQLLYIVKGRGITGVLFPGCPETFE-ESQQGQSRIRPSLRSASFQ

Sequence 1 -DRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLD
           -DRHQK-R-FR-GD--A-PAG---W-YN-G--P---VAL-DT-N-ANQLD
Sequence 2 RDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNNANQLD

Sequence 1 QTFRHFFLAGNPQG-----GRQSY------------FGRPQTEKQQGETK
           Q--R-F-LAGNP-------G-Q-Y-------------G-P----Q-G---
Sequence 2 QNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPG-QQQRGSGN

Sequence 1 NIFNGFDDEILADAFGVDVQTARRLKGQDDLRGRIVRAE--RLDIVLP--
           N-F-GFD---LADAF-VD--TARRL----D-R--IVR-E---L----P--
Sequence 2 NVFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRW

Sequence 1 GEEEEERWER--------------DPYSGA---NGLEETLCTAKLRENLD
           --EE-ER-ER------------------G----NGLEET-CT--LREN--
Sequence 2 SREEQEREERKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIG

Sequence 1 EPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNL
           -P-RAD-Y----GRIS--NS-TLPVL-WL-LSAE-G-LY---L--PHWNL
Sequence 2 DPSRADIYTEEAGRISTANSHTLPVLRWLQLSAERGALYSDALYVPHWNL

Sequence 1 NAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQ
           NAHS--Y--RG----QVV---G--VFD---REGQL---PQN--V-KRA--
Sequence 2 NAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRA-R

Sequence 1 DEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLK
           -EG-EW-SFKTN-NAM-S-LAGR-SAIRA-PEEV---A-Q--R--ARRLK
Sequence 2 NEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLANALQIPREDARRLK

Sequence 1 YNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           -NR-ES----S--R-S--RSSR--------------------
Sequence 2 FNRQESTLVRS--RPSSSRSSRSERRAEV-------------



Alignment 18
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 52.11 (259/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           MA---L-SF------L--G------G--------L--QQQ--------C-
Sequence 2 MAKLILVSFSLCLLVLFNGCLGINVG--------LRRQQQRYFG---ECN

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           --RL-A-EPT-R-E-EA---E-WD-N-QQF-CAGVA--R--I-P-GLLLP
Sequence 2 LDRLNALEPTNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRR--------
           -Y-NAP-L-Y--RGRGI-G---PGC-ETFE---Q--Q---R---------
Sequence 2 QYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRS

Sequence 1 FMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQL
           --DRHQK-R-FR-GDI-ALPAG---W-YN-G--P--TV-LL-T-N-ANQL
Sequence 2 EQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQL

Sequence 1 DQTFRHFFLAGNP----QGGRQSYFG---RPQT--------EKQQGETKN
           D---RHF-LAGNP----Q---Q--FG---R-Q-----------QQGE--N
Sequence 2 DENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNN

Sequence 1 IFNGFDDEILADAFGVDVQTARRLKGQDDLRGRIVRAE-RLDIVLP----
           -F-GFD-E-LADAF-VDV-TARRL----D-R--IV--E-RL--V-P----
Sequence 2 VFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSR

Sequence 1 ------------GEEEEERWERDPYSG--ANGLEETLCTAKLRENLDEPA
           -------------E-E-ER--R----G---NG-EET-C---LREN-----
Sequence 2 QEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRS

Sequence 1 RADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAH
           RAD-Y----GRI---NS-TLPVL-WL-LSAE-G-L-R-GL--PHWNLNAH
Sequence 2 RADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAH

Sequence 1 SIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEG
           S--Y--RG--R-QVV---G--VFD---R-GQ----PQN--VAKRA---EG
Sequence 2 SVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRA-ESEG

Sequence 1 LEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNR
           -EW--FKTNDNA--S-LAGR-SAIRA-P--V---A-Q-SR-EARRLKYNR
Sequence 2 FEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYNR

Sequence 1 EESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           -E-----S-SR-S--R--R--S-----------------
Sequence 2 QETTLVRS-SRSSSERKRRSESEGRAEA-----------



Alignment 19
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 47.48 (236/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           MA--SLLS-------L--G----LA--Q-------Q-QQQ--------C-
Sequence 2 MANPSLLSLSVCLLILFHGC---LASRQ-------QGQQQN------ECQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A-EP--R-E-EAG--E-WD-N--QF-CAGVA--R--IQP-GL-LP
Sequence 2 IDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQD-RRRRFMDRHQK
           -Y-NAP-L-Y-V-G-G--GT-IPGC-ET-----Q--Q-----RF-D-HQK
Sequence 2 EYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHGQSSRFQDKHQK

Sequence 1 VRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHF
           ---FR-GDI-ALPAG---W-YN-G--P--TV-LLD--N--NQLD---R-F
Sequence 2 IQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKF

Sequence 1 FLAGNP-----QGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVD
           -LAGNP-----Q---Q---GR-Q---QQ----NIF-GFD--ILA--F-V-
Sequence 2 NLAGNPEDEFQQQQQQQSRGRRQS--QQKSCNNIFCGFDTKILAEVFQVE

Sequence 1 VQTARRLKGQDDLRGRIVRAE-RLDIVLPGE---------EEEERWERDP
           ------L----D-RG-IV-----L----P-----------EEE---ER--
Sequence 2 QSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGR

Sequence 1 YSGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWL
           ----NGLEET-CT-KL-EN---P-R-D-Y-P--GRI-SLNSL-LP-L-WL
Sequence 2 RGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWL

Sequence 1 RLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGV
           -LSAE-GVL--N-L--PHWN-NAHSI-Y---G----QVV---G--VFDG-
Sequence 2 QLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGE

Sequence 1 VREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRA
           V-EGQ---VPQN--V-KRA------EWISFKTND-AM-S-LAG--S--RA
Sequence 2 VSEGQIFVVPQNFAVVKRA-RGQRFEWISFKTNDRAMISPLAGSTSVLRA

Sequence 1 MPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPK
           MPEEV---A-Q-SR--AR--K-N-E-----S--S----------------
Sequence 2 MPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA--------

Sequence 1 PFEYVLDVIKSMM
           -------------
Sequence 2 -------------



Alignment 20
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 47.28 (235/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ---------------------------------------QH---------
Sequence 2 --------------------------CLLLLFNGCLASRQHIFGQNKEWQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A-EP-----SEAG-TE-W-----QF--AGVA-VR--I-P-GL-LP
Sequence 2 LNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQP----RQDRRRRF---
           -Y-NAPQL-Y-VRGRG--G-V-PGCAETFE-D-QP-----Q-----F---
Sequence 2 SYVNAPQLIYIVRGRGVLGAVFPGCAETFE-DSQPQQFQQQQQQQQFRPS

Sequence 1 ----------------MDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPL
           -----------------DRHQK-R--R-GDI-ALPAG---W-YNNG--PL
Sequence 2 RQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPL

Sequence 1 ITVALLDTGNAANQLDQTFRHFFLAGNPQGG-RQSYFGRPQTEKQQGET-
           --V-LLD--N--NQLDQ--R-F-LAGNPQ--------GR-Q---QQG---
Sequence 2 VAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQG

Sequence 1 --KNIFNGFDDEILADAFGVDVQTARRLKGQDDLRGRIVRAE-RLDIVLP
           ---NIF-GFD---LA-A--V---TAR-L-GQDD-R--IVR----LD-V-P
Sequence 2 NGNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSP

Sequence 1 --------G-------------EEEEERWERDPYSGA---NGLEETLCTA
           --------G-------------E-EE---E-----G----NG-EET-C-A
Sequence 2 FSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSA

Sequence 1 KLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGL
           -L--N---P-RAD-YNP-GGRIS--N---LP-L--LRLSAEKGVLY-N--
Sequence 2 RLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAI

Sequence 1 VAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYV
           --PHW--NA----Y--RG--R-QVV---G----D--VREGQL---PQN--
Sequence 2 YTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHA

Sequence 1 VAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSR
           V---AS--EG-E-ISF-T--N--T--LAGR-S--RA-P-EV---A---SR
Sequence 2 VITQAS-NEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISR

Sequence 1 DEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           -EAR-LKYNR-ESR--S-TS----P---R-MS-----------------
Sequence 2 QEARNLKYNRQESRLLSATS----PPRGRLMSILGY-------------



Alignment 21
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 44.67 (222/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ---------------------------------------Q--L-----C-
Sequence 2 -----------------MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A-EP--R---EAG--E-W--N---F-CAGVAA-R--IQ--GL-LP
Sequence 2 LNQLQAREPDNRIQAEAGQIETWNFNQEDFQCAGVAASRITIQRNGLHLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQ----------------
           -Y-NAPQL-Y-V-GRG--G-V--GC-ETFE---Q----------------
Sequence 2 SYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQ

Sequence 1 --------------------------------------------PRQDRR
           --------------------------------------------P-Q---
Sequence 2 QQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQ

Sequence 1 RRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAAN
           -R--DRHQK-R--R-GD--A-PAG---W-YN-G---L--V-L-------N
Sequence 2 FRQFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHN

Sequence 1 QLDQTFRHFFLAGNP------QG----------GR----QSYFGRPQTEK
           QLDQ--R-F-LAGNP------QG----------GR----Q--FGRP----
Sequence 2 QLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQE

Sequence 1 QQGETKNIFNGFDDEILADAFGVDVQTARRLKGQDDLRGRIVRAE-RLDI
           QQG---N-F-GF----LA-A--V---TAR-L-GQ-D-R--I-R----LD-
Sequence 2 QQGSGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIRVRGNLDF

Sequence 1 VLP--GEEE---EERW------ERDPYSG---ANGLEETLCTAKLRENLD
           V-P--G--E---EER-------ER----G---ANGLEET-C---L-EN--
Sequence 2 VQPPRGRQEREHEERQQEQLQQERQQQGGQLMANGLEETFCSLRLKENIG

Sequence 1 EPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNL
           -P-RAD---P--GRIS-LNS--LP-L--LRLSAE-G--YRNG---PHWN-
Sequence 2 NPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNV

Sequence 1 NAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQ
           NAHS--Y--RG--R-QVV---G----D--V--GQL-IVPQN--V---A--
Sequence 2 NAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAG-

Sequence 1 DEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLK
           --G-E---FKT--NA----LAGR-S--RA-P-EV---AYQ-SR--AR-LK
Sequence 2 NQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLK

Sequence 1 YNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           YNR-E----SS-------------------------------
Sequence 2 YNRQETIALSSSQQRRAVV-----------------------



Alignment 22
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 44.06 (219/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ---------------------------------------Q--L-----C-
Sequence 2 -------------------------------------ARQSQLSPQNQCQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A-EP--R---EAG--E-W--N---F-CAGVAA-R--IQ--GL-LP
Sequence 2 LNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQ----------------
           -Y-NAPQL-Y-V-GRG--G-V--GC-ETFE---Q----------------
Sequence 2 SYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQ

Sequence 1 --------------------------------------------PRQDRR
           --------------------------------------------P-Q---
Sequence 2 QQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQ

Sequence 1 RRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAAN
           -R--DRHQK-R--R-GD--A-PAG---W-YN-G---L--V-L-------N
Sequence 2 FRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHN

Sequence 1 QLDQTFRHFFLAGNP------QG----------GR----QSYFGRPQTEK
           QLDQ--R-F-LAGNP------QG----------GR----Q--FGRP----
Sequence 2 QLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQE

Sequence 1 QQGETKNIFNGFDDEILADAFGVDVQTARRLKGQDDLRGRIVRAE-RLDI
           QQG---N-F-GF----LA-A--V---TAR-L-GQ-D-R--I------LD-
Sequence 2 QQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDF

Sequence 1 VLP--GEEEEERWERDP--------YSG----ANGLEETLCTAKLRENLD
           V-P--G--E-E--ER------------G----ANGLEET-C---L-EN--
Sequence 2 VQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIG

Sequence 1 EPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNL
           -P-RAD---P--GRIS-LNS--LP-L--LRLSAE-G--YRNG---PHWN-
Sequence 2 NPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNV

Sequence 1 NAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQ
           NAHS--Y--RG--R-QVV---G----D--V--GQL-IVPQN--V---A--
Sequence 2 NAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAG-

Sequence 1 DEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLK
           --G-E---FKT--NA----LAGR-S--RA-P-EV---AYQ-SR--AR-LK
Sequence 2 NQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLK

Sequence 1 YNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           YNR-E----SS-------------------------------
Sequence 2 YNRQETIALSSSQQRRAVV-----------------------



Alignment 23
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 43.86 (218/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQS------QQQHKLQ
           M-----LSF-----L-----SAQL-------WQ--Q--------QQH--Q
Sequence 2 MSTKLILSFSLC--LMVLSCSAQL-----WPWQKGQGSRPHHGRQQHQFQ

Sequence 1 ARTDCRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQP
           ----C---RLTA-EP--R--SEAG-TE-WD-----F-C-G--AVR-VIQP
Sequence 2 HQ--CDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQP

Sequence 1 RGLLLPHYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQ---PRQDRRR
           -GLLLP-Y-NAP----V--GRG-QG-VIPGC-ETF--D-----P---R-R
Sequence 2 GGLLLPSYSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGR

Sequence 1 RFM-----------DRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITV
           --------------D-HQK----R-GD----PAG---W--N-G---LI-V
Sequence 2 HSRQSESEEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISV

Sequence 1 ALLDTGNAANQLDQTFRHFFLAGNPQG-GRQSYFGRPQTEKQQGET---K
           -LLD------QLD---R-FFLAG--Q---R-----R---E----E-----
Sequence 2 TLLDANSYHKQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGA

Sequence 1 NIFNGFDDEILADAF-GVDVQTARRLKGQDDLRGRIVRAERLDIVLPG--
           NI--GF-DEIL---F--VD--T---L-G--D-RG-IV-A--L----P---
Sequence 2 NILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRVPQDF

Sequence 1 EEEEERWERDPYSG------ANGLEETLCTAKLRENLDEPARADVYNPHG
           EEE-ER---D---G-------NG-E---C--K-R-N---P----V-NP--
Sequence 2 EEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRA

Sequence 1 GRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGS
           GRI---NS--LP-L--L-LSA---VLY-N----P-WNLNAHS--Y-TRG-
Sequence 2 GRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGE

Sequence 1 GRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTN
           GR-QVVG--G-SVFD--V--GQ---VPQ---V---A---EGLEW---K--
Sequence 2 GRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGR-EGLEWVELKNS

Sequence 1 DNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSST
           -NA-TS---GR-S--RA-P-EV----Y--S--EA--LK--R-E--VF---
Sequence 2 GNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPF

Sequence 1 SRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           ---------R--------------------
Sequence 2 QSRDEKERERFSIV----------------



Alignment 24
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 39.44 (196/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ------------------G----L------------------------C-
Sequence 2 -----------------MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A-EP--R-ESE-GL---W--------CAGV----------GL-LP
Sequence 2 LNNLNALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRR------RRFM
           -Y---P-------G-G--G--IPGC-ETFE---Q----RR----------
Sequence 2 SYSPYPRMIIIAQGKGALGVAIPGCPETFE-EPQEQSNRRGSRSQKQQLQ

Sequence 1 DRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQ
           D-HQK-R-F--GD-L--P-G---W-YN-G-EP-----LLDT-N--NQLDQ
Sequence 2 DSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQ

Sequence 1 TFRHFFLAGNP----------QGGRQSYFGRPQTEKQQGETK---NIFNG
           T-R-F-LAGNP----------Q----S--GR-Q---QQ-E---------G
Sequence 2 TPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSG

Sequence 1 FDDEILADAFGVDVQTARRLKGQDDLRGRIVRAER-LDIVLP--------
           F----LA--F------A--L---DD-R--IV--E--L----P--------
Sequence 2 FSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDE

Sequence 1 GEEEEE------------------RWERD--------------PYSGA--
           -E-E-E--------------------E-D--------------P--G---
Sequence 2 DEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKRE

Sequence 1 ---------------------------------------------NGLEE
           ---------------------------------------------NG-EE
Sequence 2 QDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEE

Sequence 1 TLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVL
           --CT-KL-EN---P-RAD-YNP--GRIS-LNSLTLP-L----LSA---VL
Sequence 2 NICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVL

Sequence 1 YRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIV
           Y-NG---PHWNLNA-S-IY-TRG-G---VV---G--VFDG--R-GQL--V
Sequence 2 YKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVV

Sequence 1 PQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTA
           PQN-VVA--A----G-E-I-FKT--NA-TS-L-------RA-P-EV----
Sequence 2 PQNFVVAEQAGE-QGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHS

Sequence 1 YQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVI
           Y---------LKY-----------S----PR-------------------
Sequence 2 YNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA---------------

Sequence 1 KSMM
           ----
Sequence 2 ----



Alignment 25
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 39.03 (194/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           -----------------------L------------------------C-
Sequence 2 ----------------MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A-EP--R-ESE-GL-E-W--------CAGV----------GL-LP
Sequence 2 LNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDR----RRRFMDR
           -Y---PQ---VV-G-G--G---PGC-ETFE---Q----R---------D-
Sequence 2 SYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDS

Sequence 1 HQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTF
           HQK-R-F--GD-L--P-G---W-YN-G-EP-----LLDT-N--NQLDQ--
Sequence 2 HQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNP

Sequence 1 RHFFLAGNP----------QGGRQSYFGRPQTEKQQGETK--NIFNGFDD
           R-F-LAGNP----------Q----S--GR-Q---QQ-E--------GF--
Sequence 2 RVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSK

Sequence 1 EILADAFGVDVQTARRLKGQDDLRGRIVRAER-LDIVLP--------GEE
           --LA--F-----TA--L---DD-R--IV--E--L----P---------E-
Sequence 2 HFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDED

Sequence 1 EEERWE-------RDPYSGA------------------------------
           E-E--E-------R-P--G-------------------------------
Sequence 2 EDEEYEQTPSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQE

Sequence 1 ---------NGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLP
           ---------NG-EE--CT-KL-EN---P-RAD-YNP--GRIS-LNSLTLP
Sequence 2 PRGRGCQTRNGVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLP

Sequence 1 VLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRS
           -L----LSA---VLYRNG---PHWNLNA-S-IY-TRG-GR--VV---G--
Sequence 2 ALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNA

Sequence 1 VFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRL
           VFDG--R-GQL--VPQN-VVA-------GLE---FKT--NA--S------
Sequence 2 VFDGELRRGQLLVVPQNFVVAEQGGE-QGLEYVVFKTHHNAVSSYIK---

Sequence 1 SAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPM
           ---RA-P-EV----Y-------R-LKY-----------------------
Sequence 2 DVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP-------------

Sequence 1 SYMPKPFEYVLDVIKSMM
           ------------------
Sequence 2 ------------------



Alignment 26
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 38.03 (189/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ------------------------------------------------C-
Sequence 2 ------------------MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A--P--R-ESE-GL-E-W--NN--F-CAGVA--R-------L--P
Sequence 2 IQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQ-DRRRRFMDRHQK
           -Y-N-PQ--Y---G-GI-G---PGC--TFE---QP-Q-----R--DRHQK
Sequence 2 SYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQK

Sequence 1 VRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHF
           ---FR-GD--A-P-G---W-YNN---P---V---DT----NQLDQ--R-F
Sequence 2 IYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRF

Sequence 1 FLAGNP----------QGGRQSYFGRPQTEKQQGETKNIFNGFDDEILAD
           -LAGN-----------QGG-QS--G--Q-E----E---I--GF--E-L--
Sequence 2 YLAGNQEQEFLKYQQEQGGHQSQKGKHQQE-EENEGGSILSGFTLEFLEH

Sequence 1 AFGVDVQTARRLKGQDD--LRGRIVRAER-LDIVLPG---------EEEE
           AF-VD-Q-A--L-G-------G-IV-----L----P----------EEEE
Sequence 2 AFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEE

Sequence 1 ERWERDPY-----------------SGANGLEETLCTAKLRENLDEPARA
           E-----P------------------S--NG--ET-CT--LR-N-------
Sequence 2 EEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSP

Sequence 1 DVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSI
           D-YNP--G------SL--P-LSWLRLSAE-G-L--N----PH-NLNA-SI
Sequence 2 DIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSI

Sequence 1 IYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLE
           IY---G----QVV---G--VFDG---EG---IVPQN-VVA-R-SQ----E
Sequence 2 IYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAAR-SQSDNFE

Sequence 1 WISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREE
           --SFKTND--M---LAG--S---A-PEEV-----------AR--K-N---
Sequence 2 YVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF

Sequence 1 SRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           -------------------------------------
Sequence 2 KFLVPPQESQKRAVA----------------------



Alignment 27
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 38.03 (189/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ------------------------------------------------C-
Sequence 2 ------------------MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A--P--R-ESE-GL-E-W--NN--F-CAGVA--R-------L--P
Sequence 2 IQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQ-DRRRRFMDRHQK
           -Y-N-PQ--Y---G-GI-G---PGC--TFE---QP-Q-----R--DRHQK
Sequence 2 SYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQK

Sequence 1 VRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHF
           ---FR-GD--A-P-G---W-YNN---P---V---DT----NQLDQ--R-F
Sequence 2 IYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRF

Sequence 1 FLAGNP----------QGGRQSYFGRPQTEKQQGETKNIFNGFDDEILAD
           -LAGN-----------QGG-QS--G--Q-E----E---I--GF--E-L--
Sequence 2 YLAGNQEQEFLKYQQEQGGHQSQKGKHQQE-EENEGGSILSGFTLEFLEH

Sequence 1 AFGVDVQTARRLKGQDD--LRGRIVRAER-LDIVLPG---------EEEE
           AF-VD-Q-A--L-G-------G-IV-----L----P----------EEEE
Sequence 2 AFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEE

Sequence 1 ERWERDPY-----------------SGANGLEETLCTAKLRENLDEPARA
           E-----P------------------S--NG--ET-CT--LR-N-------
Sequence 2 EEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSP

Sequence 1 DVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSI
           D-YNP--G------SL--P-LSWLRLSAE-G-L--N----PH-NLNA-SI
Sequence 2 DIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSI

Sequence 1 IYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLE
           IY---G----QVV---G--VFDG---EG---IVPQN-VVA-R-SQ----E
Sequence 2 IYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAAR-SQSDNFE

Sequence 1 WISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREE
           --SFKTND--M---LAG--S---A-PEEV-----------AR--K-N---
Sequence 2 YVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF

Sequence 1 SRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           -------------------------------------
Sequence 2 KFLVPPQESQKRAVA----------------------



Alignment 28
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 37.83 (188/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           -----------------------L------------------------C-
Sequence 2 ------------------MAKLVLSLCFLLFSGCCFAFSFREQPQQNECQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           --RL-A--P--R-ESE-G--E-W--NN--F-CAGVA--R-------L--P
Sequence 2 IQRLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDRHQKV
           -Y-NAPQ--Y---G-GI-G---PGC--TFE---Q--Q--R----DRHQK-
Sequence 2 SYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQQKGQSSRPQ--DRHQKI

Sequence 1 RQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFF
           --FR-GD--A-P-G---W-YNN---P---V-L-DT----NQLDQ--R-F-
Sequence 2 YHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFY

Sequence 1 LAGN---------P---QGGRQSYFGRPQTEKQQGETKNIFNGFDDEILA
           LAGN---------P---QGG-QS--G--Q-E----E---I--GF--E-L-
Sequence 2 LAGNQEQEFLQYQPQKQQGGTQSQKGKRQQE-EENEGGSILSGFAPEFLE

Sequence 1 DAFGVDVQTARRLKGQDDL--RGRIVRAER-LDIVLPGEEEEERW-----
           -AF-VD-Q--R-L-G-------G-IV-----L----P--EE---------
Sequence 2 HAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEE

Sequence 1 -----ERDPYSGA---NGLEETLCTAKLRENLDEPARADVYNPHGGRISS
           -----E-D--------NG--ET-CT--LR-N-------D--NP--G-I--
Sequence 2 KPDCDEKDKHCQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITT

Sequence 1 LNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQV
           --SL--P-LSWL-LSA--G-L--N----PH-NLNA-SIIY---G----QV
Sequence 2 ATSLDFPALSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQV

Sequence 1 VGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMT
           V---G--VFDG---EGQ--IVPQN--VA-R-SQ----E--SFKTND----
Sequence 2 VNCNGERVFDGELQEGQVLIVPQNFAVAAR-SQSDNFEYVSFKTNDRPSI

Sequence 1 SQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSW
           --LAG--S---A-PEEV--------R--AR--K-N---S-----------
Sequence 2 GNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSFLVPPKESQRR

Sequence 1 PRSSRPMSYMPKPFEYVLDVIKSMM
           -------------------------
Sequence 2 VVA----------------------



Alignment 29
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 38.63 (192/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ------------------------------------------------C-
Sequence 2 ----------------------------------------RQQPEENACQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           --RL-AQ-P--R-ESE-G--E-W--NNQ-FECAGVA--R-V-----L--P
Sequence 2 FQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFE------RDTQ----PR----
           -Y-NAPQ------GRG--G---PGC----E------R--Q----PR----
Sequence 2 FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQG

Sequence 1 QDRRRRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTG
           -D------D-HQKV--F--GD--A-P-G---W-YN--------V-L-DT-
Sequence 2 EDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTN

Sequence 1 NAANQLDQTFRHFFLAGN--------PQGGRQSY-----FG--RPQTEKQ
           N--NQLDQ--R-F-LAGN---------Q--RQS-----------PQ----
Sequence 2 NNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPR

Sequence 1 QGETK----------------------NIFNGFDDEILADAFGVD-VQTA
           Q-E------------------------NIF-GF--E-L--AF-VD--Q--
Sequence 2 QEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIV

Sequence 1 RRLKG--QDDLRGRIVRAER-LDIVLPGE----EEEERWERDPYS-----
           --L-G-------G-IV-----L-I--P-------EEE----D-Y------
Sequence 2 QNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEED

Sequence 1 -----GA----NGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLT
           -----G-----NG-EET-CTA----N-------D-YNP--G-----N-L-
Sequence 2 RRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN

Sequence 1 LPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTG
           L--L-WL--SAE-G-LYRN-L---H-N-NAHSIIY--RG----QVV---G
Sequence 2 LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNG

Sequence 1 RSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAG
           --V-D----EG----VPQN--VA---SQ-E--E---FKT--------LAG
Sequence 2 NRVYDEELQEGHVLVVPQNFAVAGK-SQSENFEYVAFKTDSRPSIANLAG

Sequence 1 RLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSR
           --S-I---PEEVV---Y---R--AR-LK-N------F---S--S-PR---
Sequence 2 ENSVIDNLPEEVVANSYGLQREQARQLK-NNNPFKFFVPPSQQS-PRAVA

Sequence 1 PMSYMPKPFEYVLDVIKSMM
           --------------------
Sequence 2 --------------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 38.63 (192/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ------------------------------------------------C-
Sequence 2 -------------------------------------ISFRQQPEENACQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           --RL-AQ-P--R-ESE-G--E-W--NNQ-FECAGVA--R-V-----L--P
Sequence 2 FQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFE------RDTQ----PR----
           -Y-NAPQ------GRG--G---PGC----E------R--Q----PR----
Sequence 2 FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQG

Sequence 1 QDRRRRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTG
           -D------D-HQKV--F--GD--A-P-G---W-YN--------V-L-DT-
Sequence 2 EDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTN

Sequence 1 NAANQLDQTFRHFFLAGN--------PQGGRQSY-----FG--RPQTEKQ
           N--NQLDQ--R-F-LAGN---------Q--RQS-----------PQ----
Sequence 2 NNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPR

Sequence 1 QGETK----------------------NIFNGFDDEILADAFGVD-VQTA
           Q-E------------------------NIF-GF--E-L--AF-VD--Q--
Sequence 2 QEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIV

Sequence 1 RRLKG--QDDLRGRIVRAER-LDIVLPGE----EEEERWERDPYS-----
           --L-G-------G-IV-----L-I--P-------EEE----D-Y------
Sequence 2 QNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEED

Sequence 1 -----GA----NGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLT
           -----G-----NG-EET-CTA----N-------D-YNP--G-----N-L-
Sequence 2 RRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN

Sequence 1 LPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTG
           L--L-WL--SAE-G-LYRN-L---H-N-NAHSIIY--RG----QVV---G
Sequence 2 LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNG

Sequence 1 RSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAG
           --V-D----EG----VPQN--VA---SQ-E--E---FKT--------LAG
Sequence 2 NRVYDEELQEGHVLVVPQNFAVAGK-SQSENFEYVAFKTDSRPSIANLAG

Sequence 1 RLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSR
           --S-I---PEEVV---Y---R--AR-LK-N------F---S--S-PR---
Sequence 2 ENSVIDNLPEEVVANSYGLQREQARQLK-NNNPFKFFVPPSQQS-PRAVA

Sequence 1 PMSYMPKPFEYVLDVIKSMM
           --------------------
Sequence 2 --------------------



Alignment 31
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 37.83 (188/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           -----------------------L-----F------S-----------C-
Sequence 2 -----------------MAKLLELSFCFCFLVLGASSISFRQQPEENACQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           --RL-AQ-P--R-ESE-G--E-W--NNQ-FECAGVA--R-V-----L--P
Sequence 2 FQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQ----------PR----
           -Y-NAPQ------GRG--G---PGC--T-E---Q----------PR----
Sequence 2 FYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQE

Sequence 1 QDRRRRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTG
           -D------D-HQKV--F--GD--A-P-G---W-YN--------V-L-DT-
Sequence 2 EDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTN

Sequence 1 NAANQLDQTFRHFFLAGN--------PQGGRQSY-----------FGRPQ
           N--NQLDQ--R-F-LAGN---------Q--RQS--------------RP-
Sequence 2 NNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPR

Sequence 1 TEK------------------QQGETKNIFNGFDDEILADAFGVD-VQTA
           -E----------------------E--NIF-GF--E-L--AF-VD--Q--
Sequence 2 REEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIV

Sequence 1 RRLKGQDDL--RGRIVRAER-LDIVLP----GEEEEERWERDPY------
           --L-G-------G-IV-----L-I--P----G--EEE----D-Y------
Sequence 2 QNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQD

Sequence 1 --------SGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLT
           ---------G-NG-EET-CTA----N---------Y-P----------L-
Sequence 2 GRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLN

Sequence 1 LPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTG
           L--L-WL-LSAE-G-LYRN-L--PH-N-NAHSIIY--RG----QVV---G
Sequence 2 LLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNG

Sequence 1 RSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAG
           --V-D----EG----VPQN--VA---SQ-E--E---FKT---------AG
Sequence 2 NRVYDEELQEGHVLVVPQNFAVAGK-SQSENFEYVAFKTDSRPSIANFAG

Sequence 1 RLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSR
           --S-I---PEEVV---Y---R--AR-LK-N--------------------
Sequence 2 ENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA--

Sequence 1 PMSYMPKPFEYVLDVIKSMM
           --------------------
Sequence 2 --------------------



Alignment 32
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 35.81 (178/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ------------------------------------------------C-
Sequence 2 ---------------------MAKLVLSLCFLLFSGCFALREQAQQNECQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A--P--R-ESE-G--E-W--NN--F-CAGVA--R-------L--P
Sequence 2 IQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQ-DRRRRFMDRHQK
           -Y-N-PQ--Y---G-GI-G---PGC--T--------Q--R--R--DRHQK
Sequence 2 SYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRPQDRHQK

Sequence 1 VRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHF
           V--FR-GD--A-P-G---W-YNN---P---V---DT----NQLDQ--R-F
Sequence 2 VHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRF

Sequence 1 FLAGNP-----------QGGRQSYFGRPQTEKQQGETKNIFNGFDDEILA
           -LAGN------------QGG-QS--G--Q-E---G---NI--GF--E-L-
Sequence 2 YLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEG--SNILSGFAPEFLK

Sequence 1 DAFGVDVQTARRLKGQDDLR--GRIVRAER-LDIVLPG------EEEEER
           -AFGV--Q--R-L-G-------G-IV-----L----P-------EE----
Sequence 2 EAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDD

Sequence 1 WERDPYS-------------GANGLEETLCTAKLRENLDEPARADVYNPH
           -E--P-----------------NG--ET-CT--LR-N-------D-YNP-
Sequence 2 EEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQ

Sequence 1 GGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRG
           -G-I----SL--P-L--L-LSA--G-L--N----PH--LNA-SIIY---G
Sequence 2 AGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNG

Sequence 1 SGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKT
           ----QVV---G--VFDG---EG---IVPQN--VA---SQ----E--SFKT
Sequence 2 RALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAK-SQSDNFEYVSFKT

Sequence 1 NDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSS
           ND------LAG--S---A-PEEV-----------AR--K-N---S-----
Sequence 2 NDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPP

Sequence 1 TSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           -------------------------------
Sequence 2 QESQRRAVA----------------------



Alignment 33
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 35.81 (178/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           ------------------------------------------------C-
Sequence 2 ---------------------MAKLVLSLCFLLFSGCFALREQAQQNECQ

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---L-A--P--R-ESE-G--E-W--NN--F-CAGVA--R-------L--P
Sequence 2 IQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQ-DRRRRFMDRHQK
           -Y-N-PQ--Y---G-GI-G---PGC--T--------Q--R--R--DRHQK
Sequence 2 SYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRPQDRHQK

Sequence 1 VRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHF
           V--FR-GD--A-P-G---W-YNN---P---V---DT----NQLDQ--R-F
Sequence 2 VHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRF

Sequence 1 FLAGNP-----------QGGRQSYFGRPQTEKQQGETKNIFNGFDDEILA
           -LAGN------------QGG-QS--G--Q-E---G---NI--GF--E-L-
Sequence 2 YLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEG--SNILSGFAPEFLK

Sequence 1 DAFGVDVQTARRLKGQDDLR--GRIVRAER-LDIVLPG------EEEEER
           -AFGV--Q--R-L-G-------G-IV-----L----P-------EE----
Sequence 2 EAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDD

Sequence 1 WERDPYS-------------GANGLEETLCTAKLRENLDEPARADVYNPH
           -E--P-----------------NG--ET-CT--LR-N-------D-YNP-
Sequence 2 EEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQ

Sequence 1 GGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRG
           -G-I----SL--P-L--L-LSA--G-L--N----PH--LNA-SIIY---G
Sequence 2 AGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNG

Sequence 1 SGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKT
           ----QVV---G--VFDG---EG---IVPQN--VA---SQ----E--SFKT
Sequence 2 RALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAK-SQSDNFEYVSFKT

Sequence 1 NDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSS
           ND------LAG--S---A-PEEV-----------AR--K-N---S-----
Sequence 2 NDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPP

Sequence 1 TSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM
           -------------------------------
Sequence 2 QESQRRAVA----------------------



Alignment 34
Sequence 1:
Sequence 2: Allergen Gly m Bd28K, Sequence: BAB21619
Sequence identity: 18.71 (93/497)
Sequence 1 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR
           -----------------------L--------------------------
Sequence 2 -----------------KTTLLLLLFVLCHGVATTTMAFHDDEGGDKKSP

Sequence 1 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP
           ---------T--F---AG-------------------------P--L--P
Sequence 2 KSLFLMSNSTRVFKTDAGEMRVLKSHGGRIFYRHMHIGFISMEPKSLFVP

Sequence 1 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDRHQKV
           -Y----------RG----G-------------------------D-----
Sequence 2 QYLDSNLIIFIRRGEAKLGFI----------------------YDDELAE

Sequence 1 RQFRQGDILALPAGLTLWFYNNG-GEPLITVALLDTGNAANQLDQTFRHF
           R----GD----P-G------N-G-G--L------D----------TF--F
Sequence 2 RRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSIDPSTSLGL--ETFQSF

Sequence 1 FLAGNPQG-GRQSYFGRPQTEKQQGETKNIFNG-FDDEILADAFGVDVQT
           ---G--------S-F-----E----E--------F--E-------VD---
Sequence 2 YIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFVDDSH

Sequence 1 ARRLKGQDDLRGRIVRAERLDIVLPGEEEEERWERDPYSGANGLEETLCT
           A--L---------------L-------EE-E-------S----LE-----
Sequence 2 APSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGK

Sequence 1 AKLR-ENLD---EPA--------RADVYNPHGGRISSLNSLTLPVLSWLR
           -----EN-D----PA---------AD--N--G-----L-----P-LS---
Sequence 2 VNEKIENKDTAGSPASYNLYDDKKADFKNAYGWS-KALHGGEYPPLSEPD

Sequence 1 LSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVV
           -------L------APH-N-----------G-G--------G--------
Sequence 2 IGVLLVKLSAGSMLAPHVNPISDEYTIVLSGYGELHIGYPNGSRAMKTKI

Sequence 1 REGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQ-LAGRLSAIRA
           --G----VP--------AS-D--LE---F-T-------Q-LAG--S--R-
Sequence 2 KQGDVFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAASLLRT

Sequence 1 MPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSW---PRSSRPMSY
           --------A--VS-D--RR------E-----S-----W---P--------
Sequence 2 LMGPELSAAFGVSEDTLRRAVDAQHEAVILPS----AWAAPPENAGKLKM

Sequence 1 MPKPFEYVLDVIKSMM---
           ---P-----------M---
Sequence 2 EEEPNAIRSFANDVVMDVF



Alignment 35
Sequence 1:
Sequence 2: Allergen Coc n 1.0101, Sequence: A0A0S3B0K0
Sequence identity: 17.91 (89/497)
Sequence 1 --MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTD
           ---A--------I---LL----S------------------------R--
Sequence 2 MVSAMGDRTASAILALLLLSSWSLMVVMAYQGRGMEGREKRVEEKAPRSP

Sequence 1 CRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLL
           ------------------AG-------------------------P--L-
Sequence 2 EDRGLFILRRSKEVLKTDAGEVRLMMGYRYRGNHSPMHIGFITMEPNTLY

Sequence 1 LPHYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDRHQ
           -P-Y--A---L-V-RG----G-----------------------------
Sequence 2 IPQYIDASLILFVRRGEAKVGYIY-----------------KNKLVEK--

Sequence 1 KVRQFRQGDILALPAGLTLWFYNNG-GEPLITVALLDTGNAANQLDQTFR
           -------G---A-PAG------N----E-L------DT------------
Sequence 2 ---RLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYPQ

Sequence 1 HFFLAGN--PQG---GRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFG
           -F---G---P-----G-------------------I-N-----------G
Sequence 2 SFYVGGGVLPRSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNG

Sequence 1 VDVQTARRLKGQDDLRGRIVRAERLDIVLPGEEEEERWERDPYSGANGLE
           --------L-----L--R-V-----D-------E-E--E-D-------L-
Sequence 2 EAAEQRDYLSSIMQLKERMVQEKEMDS--DDDDEAEQEEDDVWTWRCLLK

Sequence 1 ETL----CTAKLRENL-DEPARADVY-------NPHGGRISSLNSLTLPV
           --L----C-------L---P-----Y-------N--G--I----------
Sequence 2 SLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYSIA-IDGHDYSA

Sequence 1 LSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSV
           L----L------L-------PH-N--A-----I-RGSG--QVV---G---
Sequence 2 LKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVFPNGTAA

Sequence 1 FDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQ-LAGRL
           ----V-EG-----P--------AS----LE---F-T-------Q-L-G--
Sequence 2 MNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGKS

Sequence 1 SAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPM
           S----M-------A--VS-----R------E-------------------
Sequence 2 SLLHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKK

Sequence 1 SYMPKPFEYVLDVIKSMM
           ------------------
Sequence 2 WKGEEVLVMKRGLFA---



Alignment 36
Sequence 1:
Sequence 2: Allergen Ses i 3, Sequence: AAK15089
Sequence identity: 22.13 (110/497)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH

Sequence 1 ----------------------------------------------MALT
           --------------------------------------------------
Sequence 2 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF

Sequence 1 SLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCRVERL
           S------------R-------G----Y------------Q-R---R----
Sequence 2 SREHCERRREEKYREQQGREGGRGEMY-EGREREEEQEEQGRG--RIPYV

Sequence 1 TAQEPTIR-FESEAG----LTEFWDRNNQQFECAGVAAVRNVI---QPRG
           ------I--F----G----L--F-DR--------G----R--I----P--
Sequence 2 FEDQHFITGFRTQHGRMRVLQKFTDRSELL---RGIENYRVAILEAEPQT

Sequence 1 LLLPHYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRRRFMDR
           ---P----A-----V--GRG----V--------------RQDRR------
Sequence 2 FIVPNHWDAESVVFVAKGRGTISLV--------------RQDRRESL---

Sequence 1 HQKVRQFRQGDILALPAGLTLWFYN-NGGEPLITVALLDTGNAANQLDQT
           --------QGDIL---AG-T----N----E-L----LL------------
Sequence 2 -----NIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVSTPGE----

Sequence 1 FRHFFLAGNPQGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVDV
           F--FF-AG------------P------------F--F-DEIL--AF----
Sequence 2 FELFFGAGGEN---------PES---------FFKSFSDEILEAAFNTRR

Sequence 1 QTARRLKGQDDLRGRIVRAERLDI-VLPGEEEEERWERDPYSGANGLEET
           ----R--GQ----G-IV-A-----------EE---W---P--G-----E-
Sequence 2 DRLQRIFGQQR-QGVIVKASEEQVRAMSRHEEGGIW---PFGG-----ES

Sequence 1 LCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLY
           --T---------P-----Y----G------------L--L-L--------
Sequence 2 KGTINIYQQ--RPTHSNQY----GQLHEVDASQYRQLRDLDLTVSLANIT

Sequence 1 RNGLVAPHWNLNAHSIIYITRGSGRFQVV-GHTGRS--VFDGVVR-----
           -----APH-N--A--I-----G-G-F-----H--RS-----G--R-----
Sequence 2 QGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSY

Sequence 1 --------EGQLIIVPQNYVVAKRASQDEGLEWISFKTN-DNAMTSQLAG
           ---------G---I-P--------AS----L----F--N--N-----LAG
Sequence 2 QRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAG

Sequence 1 RLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSR
           R---------E----A------E---------E---F---------R---
Sequence 2 RRNVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQGRADA

Sequence 1 PMSYMPKPFEYVLDVIKSMM
           --------------------
Sequence 2 --------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.