The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Tri a 14.0101

Sequence 19846220

Full FASTA alignment

Sequence name:
Query sequence:
IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC
LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Tri a 14.010119846220Go!90127.07.6e-32
2Hor v 1AAA32970Go!117101.07.0e-24
3Hor v 1CAA42832Go!134100.41.2e-23
4Zea m 14.0101P19656-1Go!12079.42.3e-17
5Zea m 14.0102P19656-2Go!12878.54.3e-17
6Len c 3.0101A0AT29Go!11874.85.4e-16
7Ara h 9.0201ABX75045Go!9269.02.3e-14
8Pru d 3P82534Go!9168.53.3e-14
9Pru ar 3P81651Go!9168.53.3e-14
10Pru p 3P81402Go!9168.14.3e-14
11Tri tu 14.0101CAH69206Go!11568.34.5e-14
12Pru av 3Q9M5X8Go!11768.44.5e-14
13Pun g 1.0201A0A059SSZ0Go!12068.44.6e-14
14Pru p 3CAB96876Go!9167.94.9e-14
15Pha v 3.0101ADC80502Go!11568.25.1e-14
16Fra a 3.0101Q8VX12Go!11767.86.6e-14
17Hev b 12AAL25839Go!11667.48.6e-14
18Mal d 3Q9M5X7Go!11567.11.1e-13
19Art gm 3.0102ANC85023Go!11766.51.6e-13
20Fra a 3.0102Q4PLT9Go!11766.22.1e-13
21Art v 3.0202ACE07187Go!11666.02.4e-13
22Art si 3.0102ANC85027Go!11666.02.4e-13
23Art ar 3.0102ANC85020Go!11666.02.4e-13
24Rub i 3.0101Q0Z8V0Go!11765.63.0e-13
25Art ca 3.0102QIN55516Go!11765.63.0e-13
26Pla or 3.0101ABY21307Go!11865.63.1e-13
27Ara h 17.0101A0A510A9S3Go!9365.23.3e-13
28Pyr c 3Q9M5X6Go!11564.95.0e-13
29Art gm 3.0101ANC85022Go!11764.95.1e-13
30Pla a 3.0101CAL07989Go!11864.95.1e-13
31Ara h 9.0101ABX56711Go!11664.75.7e-13
32Fra a 3.0202Q4PLT6Go!11764.75.8e-13
33Art an 3.0101ANC85017Go!11764.56.5e-13
34Art ca 3.0101ANC85021Go!11764.56.5e-13
35Can s 3.0101W0U0V5Go!9164.17.0e-13
36Art v 3.0201EU564845Go!11464.37.4e-13
37Art la 3.0101ANC85024Go!11664.37.4e-13
38Art ar 3.0101ANC85019Go!11664.37.4e-13
39Api g 2ACV04796Go!11864.37.4e-13
40Mor n 3.0101P85894Go!9163.97.9e-13
41Lup an 3.0101XP_019446786Go!11664.18.4e-13
42Art an 3.0102ANC85018Go!11764.28.4e-13
43Art la 3.0102ANC85025Go!11563.41.4e-12
44Art v 3.0301EU564847Go!11763.41.4e-12
45Sola l 3.0101P93224Go!11463.01.8e-12
46Lyc e 3AAB42069Go!11463.01.8e-12
47Fra a 3.0201Q4PLU0Go!11763.11.8e-12
48Cor a 8AAK28533Go!11561.93.8e-12
49Pis s 3.0101A0A161AT60Go!12061.65.0e-12
50Pun g 1.0101A0A059STC4Go!12061.65.0e-12
51Sin a 3.0101ABU95411Go!9261.15.3e-12
52Sola l 7.0101NP_001316123Go!11561.45.6e-12
53Art si 3.0101ANC85026Go!11661.45.6e-12
54Pha v 3.0201ADC80503Go!11861.45.7e-12
55Pru du 3.0101ACN11576Go!12360.98.4e-12
56Pun g 1.0301A0A059ST23Go!12058.93.4e-11
57Hel a 3.0101P82007Go!11653.01.9e-09
58Par j 2O04403Go!13349.62.2e-08
59Par j 2P55958Go!13347.69.0e-08
60Amb a 6O04004Go!11846.22.1e-07
61Par j 1Q40905Go!13844.48.9e-07
62Par j 1P43217Go!13944.21.0e-06
63Par j 1O04404Go!17644.11.4e-06
64Par j 1.0103CAI94601Go!13943.51.7e-06
65Par j 1.0101CAA54587Go!13342.04.6e-06

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 100.00 (90/90)
Sequence 1 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC
           IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC
Sequence 2 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC

Sequence 1 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV
           LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV
Sequence 2 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV



Alignment 2
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 72.22 (65/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           ----------------------------CG-VDS---PCL-YVQGGPGPS
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           G-CC-GV--LHNQA-S--DRQ--CNCLKGIARGIHNLN--NA-SIP-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PYTIS--IDCSR--
Sequence 2 VNVPYTISPDIDCSRIY



Alignment 3
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 72.22 (65/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           ----------------------------CG-VDS---PCL-YVQGGPGPS
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           G-CC-GV--LHNQA-S--DRQ--CNCLKGIARGIHNLN--NA-SIP-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNLPYTISLNIDCSRV------------------
           VN-PYTIS--IDCSR-------------------
Sequence 2 VNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 4
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 58.89 (53/90)
Sequence 1 ----------------------------IDCGHVDSLVRPCLSYVQG-GP
           ----------------------------I-CG-V-S---PC-SY--G-G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 GPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPP
           GPS--CC-GV--L-N-AR---DR--ACNCLK--A-G---LN--NA-SIP-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNLPYTISLNIDCSRV-
           KCGV--PYTIS---DCSRV-
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 5
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 57.78 (52/90)
Sequence 1 ----------------------------IDCGHVDSLVRPCLSYVQG-GP
           ----------------------------I-CG-V-S---PC-SY--G-G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 GPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPP
           GPS--CC-GV--L-N-AR---DR--ACNCLK--A-G---LN--NA-SIP-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNLPYTISLNIDCSRV---------
           KCGV--PYTIS---DCSR----------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 6
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 55.56 (50/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           --------------------------I-CG-V-S---PCL-Y--GGPGPS
Sequence 2 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           -QCC-GVK-L---A----DRQ-ACNCLK--A--I--LN--NA---P-KCG
Sequence 2 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG

Sequence 1 VNLPYTISLNIDCSRV--
           VN-PY-IS----C--V--
Sequence 2 VNIPYKISTTTNCNTVKF



Alignment 7
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 44.44 (40/90)
Sequence 1 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC
           --CG-V-S---PC------G--PSG-CC-GV--L---A----DRQ-ACNC
Sequence 2 LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNC

Sequence 1 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV--
           LK--A---H-LN--NA---P--CGV--PY-IS----C-----
Sequence 2 LKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF



Alignment 8
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 46.67 (42/90)
Sequence 1 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC
           I-CG-V-S---PC--YV-GG------CC-G--N--N-AR---DR--ACNC
Sequence 2 ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNC

Sequence 1 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-
           LK-----I---N--NA---P-KCGVN-PY-IS----C--V-
Sequence 2 LKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 46.67 (42/90)
Sequence 1 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC
           I-CG-V-S---PC--YV-GG------CC-G--N--N-AR---DR--ACNC
Sequence 2 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC

Sequence 1 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-
           LK-----I---N--NA---P-KCGVN-PY-IS----C--V-
Sequence 2 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 45.56 (41/90)
Sequence 1 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC
           I-CG-V-S---PC--YV-GG------CC-G--N--N-AR---DRQ-ACNC
Sequence 2 ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNC

Sequence 1 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-
           LK---------N--NA---P-KCGV--PY-IS----C--V-
Sequence 2 LKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 48.89 (44/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQG-GPGP
           ----------------------------CG-V-S---PC-SY--G-G--P
Sequence 2 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           S--CC-GV--L---ARS--D-Q-AC-C-K--A-G---LN---A--IP-KC
Sequence 2 SAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPTKC

Sequence 1 GVNLPYTISLNIDCSRV-
           GV--PY-IS---DCS---
Sequence 2 GVSVPYAISSSVDCSKIR



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 44.44 (40/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           ----------------------------CG-V-S---PC--YV-GG----
Sequence 2 MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVP

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-G--N--N-A----DRQ-ACNCLK---------N--NA---P-KCG
Sequence 2 PACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCG

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PY-IS----C--V-
Sequence 2 VNVPYKISPSTNCATVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 50.00 (45/90)
Sequence 1 ----------------------------IDCGHVDSLVRPCLSYVQGG-P
           ------------------------------CG-V-S---PC--Y--G---
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 GPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPP
           -PS--CC-GV--L-N-A----DRQ-ACNCLK-IAR-I---N-------P-
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGVNLPYTISLNIDCSRV-
           KCGV--PY-IS---DCSRV-
Sequence 2 KCGVSIPYKISPSTDCSRVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 45.56 (41/90)
Sequence 1 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC
           I-CG-V-S---PC--YV-GG------CC-G--N--N-AR---DRQ-ACNC
Sequence 2 ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNC

Sequence 1 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-
           LK---------N--NA---P-KCGV--PY-IS----C--V-
Sequence 2 LKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 47.78 (43/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQ-GGPGPSG
           --------------------------CG-V-S---PC----Q-GG--P-G
Sequence 2 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG

Sequence 1 QCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGV
           -CC-GV-N--N-ARS--DR---CNCLK--A-----LN--NA---P-KCGV
Sequence 2 -CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV

Sequence 1 NLPYTISLNIDCSRV-
           N-PY-IS----C----
Sequence 2 NIPYKISTSTNCASIN



Alignment 16
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 47.78 (43/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           --------------------------I-CG-V-S---PCL-YV--G----
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-G--NL---A----DRQ-ACNCLK--A-GI--LN---A---P-KCG
Sequence 2 AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VNLPYTISLNIDCSRV-
           V--PY-IS----C--V-
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 46.67 (42/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQG-GPGPSG
           ------------------------I-CG-V-S---PCLSY----GP-P--
Sequence 2 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA

Sequence 1 QCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGV
           -CC-GV----N-A----DR--AC-CLK--A-----LN-------P-KCGV
Sequence 2 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV

Sequence 1 NLPYTISLNIDCSRV-
           N-PY-ISL---C--V-
Sequence 2 NIPYKISLSTNCATVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 45.56 (41/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQGGPGPSGQ
           ------------------------I-CG-V-S---PC--YV--G------
Sequence 2 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA

Sequence 1 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN
           CC-G-------AR---DRQ-ACNCLK--A--I---N--NA---P-KCGVN
Sequence 2 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN

Sequence 1 LPYTISLNIDCSRV-
           -PY-IS----C--V-
Sequence 2 VPYKISTSTNCATVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 48.89 (44/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYV-QGGPGP
           ----------------------------C--V-----PCLS---QGG--P
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVP

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           ---CC-GVK-L---A----DRQ-ACNCLK--------L--DNA---P-KC
Sequence 2 A-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKC

Sequence 1 GVNLPYTISLNIDCSRV-
           GVN-PY-ISL--DC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 45.56 (41/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           --------------------------I-CG-V-S---PC--YV--G----
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-G--NL---A----DRQ--CNCLK--A-GI--LN---A---P-KCG
Sequence 2 APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VNLPYTISLNIDCSRV-
           V--PY-IS----C--V-
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 48.89 (44/90)
Sequence 1 -------------------------IDCGHVDSLVRPCLSYV-QGGPGPS
           ---------------------------C--V-----PCL-Y--QGG--P-
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-GVK-L---A----DRQ-ACNCLK--------L--D-A-S-P-KCG
Sequence 2 -DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PY-ISL--DC--V-
Sequence 2 VNIPYKISLETDCNKVK



Alignment 22
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 48.89 (44/90)
Sequence 1 -------------------------IDCGHVDSLVRPCLSYV-QGGPGPS
           ---------------------------C--V-----PCL-Y--QGG--P-
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-GVK-L---A----DRQ-ACNCLK--------L--D-A-S-P-KCG
Sequence 2 -DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PY-ISL--DC--V-
Sequence 2 VNIPYKISLETDCNKVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 48.89 (44/90)
Sequence 1 -------------------------IDCGHVDSLVRPCLSYV-QGGPGPS
           ---------------------------C--V-----PCL-Y--QGG--P-
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-GVK-L---A----DRQ-ACNCLK--------L--D-A-S-P-KCG
Sequence 2 -DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PY-ISL--DC--V-
Sequence 2 VNIPYKISLETDCNKVK



Alignment 24
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 46.67 (42/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           --------------------------I-CG-V---V-PC--YV--G----
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-GV-NL--QA----DRQ--CNCLK--A--I--LN---A---P-KCG
Sequence 2 AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCG

Sequence 1 VNLPYTISLNIDCSRV-
           V--PY-IS----C--V-
Sequence 2 VSVPYKISTSTNCATVK



Alignment 25
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 48.89 (44/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYV-QGGPGP
           ----------------------------C--V-----PCLS---QGG--P
Sequence 2 MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVP

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           ---CC-GVK-L---A----DRQ-ACNCLK--------L--DNA---P-KC
Sequence 2 A-DCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKC

Sequence 1 GVNLPYTISLNIDCSRV-
           GVN-PY-ISL--DC--V-
Sequence 2 GVNIPYKISLETDCNTVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 48.89 (44/90)
Sequence 1 ---------------------------IDCGHVDSLVRPCLSYVQGGPGP
           ---------------------------I-CG-V-----PCL-Y---G---
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           ---CC-GVK-L-N-A----DRQ-AC-CLK-----I------NA-S---KC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNLPYTISLNIDCSRV-
           GVNLPY-IS--IDCS-V-
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 44.44 (40/90)
Sequence 1 -IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACN
           -I-C--V-----PC--Y---G---SG-CC-G--N----A---SDRQ--CN
Sequence 2 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN

Sequence 1 CLKGIARGI-HNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-
           CLK--A-------N--NA-S-P-KCGV--PY-IS--I-CS---
Sequence 2 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK



Alignment 28
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 43.33 (39/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQGGPGPSGQ
           ------------------------I-C--V-----PC--YV--G------
Sequence 2 MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVPPA

Sequence 1 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN
           CC-G-K-----A----DRQ-ACNCLK--A------N--NA-S-P-KCGVN
Sequence 2 CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVN

Sequence 1 LPYTISLNIDCSRV-
           -PY-IS----C--V-
Sequence 2 VPYKISTSTNCATVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 46.67 (42/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYV-QGGPGP
           ----------------------------C--V-----PC-S---QGG--P
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVP

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           ---CC-GVK-L---A----DRQ-ACNCLK-----------DNA---P-KC
Sequence 2 A-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKC

Sequence 1 GVNLPYTISLNIDCSRV-
           GVN-PY-ISL--DC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 47.78 (43/90)
Sequence 1 ---------------------------IDCGHVDSLVRPCLSYVQGGPGP
           ---------------------------I-CG-V-----PCL-----G---
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           ---CC-GVK-L-N-A----DRQ-AC-CLK-----I------NA-S---KC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNLPYTISLNIDCSRV-
           GVNLPY-IS--IDCS-V-
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 42.22 (38/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQGGPGPSGQ
           ------------------------I-CG-V-S---PC------G--P---
Sequence 2 MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPA

Sequence 1 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN
           CC-GV--L----R---DRQ-ACNCLK--A-----LN--NA---P--CGV-
Sequence 2 CCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVS

Sequence 1 LPYTISLNIDCSRV--
           -PY-IS----C-----
Sequence 2 IPYKISTSTNCATIKF



Alignment 32
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 43.33 (39/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           --------------------------I-CG-V-S---PC--YV--G----
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-G---L---A----DRQ--CNCLK-----I--LN---A---P-KCG
Sequence 2 AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCG

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PY-IS----C--V-
Sequence 2 VNVPYKISTSTNCAAVK



Alignment 33
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 44.44 (40/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           ----------------------------C--V-----PC-S----G---S
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-GVK-L---A----DRQ-ACNCLK-----------DNA---P-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PY-ISL--DC--V-
Sequence 2 VNIPYKISLETDCNKVK



Alignment 34
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 44.44 (40/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           ----------------------------C--V-----PC-S----G---S
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-GVK-L---A----DRQ-ACNCLK-----------DNA---P-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PY-ISL--DC--V-
Sequence 2 VNIPYKISLETDCNKVK



Alignment 35
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 48.89 (44/90)
Sequence 1 IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACN
           I-CG-V-S---PCLSY---GG--P-G-CC---K-L---A----DRQ-AC-
Sequence 2 ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACK

Sequence 1 CLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-
           CLK--A--I---N---A---P-KCGV--PY-IS---DCS-V-
Sequence 2 CLKSAASSIKGVNFNLASGLPGKCGVSIPYKISPSTDCSSVK



Alignment 36
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 47.78 (43/90)
Sequence 1 -----------------------IDCGHVDSLVRPCLSYV-QGGPGPSGQ
           -------------------------C--V------CLSY--QGG--P---
Sequence 2 MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA-D

Sequence 1 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN
           CC-GVK-L---A----DRQ-ACNCLK-----------D-A-S-P-KCGVN
Sequence 2 CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVN

Sequence 1 LPYTISLNIDCSRV-
           -PY-ISL--DC--V-
Sequence 2 IPYKISLETDCNKVK



Alignment 37
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 47.78 (43/90)
Sequence 1 -------------------------IDCGHVDSLVRPCLSYV-QGGPGPS
           ---------------------------C--V------CLSY--QGG--P-
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-GVK-L---A----DRQ-ACNCLK-----------D-A-S-P-KCG
Sequence 2 -DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCG

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PY-ISL--DC--V-
Sequence 2 VNIPYKISLETDCNKVK



Alignment 38
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 47.78 (43/90)
Sequence 1 -------------------------IDCGHVDSLVRPCLSYV-QGGPGPS
           ---------------------------C--V------CLSY--QGG--P-
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-GVK-L---A----DRQ-ACNCLK-----------D-A-S-P-KCG
Sequence 2 -DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCG

Sequence 1 VNLPYTISLNIDCSRV-
           VN-PY-ISL--DC--V-
Sequence 2 VNIPYKISLETDCNKVK



Alignment 39
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 44.44 (40/90)
Sequence 1 ---------------------------IDCGHVDSLVRPCLSYVQGGPGP
           -----------------------------CG-V------CL-Y--GG--P
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           S--CC-GVK-L---A----DR--AC-CLK--A------N---A---P-KC
Sequence 2 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC

Sequence 1 GVNLPYTISLNIDCSRV-
           G---PY-IS---DCSRV-
Sequence 2 GIRIPYPISPSTDCSRVN



Alignment 40
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 45.56 (41/90)
Sequence 1 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC
           I-CG-V-S---PC--Y---G------CC-GV--L-N-A----DRQ-ACNC
Sequence 2 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC

Sequence 1 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-
           LK-----I--LN---A---P-KCGV--PY-IS---DC--V-
Sequence 2 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK



Alignment 41
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 44.44 (40/90)
Sequence 1 -------------------------IDCGHVDSLVRPCLSYVQGGPGPSG
           -------------------------I-CG-V------CL-Y---G-----
Sequence 2 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA

Sequence 1 QCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGV
           -CC-G-KN--N-A----DR--ACNCLK--A-----LN--NA-S-P-KCGV
Sequence 2 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV

Sequence 1 NLPYTISLNIDCSRV-
           N-PY-IS----C----
Sequence 2 NIPYKISTSTNCASIK



Alignment 42
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 46.67 (42/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQ-GGPGP
           ----------------------------C--V-----PC-S----GG--P
Sequence 2 MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVP

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           ---CC-GVK-L---A----DRQ-ACNCLK-------N--E-NA---P-KC
Sequence 2 V-DCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKC

Sequence 1 GVNLPYTISLNIDCSRV-
           GVN-PY-ISL--DC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 45.56 (41/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQ-GGPGPSG
           --------------------------C--V-----PCLSY---GG--P--
Sequence 2 MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPA-

Sequence 1 QCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGV
           -CC-GVK-L--------DRQ-ACNCLK--------L--D-A---P-KCG-
Sequence 2 DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGL

Sequence 1 NLPYTISLNIDCSRV-
           NLPY--SL--DC--V-
Sequence 2 NLPYKLSLETDCNKVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 45.56 (41/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQ-GGPGP
           ----------------------------C--V-----PCLSY---GG--P
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           ---CC-GVK-L--------DRQ-ACNCLK--------L--D-A---P-KC
Sequence 2 A-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GVNLPYTISLNIDCSRV-
           G-NLPY--SL--DC--V-
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 45
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 46.67 (42/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQGGPGPSGQ
           --------------------------CG-V-S---PCL-Y--G--GP-G-
Sequence 2 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGR-GPLGG

Sequence 1 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN
           CC-GVK-L---A----DR--AC-CLK--A--I-------A---P--CGVN
Sequence 2 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN

Sequence 1 LPYTISLNIDCSRV-
           -PY-IS---DCS-V-
Sequence 2 IPYKISPSTDCSTVQ



Alignment 46
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 46.67 (42/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQGGPGPSGQ
           --------------------------CG-V-S---PCL-Y--G--GP-G-
Sequence 2 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGR-GPLGG

Sequence 1 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN
           CC-GVK-L---A----DR--AC-CLK--A--I-------A---P--CGVN
Sequence 2 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN

Sequence 1 LPYTISLNIDCSRV-
           -PY-IS---DCS-V-
Sequence 2 IPYKISPSTDCSTVQ



Alignment 47
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 42.22 (38/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           --------------------------I-CG-V-S---PC--YV--G----
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-G---L---A----DRQ--CNCLK-----I--LN---A---P-KCG
Sequence 2 AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCG

Sequence 1 VNLPYTISLNIDCSRV-
           V--PY-IS----C--V-
Sequence 2 VSVPYKISTSTNCAAVK



Alignment 48
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 43.33 (39/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQGGPGPSGQ
           --------------------------C--------PC--Y---G------
Sequence 2 MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS

Sequence 1 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN
           CC-GV-------R--SDRQSACNCLK--A-GI--LN---A---P-KCGVN
Sequence 2 CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVN

Sequence 1 LPYTISLNIDCSRV-
           -PY-IS----C--V-
Sequence 2 IPYKISPSTNCNNVK



Alignment 49
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 45.56 (41/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQ--GGPG
           ----------------------------CG-V-----PC--Y-Q------
Sequence 2 MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNAS

Sequence 1 PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPK
           P---CC-GVK-L---A----DRQ-ACNCLK--A--I--LN--NA---P-K
Sequence 2 PPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGK

Sequence 1 CGVNLPYTISLNIDCSRV--
           CGV--PY-IS----C--V--
Sequence 2 CGVSIPYKISTSTNCNTVRF



Alignment 50
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 45.56 (41/90)
Sequence 1 ----------------------------IDCGHVDSLVRPCLSYVQ--GG
           ------------------------------CG-V-S---PC--Y----GG
Sequence 2 MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGG

Sequence 1 PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIP
           --P---CC-G-K-L---AR---DRQ--C-CLK-----I---N-----S-P
Sequence 2 AVPPA-CCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLP

Sequence 1 PKCGVNLPYTISLNIDCSRV-
           -KCGVN-PY-IS---DC-RV-
Sequence 2 AKCGVNIPYKISPSTDCARVK



Alignment 51
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 46.67 (42/90)
Sequence 1 -IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSAC
           ---CG-V-S----C--Y--Q--P-P-G-CC-GV-NL-N-AR---DRQ-AC
Sequence 2 ALSCGTVNSNLAACIGYLTQNAPLPKG-CCTGVTNLNNMARTTPDRQQAC

Sequence 1 NCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-
           -CL-G-A-----LN---A---P--CGVN-PY-IS----C--V-
Sequence 2 RCLVGAANSFPSLNAARAAALPKACGVNIPYKISKSTNCNSVR



Alignment 52
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 40.00 (36/90)
Sequence 1 ------------------------IDCGHVDSLVRPCLSYVQGGPGPSGQ
           ------------------------I-CG-VD----PC------G--P---
Sequence 2 MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAA

Sequence 1 CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVN
           CC-GV--L-----S--DR--ACNC-K--A----NL--D-A-S-P-KCG--
Sequence 2 CCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGIS

Sequence 1 LPYTISLNIDCSRV-
           L---IS----C----
Sequence 2 LTVPISRTVNCDTIS



Alignment 53
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 43.33 (39/90)
Sequence 1 -------------------------IDCGHVDSLVRPCLSYV-QGGPGPS
           ---------------------------C--V-----PCL-Y--QGG--P-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPA

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-GVK-L---A----DRQ-AC-CLK--------L--D-A---P-KCG
Sequence 2 N-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCG

Sequence 1 VNLPYTISLNIDCSRV-
           V--PY--S---DC--V-
Sequence 2 VTIPYKLSMETDCNKVK



Alignment 54
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 43.33 (39/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYV-QGGPGP
           --------------------------I-CG-V-S----C------GGP-P
Sequence 2 MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           ---CC-GV--L---A----DRQ--CNCLK--A--I---N--NA---P-KC
Sequence 2 AS-CCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKC

Sequence 1 GVNLPYTISLNIDCSRV--
           GV--PY-IS----C-----
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 55
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 44.44 (40/90)
Sequence 1 ------------------------------IDCGHVDSLVRPCLSYVQGG
           --------------------------------CG-V-----PC--YV--G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGI--HNLNEDNARS
           ------CC-GV--L---A----DRQS-CNCLK----GI---N-N---A--
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 IPPKCGVNLPYTISLNIDCSRV-
           -P-KCGVN-PY-IS---DC----
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK



Alignment 56
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 42.22 (38/90)
Sequence 1 ---------------------------IDCGHVDSLVRPCLSYVQG-GPG
           ---------------------------I-CG-V-S----C--Y--G-G-G
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 PSGQ-CCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPP
           P--Q-CC-G---L---A----DRQ-AC-CLK--A--I---N-------P-
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG

Sequence 1 KCGVNLPYTISLNIDCSRV-
           KCGV--PY-I-----C--V-
Sequence 2 KCGVSIPYKIAPSTNCDNVK



Alignment 57
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 36.67 (33/90)
Sequence 1 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS
           --------------------------I-C--V-----PCL-Y---G--P-
Sequence 2 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT

Sequence 1 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG
           --CC-G-K-L----R-Q-DR--AC-C-K--A--------D-A-S-P-KCG
Sequence 2 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG

Sequence 1 VNLPYTISLNIDCSRV-
           ------I--N--C----
Sequence 2 ISTSIPINPNVNCNTIP



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 33.33 (30/90)
Sequence 1 --------------------------------IDCGHVDSLVRPCLSYVQ
           ----------------------------------CG-V-----PCL--V-
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 GGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNAR
           G----PS--CC-G-K-L------------AC-C------GI---------
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 SIPPKCGVN--LPYTISLNIDCSRV---------
           --P-KCG----LP--I----DCS-----------
Sequence 2 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 32.22 (29/90)
Sequence 1 --------------------------------IDCGHVDSLVRPCLSYVQ
           ----------------------------------CG-V-----PCL--V-
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 GGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNAR
           G----PS--CC-G-K-L------------AC-C------GI---------
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 SIPPKCGVN--LPYTISLNIDCSRV---------
           --P-KC-----LP--I----DCS-----------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 33.33 (30/90)
Sequence 1 ---------------------------IDCGHVDSLVRPCLSYVQGGPGP
           -----------------------------C--V-----PC-----G---P
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQE-P

Sequence 1 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC
           S--CC-GV-NL-N------DR---CNC-K-----I-------------KC
Sequence 2 SKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AYDPKRMPLLSTKC

Sequence 1 GV--NLPYTISLNIDCSRV--
           GV----P-----N-DCS----
Sequence 2 GVKPDFP-AVDKNLDCSKLPV



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 32.22 (29/90)
Sequence 1 -------------------------------------IDCGHVDSLVRPC
           ---------------------------------------CG-V-----PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 LSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLN
           L--VQG----PS--CC-G-K-L---------R--AC-C------------
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 EDNARSIPPKCGV---NLPYTISLNIDCSRV--------
           -------P--CG-----LP--I--N-DC-----------
Sequence 2 GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 32.22 (29/90)
Sequence 1 -IDCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSAC
           ---CG-------PCL--VQG----PS--CC-G-K-L---------R--AC
Sequence 2 QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHAC

Sequence 1 NCLKGIARGIHNLNEDNARSIPPKCGV---NLPYTISLNIDCSRV-----
           -C-------------------P--CG-----LP--I--N-DC--V-----
Sequence 2 ECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTVGVVPR

Sequence 1 ----------------------------------------
           ----------------------------------------
Sequence 2 QPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 32.22 (29/90)
Sequence 1 --------------------------------------IDCGHVDSLVRP
           ----------------------------------------CG-V-----P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL
           CL--VQG----PS--CC-G-K-L---------R--AC-C-----------
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NEDNARSIPPKCGV---NLPYTISLNIDCSRV------------------
           --------P--CG-----LP--I--N-DC---------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 31.11 (28/90)
Sequence 1 -IDCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSAC
           ---CG-------PCL--VQG----PS--CC-G-K-L---------R--AC
Sequence 2 QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHAC

Sequence 1 NCLKGIARGIHNLNEDNARSIPPKCGV---NLPYTISLNIDCSRV-----
           -C-------------------P--CG-----LP--I--N-DC--------
Sequence 2 ECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPR

Sequence 1 ----------------------------------------
           ----------------------------------------
Sequence 2 QPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 30.00 (27/90)
Sequence 1 IDCGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACN
           -----------PCL--VQG----PS--CC-G-K-L---------R--AC-
Sequence 2 -----MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACE

Sequence 1 CLKGIARGIHNLNEDNARSIPPKCGV---NLPYTISLNIDCSRV------
           C-------------------P--CG-----LP--I--N-DC--V------
Sequence 2 CIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTVGVVPRQ

Sequence 1 ---------------------------------------
           ---------------------------------------
Sequence 2 PQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.