The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Pru du 6

Sequence 258588247

Full FASTA alignment

Sequence name:
Query sequence:
ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG
QHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN
RNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLE
ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF
FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI
VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANA
YQISREQARQLKYNRQETIALSSSQQRRAVV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Pru du 63EHK_AGo!531405.34.5e-114
2Pru du 6.0101ADN39440Go!551401.47.1e-113
3Cor a 9AAL73404Go!515169.73.8e-43
4Jug n 4.0101A0A1L6K371Go!510165.47.2e-42
5Pru du 6.0201ADN39441Go!504164.61.2e-41
6Jug r 4.0101Q2TPW5Go!507164.11.8e-41
7Car i 4.0101ABW86978Go!505162.74.7e-41
8Fag e 1BAA21758Go!565137.71.7e-33
9Gly m 6.0301P11828Go!481126.24.3e-30
10Gly m 6.0201P04405Go!485123.72.4e-29
11Gly m glycinin G2CAA68460Go!485123.72.4e-29
12Pis v 5.0101EU410073Go!473117.12.2e-27
13Gly m glycinin G1AAA33966Go!495109.35.4e-25
14Gly m 6.0101P04776Go!495109.35.4e-25
15Ana o 2AAN76862Go!457106.82.9e-24
16Sin a 2.0101Q2TLW0Go!510105.11.0e-23
17Ara h 3O82580Go!507103.23.7e-23
18Ara h 3AAC63045Go!510103.23.8e-23
19Ara h 4AAD47382Go!530100.52.6e-22
20Fag e 1Q9XFM4Go!53898.79.3e-22
21Pis v 2.0101DQ631676Go!49696.34.3e-21
22Pis v 2.0201DQ631677Go!47294.11.9e-20
23Fag e 1BAA21760Go!50493.14.2e-20
24Cuc ma 4.0101P13744Go!48092.27.5e-20
25Ses i 7.0101Q9AUD2Go!49790.91.9e-19
26Zan b 2.0101QYU76045Go!38987.51.6e-18
27Ber e 2AAO38859Go!46587.71.6e-18
28Zan b 2.0102QYU76046Go!38886.72.7e-18
29Zan b 2.02QYU76044Go!38386.53.1e-18
30Zan b 2.03QYS16039Go!38985.37.2e-18
31Gly m 6.0401Q9SB11Go!56384.81.4e-17
32Gly m 6.0501Q7GC77Go!51782.66.1e-17
33Ses i 6.0101Q9XHP0Go!45980.42.6e-16
34Tri a gluteninCAA27052Go!83843.27.4e-05
35Tri a gluteninAAB02788Go!81543.07.9e-05
36Tri a 26.0101P10388Go!83940.93.6e-04
37Tri a gluteninCAA31395Go!83940.93.6e-04
38Tri a gluteninCAA43331Go!83040.54.5e-04
39Coc n 1.0101A0A0S3B0K0Go!49038.61.0e-03
40Tri a gluteninCAA31396Go!64838.81.2e-03
41Tri a gluteninCAA26847Go!66037.53.0e-03
42Tri a gluteninCAA43361Go!70536.75.3e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 100.00 (531/531)
Sequence 1 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
           ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
Sequence 2 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA

Sequence 1 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
           SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
Sequence 2 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ

Sequence 1 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
           QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
Sequence 2 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ

Sequence 1 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
           QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
Sequence 2 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL

Sequence 1 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG
           VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG
Sequence 2 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG

Sequence 1 QHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN
           QHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN
Sequence 2 QHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN

Sequence 1 RNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLE
           RNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLE
Sequence 2 RNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLE

Sequence 1 ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF
           ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF
Sequence 2 ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF

Sequence 1 FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI
           FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI
Sequence 2 FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI

Sequence 1 VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANA
           VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANA
Sequence 2 VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANA

Sequence 1 YQISREQARQLKYNRQETIALSSSQQRRAVV
           YQISREQARQLKYNRQETIALSSSQQRRAVV
Sequence 2 YQISREQARQLKYNRQETIALSSSQQRRAVV



Alignment 2
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 99.06 (526/531)
Sequence 1 --------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEA
           --------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEA
Sequence 2 MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEA

Sequence 1 GQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV
           GQIETWNFNQ-DFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV
Sequence 2 GQIETWNFNQEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV

Sequence 1 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ
           LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ
Sequence 2 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ

Sequence 1 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGD
           ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQ-DRHQKTRRIREGD
Sequence 2 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDRHQKTRRIREGD

Sequence 1 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN
           VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN
Sequence 2 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN

Sequence 1 EFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLL
           EFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQG-GNNVFSGFNTQLL
Sequence 2 EFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLL

Sequence 1 AQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREHEERQQ
           AQALNVNEETARNLQGQNDNRNQII-VRGNLDFVQPPRGRQEREHEERQQ
Sequence 2 AQALNVNEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQ

Sequence 1 EQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIST
           EQLQQERQQQG-QLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIST
Sequence 2 EQLQQERQQQGGQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIST

Sequence 1 LNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQV
           LNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQV
Sequence 2 LNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQV

Sequence 1 VNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFIN
           VNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFIN
Sequence 2 VNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFIN

Sequence 1 TLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAV
           TLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAV
Sequence 2 TLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAV

Sequence 1 V
           V
Sequence 2 V



Alignment 3
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 51.79 (275/531)
Sequence 1 --------------------------ARQSQLSPQNQCQLNQLQAREPDN
           ---------------------------R--Q------C-L--L-A-EP-N
Sequence 2 MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTN

Sequence 1 RIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYI
           RI-AEA-QIE-W--N---FQCAGVA--R-TI--NGL-LP-YSNAP-LIYI
Sequence 2 RIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYI

Sequence 1 VQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQG
           --GRG--G--F-GCPETFE--QQ-SQQG----------------------
Sequence 2 ERGRGITGVLFPGCPETFEDPQQQSQQG----------------------

Sequence 1 QQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTR
           -------RQG-----------------QGQ--R--Q-------DRHQK-R
Sequence 2 ------QRQG-----------------QGQSQRSEQ-------DRHQKIR

Sequence 1 RIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYL
           --REGD--A-PAGVA-W-YNDGD---V-V-L-H-----NQLD-NPR-FYL
Sequence 2 HFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYL

Sequence 1 AGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSG
           AGNP--E---QGQ----Q-G---R--QH----G----QEQQG-GNNVFSG
Sequence 2 AGNPDDEHQRQGQ---QQFGQRRRQQQHSH--GEQGEQEQQGEGNNVFSG

Sequence 1 FNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQERE
           F----LA-A-NV---TAR-LQ---D-R--I--V-G-L--V-P-R-RQE-E
Sequence 2 FDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWE

Sequence 1 HEERQQEQLQQERQQQ----GEQLMANGLEETFCSLRLKENIGNPERADI
           --ERQ-----QER--Q----G-----NG-EET-CSLRL-ENI----RADI
Sequence 2 RQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADI

Sequence 1 FSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVY
           -----GRI-T-NS--LP-LR-L-LSAERG---R-G-Y-PHWN-NAHSVVY
Sequence 2 YTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVY

Sequence 1 VIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFA
           -IRG-ARVQVV--NG----D-E--QGQ----PQN--V---A---GFE--A
Sequence 2 AIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVA

Sequence 1 FKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIA
           FKT--NA-I--LAGRTS--RALPD-VLANA-QISRE-AR-LKYNRQET--
Sequence 2 FKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYNRQETTL

Sequence 1 LSSSQQRRAVV-----------
           --SS------------------
Sequence 2 VRSSRSSSERKRRSESEGRAEA



Alignment 4
Sequence 1:
Sequence 2: Allergen Jug n 4.0101, Sequence: A0A1L6K371
Sequence identity: 51.22 (272/531)
Sequence 1 -----------------------ARQSQLSPQNQCQLNQLQAREPDNRIQ
           ---------------------------Q------C-L--L-A-EP-NRI-
Sequence 2 MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIE

Sequence 1 AEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQG
           AEAG-IE-W--N---FQCAGVA--R-TI--NGL-LP-YSNAPQL-YIV-G
Sequence 2 AEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKG

Sequence 1 RGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQE
           RG--G--F-GCPETFEESQQ--------------------------GQ--
Sequence 2 RGITGVLFPGCPETFEESQQ--------------------------GQSR

Sequence 1 QQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIR
           -----------------------------RP-------Q-DRHQK-R--R
Sequence 2 I----------------------------RPSLRSASFQRDRHQKIRHFR

Sequence 1 EGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGN
           EGDV-A-PAGVA-W-YNDGD---VAV-L-------NQLDQNPR-FYLAGN
Sequence 2 EGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNNANQLDQNPRNFYLAGN

Sequence 1 PENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNT
           P--EF--QGQ----Q---Q----QHQQ--G-P-QQ-Q-G-GNNVFSGF--
Sequence 2 PDDEFRPQGQQEYEQHRRQQ---QHQQRHGEPGQQ-QRGSGNNVFSGFDA

Sequence 1 QLLAQALNVNEETARNLQGQNDNRNQIIQVRG-NLDFVQPPRGRQEREHE
           --LA-A-NV--ETAR-LQ--ND-R--I--V-G--L----P---R-E-E-E
Sequence 2 DFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQERE

Sequence 1 ERQQEQLQQERQQQGEQLMA-----NGLEETFCSLRLKENIGNPERADIF
           ER-------E------Q--------NGLEET-C-LRL-ENIG-P-RADI-
Sequence 2 ERKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIY

Sequence 1 SPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYV
           ---AGRIST-NSH-LP-LR-L-LSAERG--Y----Y-PHWN-NAHSVVY-
Sequence 2 TEEAGRISTANSHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYA

Sequence 1 IRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAF
           -RG-A-VQVV---G----D-E---GQL---PQN--V---A-N-GFE---F
Sequence 2 LRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARNEGFEWVSF

Sequence 1 KTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIAL
           KT-ENA----LAGRTS--RALP-EVLANA-QI-RE-AR-LK-NRQE----
Sequence 2 KTNENAMVSPLAGRTSAIRALPEEVLANALQIPREDARRLKFNRQESTLV

Sequence 1 --------SSSQQRRAVV
           --------SS---RRA-V
Sequence 2 RSRPSSSRSSRSERRAEV



Alignment 5
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 60.26 (320/531)
Sequence 1 -----------ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFN
           ------------RQ---------QLNQL-AREPDN-IQ-EAG--E-WN--
Sequence 2 CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPS

Sequence 1 QGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCP
           ---FQ-AGVA--R-TI--NGLHLPSY-NAPQLIYIV-GRGVLGAVF-GC-
Sequence 2 DPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCA

Sequence 1 ETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGR
           ETFE-SQ------------Q--QQQQQ-----------QQQ-R--RQ-G-
Sequence 2 ETFEDSQP-----------QQFQQQQQ-----------QQQFRPSRQEGG

Sequence 1 QQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVA
           Q----G-QQ-Q---QQ------------DRHQK-R-IREGD--A-PAGVA
Sequence 2 Q----GQQQFQGEDQQ------------DRHQKIRHIREGDIIALPAGVA

Sequence 1 YWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQ
           YWSYN-G-Q-LVAV-L-----D-NQLDQ-PR-FYLAGNP--EFN------
Sequence 2 YWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFN------

Sequence 1 PRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEE
           P-QQG-Q----Q-QQ------QQ-QQGNGNN-FSGF-TQLLAQALNVN-E
Sequence 2 PQQQGRQ----QQQQ------QQGQQGNGNNIFSGFDTQLLAQALNVNPE

Sequence 1 TARNLQGQNDNRNQIIQVRGNLDFVQP------PRGRQEREHEE----RQ
           TARNLQGQ-DNRN-I--V-G-LDFV-P-------RG-QER--EE----R-
Sequence 2 TARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQRE

Sequence 1 QEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIS
           -E--Q-E--QQG-----NG-EETFCS-RL--NIG-P-RAD---P--GRIS
Sequence 2 REEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRIS

Sequence 1 TLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQ
           --N---LPILR-LRLSAE-G--Y-N-IY-PHW--NA---VY-IRGNARVQ
Sequence 2 VVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQ

Sequence 1 VVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFI
           VVNENGD-ILD-EV--GQLF--PQNH-VI-QA-N-GFEY--F-T-EN-F-
Sequence 2 VVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFT

Sequence 1 NTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRA
           NTLAGRTS-LRALPDEVL-NA--ISR--AR-LKYNRQE---LS-----R-
Sequence 2 NTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQESRLLSATSPPRG

Sequence 1 VV------
           --------
Sequence 2 RLMSILGY



Alignment 6
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 50.66 (269/531)
Sequence 1 --------------------------ARQSQLSPQNQCQLNQLQAREPDN
           ---------------------------RQ-Q-----QCQLN-L-A-EP-N
Sequence 2 MAKPILLSIYLFLIVALFNGCLAQSGGRQQQQF--GQCQLNRLDALEPTN

Sequence 1 RIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYI
           RI-AEAG-IE-W--N---FQCAGVA--R-TI--NGL-LP-YSNAPQL-YI
Sequence 2 RIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYI

Sequence 1 VQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQG
           --GRG--G--F-GCPETFEESQ--SQQG----------------------
Sequence 2 ARGRGITGVLFPGCPETFEESQRQSQQG----------------------

Sequence 1 QQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTR
           -----------------------------------Q---F-Q-DRHQK-R
Sequence 2 -----------------------------------QSREFQQ-DRHQKIR

Sequence 1 RIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYL
           --REGD--A-PAGVA-WSYNDG----VA--L-------NQLDQNPR-FYL
Sequence 2 HFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRNFYL

Sequence 1 AGNPENEFNQQGQSQ----PRQQGEQGRPGQHQQPFGRPRQQEQQGNGNN
           AGNP--EF--QGQ-------RQQ--Q-RPG-H-Q---------Q-G-GNN
Sequence 2 AGNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHGQ--------QQRGLGNN

Sequence 1 VFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRG-NLDFVQPPRG
           VFSGF----LA-A-NV--ETAR-LQ--ND-R--I--V-G--L----P---
Sequence 2 VFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWS

Sequence 1 RQEREHEERQQEQLQQERQQQGEQLMA-----NGLEETFCSLRLKENIGN
           R-E-E-EER-------E------Q--------NGLEET-C-LRL-ENIG-
Sequence 2 REEQEREERKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGD

Sequence 1 PERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVN
           P-RADI----AGRIST-NSH-LP-LR-L-LSAERG--Y----Y-PHWN-N
Sequence 2 PSRADIYTEEAGRISTVNSHTLPVLRWLQLSAERGALYSDALYVPHWNLN

Sequence 1 AHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQ
           AHSVVY--RG-A-VQVV---G----D-E---GQL---PQN--V---A-N-
Sequence 2 AHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARNE

Sequence 1 GFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYN
           GFE---FKT-ENA----LAGRTS--RALP-EVLA-A-QI-RE-AR-LK-N
Sequence 2 GFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIPREDARRLKFN

Sequence 1 RQETIALSSSQQRRAVV--------
           RQE-----S---R------------
Sequence 2 RQESTLVRSRPSRSRSSRSERRAEV



Alignment 7
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 50.47 (268/531)
Sequence 1 -------------------------ARQSQLSPQNQCQLNQLQAREPDNR
           -----------------------------Q-----QCQLN-L-A-EP-NR
Sequence 2 MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNR

Sequence 1 IQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIV
           I-AEAG-IE-W--N----QCAGVA--R-TI--NGL-LP-YSNAPQL-YI-
Sequence 2 IEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIA

Sequence 1 QGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQ
           -GRG--G--F-GCPETFEESQ--SQQG-----------------------
Sequence 2 RGRGITGVLFPGCPETFEESQRQSQQG-----------------------

Sequence 1 QEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRR
           ----------------------------------Q---F-Q-DRHQK-R-
Sequence 2 ----------------------------------QRREFQQ-DRHQKIRH

Sequence 1 IREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLA
           -REGD--A-PAGVA-W-YNDG----VA--L-------NQLDQNPR-FYLA
Sequence 2 FREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNPRNFYLA

Sequence 1 GNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGF
           GNP--EF--QGQ----Q---Q----QHQQ--G----Q-Q---GNNVFSGF
Sequence 2 GNPDDEFRPQGQQEYEQHRRQQ---QHQQRRGEHGEQ-QRDLGNNVFSGF

Sequence 1 NTQLLAQALNVNEETARNLQGQNDNRNQIIQVRG-NLDFVQPPRGRQERE
           ----LA-A-NV--ETAR-LQ--ND-R--I--V-G--L----P---R-E-E
Sequence 2 DAEFLADAFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQE

Sequence 1 HEERQQEQLQQERQQQGEQLMA-----NGLEETFCSLRLKENIGNPERAD
           HEER-------E------Q--------NGLEET-C-L-L-ENIG-P-RAD
Sequence 2 HEERKERERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRAD

Sequence 1 IFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVV
           I----AGRIST-NSHNLPILR-L-LSAERG--Y----Y-PHWN-NAHSVV
Sequence 2 IYTEEAGRISTVNSHNLPILRWLQLSAERGALYSDALYVPHWNLNAHSVV

Sequence 1 YVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYF
           Y--RG-A-VQVV---G----D-E---GQL---PQN--V---A---GFE--
Sequence 2 YALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARDEGFEWV

Sequence 1 AFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETI
           -FKT-ENA----LAGRTS--RALP-EVL-NA-QI-RE-AR-LK-NRQE--
Sequence 2 SFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQIPREDARRLKFNRQEST

Sequence 1 AL-----SSSQQRRAVV
           -------SS---RRA-V
Sequence 2 LVRSRSRSSRSERRAEV



Alignment 8
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 41.24 (219/531)
Sequence 1 --------------------------------ARQSQLSPQNQCQLNQLQ
           ------------------------------------------QC----L-
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT

Sequence 1 AREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNA
           A-EP--R---EAG--E-W------F-CAG--A-R--IQ--GL-LPSYSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PQLIYIVQGRGVLGAVFSGCPETFE-ESQ------QSSQQGRQQEQEQ--
           P------QGRGV-G-V--GCPETF--ES-------Q--Q--RQ-E-E---
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS

Sequence 1 ---ERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQG-QQ
           ----R--Q---E------Q---Q-E------G-Q--------E---G-Q-
Sequence 2 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR

Sequence 1 GRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNL
           -R------F---D-HQK--RIR-GDV---PAGV--W--NDGD--L----L
Sequence 2 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL

Sequence 1 FHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQP
           ----S--NQLD-N-R-F-LAG--------------RQ--E-G---Q----
Sequence 2 YDANSFQNQLDGNVRNFFLAGQSKQ--SREDRRSQRQTREEGSDRQ----

Sequence 1 FGRPRQQEQQGNGNNVFSGFNTQLLAQAL-NVNEETARNLQGQNDNRNQI
           --R-----------N---GF----L-----NV--ET---L-G-ND-R--I
Sequence 2 -SRESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFI

Sequence 1 IQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFC
           -Q-R--L----P-----E---EE-Q-E-----R---G-----NGLE--FC
Sequence 2 VQAR-DLKLRVP-----EEYEEELQRERGDRKRGGSGR---SNGLEQAFC

Sequence 1 SLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRN
           -L--K-N---P-RAD-F-PRAGRI-T-NS-NLPIL-F--LSA-----Y-N
Sequence 2 NLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKN

Sequence 1 GIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQN
           -I--P-WN-NAHS--YV-RG--RVQVV---G----D--VQ-GQ---VPQ-
Sequence 2 AILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQG

Sequence 1 HGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQIS
           --V---AG--G-E----K---NA-----AG-TS-LRA-P-EVLAN-Y-IS
Sequence 2 FAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDIS

Sequence 1 REQARQLKYNRQETIALSSSQQRRAVV----
           ---A--LK--RQE-------Q-R--------
Sequence 2 TKEAFRLKNGRQEVEVFLPFQSRDEKERERF



Alignment 9
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 40.30 (214/531)
Sequence 1 -------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEAG
           ---------------------------QN-CQ---L-A--PDNRI--E-G
Sequence 2 MAKLVLSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGG

Sequence 1 QIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVL
           -IETWN-N---FQCAGVA-SR-T--RN-L--PSY-NAPQ-IYI-QG-G--
Sequence 2 FIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIF

Sequence 1 GAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQE
           G--F-GCP-TFEE-QQ----------------------------------
Sequence 2 GMIFPGCPSTFEEPQQ----------------------------------

Sequence 1 RQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDV
           ---------------------GQ--RPQ--------DRHQK----REGD-
Sequence 2 --------------------KGQSSRPQ--------DRHQKIYHFREGDL

Sequence 1 VAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENE
           -A-P-G-AYW-YN--D---VAV-L----S--NQLDQ-PR-FYLAGN-E-E
Sequence 2 IAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQE

Sequence 1 FNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLA
           F-Q--Q-Q--Q-G-Q---G---------RQQE----G----SGF----L-
Sequence 2 FLQY-QPQKQQGGTQSQKGK--------RQQEEENEGGSILSGFAPEFLE

Sequence 1 QALNVNEETARNLQGQND--NRNQIIQVRGNLDFVQPPRGRQEREHEERQ
           -A--V-----R-LQG-N-------I--V-G-L----PP---Q----EE--
Sequence 2 HAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEE

Sequence 1 QEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIS
           ------E----------NG--ET-C--RL--NIG-----DIF-P-AG-I-
Sequence 2 KPDCD-EKDKHCQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSIT

Sequence 1 TLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQ
           T--S---P-L--L-LSA--G----N----PH-N-NA-S--Y---G-A-VQ
Sequence 2 TATSLDFPALSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQ

Sequence 1 VVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFI
           VVN-NG----D-E-Q-GQ--IVPQN--V--------FEY--FKT-----I
Sequence 2 VVNCNGERVFDGELQEGQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSI

Sequence 1 NTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRA
           --LAG--S-L-ALP-EV--------R-QARQ-K-N-------------R-
Sequence 2 GNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSFLVPPKESQRR

Sequence 1 VV-
           VV-
Sequence 2 VVA



Alignment 10
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 40.49 (215/531)
Sequence 1 ----------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIE
           ------------------------QN-CQ---L-A--PDNRI--E-G-IE
Sequence 2 MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIE

Sequence 1 TWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAV
           TWN-N---FQCAGVA-SR-T--RN-L--PSY-N-PQ-IYI-QG-G--G--
Sequence 2 TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMI

Sequence 1 FSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQG
           F-GCP-T--E-Q-S-Q-GR-Q-----------------------------
Sequence 2 FPGCPSTYQEPQESQQRGRSQ-----------------------------

Sequence 1 RQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAI
           ----------------------RPQ--------DRHQK--R-REGD--A-
Sequence 2 ----------------------RPQ--------DRHQKVHRFREGDLIAV

Sequence 1 PAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQ
           P-GVA-W-YN--D---VAV------S--NQLDQ-PR-FYLAGN-E-EF--
Sequence 2 PTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLK

Sequence 1 QGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQAL
           --Q-Q--Q-G-Q---G----------QQE----G-N--SGF----L--A-
Sequence 2 YQQQQ--QGGSQSQKG---------KQQEEENEGSNILSGFAPEFLKEAF

Sequence 1 NVNEETARNLQGQNDNRNQ--IIQVRGNLDFVQPP-RGRQEREHEERQQE
           -VN----RNLQG-N-------I--V-G-L----P--R--Q--E------E
Sequence 2 GVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEE

Sequence 1 QLQQERQQQGEQLMA----NGLEETFCSLRLKENIGNPERADIFSPRAGR
           Q-Q------G-Q-------NG--ET-C--RL--NIG-----DI--P-AG-
Sequence 2 QPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGS

Sequence 1 ISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNAR
           I-T--S---P-L--L-LSA--G----N----PH---NA-S--Y---G-A-
Sequence 2 ITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRAL

Sequence 1 VQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENA
           VQVVN-NG----D-E-Q-G---IVPQN--V--------FEY--FKT----
Sequence 2 VQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRP

Sequence 1 FINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQ-Q
           -I--LAG--S-L-ALP-EV----------QARQ-K-N------------Q
Sequence 2 SIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQ

Sequence 1 RRAVV
           RRAV-
Sequence 2 RRAVA



Alignment 11
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 40.49 (215/531)
Sequence 1 ----------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIE
           ------------------------QN-CQ---L-A--PDNRI--E-G-IE
Sequence 2 MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIE

Sequence 1 TWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAV
           TWN-N---FQCAGVA-SR-T--RN-L--PSY-N-PQ-IYI-QG-G--G--
Sequence 2 TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMI

Sequence 1 FSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQG
           F-GCP-T--E-Q-S-Q-GR-Q-----------------------------
Sequence 2 FPGCPSTYQEPQESQQRGRSQ-----------------------------

Sequence 1 RQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAI
           ----------------------RPQ--------DRHQK--R-REGD--A-
Sequence 2 ----------------------RPQ--------DRHQKVHRFREGDLIAV

Sequence 1 PAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQ
           P-GVA-W-YN--D---VAV------S--NQLDQ-PR-FYLAGN-E-EF--
Sequence 2 PTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLK

Sequence 1 QGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQAL
           --Q-Q--Q-G-Q---G----------QQE----G-N--SGF----L--A-
Sequence 2 YQQQQ--QGGSQSQKG---------KQQEEENEGSNILSGFAPEFLKEAF

Sequence 1 NVNEETARNLQGQNDNRNQ--IIQVRGNLDFVQPP-RGRQEREHEERQQE
           -VN----RNLQG-N-------I--V-G-L----P--R--Q--E------E
Sequence 2 GVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEE

Sequence 1 QLQQERQQQGEQLMA----NGLEETFCSLRLKENIGNPERADIFSPRAGR
           Q-Q------G-Q-------NG--ET-C--RL--NIG-----DI--P-AG-
Sequence 2 QPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGS

Sequence 1 ISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNAR
           I-T--S---P-L--L-LSA--G----N----PH---NA-S--Y---G-A-
Sequence 2 ITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRAL

Sequence 1 VQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENA
           VQVVN-NG----D-E-Q-G---IVPQN--V--------FEY--FKT----
Sequence 2 VQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRP

Sequence 1 FINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQ-Q
           -I--LAG--S-L-ALP-EV----------QARQ-K-N------------Q
Sequence 2 SIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQ

Sequence 1 RRAVV
           RRAV-
Sequence 2 RRAVA



Alignment 12
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 45.95 (244/531)
Sequence 1 ---------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAE
           ---------------------A---Q---QN-CQ--QL-A-EPDNR---E
Sequence 2 MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYE

Sequence 1 AGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRG
           AG--ETW--N---F-CAGVA--R-TIQ-NGL-LP-YSNAP-L-YIV-G-G
Sequence 2 AGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEG

Sequence 1 VLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQ
           --G----GCPET-----Q--QQG---------------------------
Sequence 2 MTGTLIPGCPETY----QAPQQG---------------------------

Sequence 1 QERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREG
           --------------------QQ-GQ--R-Q--------D-HQK--R-R-G
Sequence 2 --------------------QQHGQSSRFQ--------DKHQKIQRFRKG

Sequence 1 DVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPE
           D--A-PAGVA-W-YN-G----V-V-L--VS---NQLD--PRKF-LAGNPE
Sequence 2 DIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNPE

Sequence 1 NEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQL
           -EF-QQ-Q-Q------------------R-R-Q-QQ---NN-F-GF-T--
Sequence 2 DEFQQQQQQQ-----------------SRGRRQSQQKSCNNIFCGFDTKI

Sequence 1 LAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREHEERQ
           LA----V-------LQ---DNR--I--V-G-L----PPR---ER--E---
Sequence 2 LAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFE--S

Sequence 1 QEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIS
           -E----ER---G-----NGLEET-C---LKENI--P-R-DI--P--GRI-
Sequence 2 EEESEYERGRRGRD---NGLEETICTMKLKENIHDPSRSDIYTPEVGRIT

Sequence 1 TLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQ
           -LNS-NLPIL--L-LSAERG----N----PHWN-NAHS-VY---GNA-VQ
Sequence 2 SLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQ

Sequence 1 VVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFI
           VV---G----D-EV--GQ-F-VPQN--V---A--Q-FE---FKT---A-I
Sequence 2 VVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMI

Sequence 1 NTLAGRTSFLRALPDEVLANAYQISREQARQLKYN-RQETIALS-SSQQR
           --LAG-TS-LRA-P-EVLANA-QISRE-AR--K-N--Q-T-----SSQQ-
Sequence 2 SPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQM

Sequence 1 RAVV
           R---
Sequence 2 RDDA



Alignment 13
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 40.49 (215/531)
Sequence 1 ------------------ARQSQLSPQ-NQCQLNQLQAREPDNRIQAEAG
           ------------------A--S---PQ-N-CQ---L-A--PDNRI--E-G
Sequence 2 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG

Sequence 1 QIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVL
           -IETWN-N---FQCAGVA-SR-T--RN-L--PSY-N-PQ-IYI-QG-G--
Sequence 2 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF

Sequence 1 GAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQE
           G----GCP-TFEE-QQ----------------------------------
Sequence 2 GMIYPGCPSTFEEPQQP---------------------------------

Sequence 1 RQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDV
           ------------------QQ-GQ--RPQ--------DRHQK----REGD-
Sequence 2 ------------------QQRGQSSRPQ--------DRHQKIYNFREGDL

Sequence 1 VAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENE
           -A-P-GVA-W-YN--D---VAV------S--NQLDQ-PR-FYLAGN-E-E
Sequence 2 IAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQE

Sequence 1 FNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLA
           F------Q--Q-G-Q---G-HQQ--------E----G----SGF----L-
Sequence 2 FLKY---QQEQGGHQSQKGKHQQ--------EEENEGGSILSGFTLEFLE

Sequence 1 QALNVNEETARNLQGQNDNRNQ--IIQVRGNLDFVQPPRGRQEREHEERQ
           -A--V----A-NLQG-N-------I--V-G-L----PP---Q-----E--
Sequence 2 HAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE

Sequence 1 QEQLQQERQQQGEQLMA------------NGLEETFCSLRLKENIGNPER
           -E------Q--G-----------------NG--ET-C--RL--NIG----
Sequence 2 EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSS

Sequence 1 ADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHS
           -DI--P-AG---T--S---P-L--LRLSAE-G----N----PH-N-NA-S
Sequence 2 PDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANS

Sequence 1 VVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFE
           --Y---G-A--QVVN-NG----D-E-Q-G---IVPQN--V--------FE
Sequence 2 IIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFE

Sequence 1 YFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQ-
           Y--FKT-----I-TLAG--S-L-ALP-EV----------QARQ-K-N---
Sequence 2 YVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF

Sequence 1 ETIALSSSQQRRAVV
           ---------Q-RAV-
Sequence 2 KFLVPPQESQKRAVA



Alignment 14
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 40.49 (215/531)
Sequence 1 ------------------ARQSQLSPQ-NQCQLNQLQAREPDNRIQAEAG
           ------------------A--S---PQ-N-CQ---L-A--PDNRI--E-G
Sequence 2 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG

Sequence 1 QIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVL
           -IETWN-N---FQCAGVA-SR-T--RN-L--PSY-N-PQ-IYI-QG-G--
Sequence 2 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF

Sequence 1 GAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQE
           G----GCP-TFEE-QQ----------------------------------
Sequence 2 GMIYPGCPSTFEEPQQP---------------------------------

Sequence 1 RQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDV
           ------------------QQ-GQ--RPQ--------DRHQK----REGD-
Sequence 2 ------------------QQRGQSSRPQ--------DRHQKIYNFREGDL

Sequence 1 VAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENE
           -A-P-GVA-W-YN--D---VAV------S--NQLDQ-PR-FYLAGN-E-E
Sequence 2 IAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQE

Sequence 1 FNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLA
           F------Q--Q-G-Q---G-HQQ--------E----G----SGF----L-
Sequence 2 FLKY---QQEQGGHQSQKGKHQQ--------EEENEGGSILSGFTLEFLE

Sequence 1 QALNVNEETARNLQGQNDNRNQ--IIQVRGNLDFVQPPRGRQEREHEERQ
           -A--V----A-NLQG-N-------I--V-G-L----PP---Q-----E--
Sequence 2 HAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE

Sequence 1 QEQLQQERQQQGEQLMA------------NGLEETFCSLRLKENIGNPER
           -E------Q--G-----------------NG--ET-C--RL--NIG----
Sequence 2 EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSS

Sequence 1 ADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHS
           -DI--P-AG---T--S---P-L--LRLSAE-G----N----PH-N-NA-S
Sequence 2 PDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANS

Sequence 1 VVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFE
           --Y---G-A--QVVN-NG----D-E-Q-G---IVPQN--V--------FE
Sequence 2 IIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFE

Sequence 1 YFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQ-
           Y--FKT-----I-TLAG--S-L-ALP-EV----------QARQ-K-N---
Sequence 2 YVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF

Sequence 1 ETIALSSSQQRRAVV
           ---------Q-RAV-
Sequence 2 KFLVPPQESQKRAVA



Alignment 15
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 43.69 (232/531)
Sequence 1 -------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWN
           -------------A-------Q--CQ---L-A-EPDNR---EAG--E-W-
Sequence 2 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD

Sequence 1 FNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSG
           -N---F-CAGVA--R-TIQ-NGL-LP-YSNAPQLIY-VQG-G--G----G
Sequence 2 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG

Sequence 1 CPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQ
           CPET-----Q--QQGRQQ--------------------------------
Sequence 2 CPETY----QAPQQGRQQ--------------------------------

Sequence 1 GRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAG
           ---------------GQ-GR-Q--------DRHQK-RR-R-GD--AIPAG
Sequence 2 ---------------GQSGRFQ--------DRHQKIRRFRRGDIIAIPAG

Sequence 1 VAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQ
           VA-W-YN-G----V-V-L--VS---NQLD--PRKF-LAGNP---F-QQ-Q
Sequence 2 VAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQ

Sequence 1 SQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVN
           -Q-R--------------------------G-N-FSGF-T-LLA-A--V-
Sequence 2 HQSR--------------------------GRNLFSGFDTELLAEAFQVD

Sequence 1 EETARNLQGQNDNRNQIIQVRGN-LDFVQPPRGRQEREHEERQQEQLQQE
           E-----L----DNR--I--V----L----P-R---ER--E----E----E
Sequence 2 ERLIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSE--SEEESEDE

Sequence 1 RQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNL
           ----G-----NG-EET-C--RLKENI--P-RADI--P--GR--TLNS-NL
Sequence 2 KRRWGQR--DNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNL

Sequence 1 PILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGD
           PIL--L-LS-E-G--Y-N----PHWN-N-HS--Y---G---VQVV---G-
Sequence 2 PILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGN

Sequence 1 AILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRT
           ---D-EV--GQ---VPQN--V---A----FE---FKT---A----LAGRT
Sequence 2 RVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRT

Sequence 1 SFLRALPDEVLANAYQISREQARQLKYNRQETIALS--SSQQRRAVV
           S-L---P-EVLANA-QISRE-AR--K-N-Q-T---S--SS---R---
Sequence 2 SVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA



Alignment 16
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 45.95 (244/531)
Sequence 1 ----------------------ARQSQ-LSPQ--NQCQLNQLQAREPDNR
           ----------------------ARQS----PQ----C-L--L----P---
Sequence 2 MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTEV

Sequence 1 IQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIV
           I--EAGQ-E-W--N-----CAGV---R--IQ--GL-LP-----P---Y-V
Sequence 2 IKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSSPFISYVV

Sequence 1 QGRGVLGAVFSGCPETFEESQ-QSSQQGRQQEQEQERQQQQQGEQGRQQG
           QG-G--G-V--GC-ETF--SQ----QQG-QQ-Q----QQ-QQG-QG-QQG
Sequence 2 QGMGISGRVIPGCAETFMDSQPMQGQQGQQQGQQG--QQGQQGQQG-QQG

Sequence 1 QQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTR
           QQ-QQ------QQG-QQ---G-----QQGQQG--QQ-Q-FR--D-HQK--
Sequence 2 QQGQQG-----QQG-QQGQQG-----QQGQQG--QQGQGFR--DMHQKVE

Sequence 1 RIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYL
           --R-GD--A---G-A-W-YN-GDQ-L--V-L-------NQLD-NPR-F-L
Sequence 2 HVRHGDAIAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRL

Sequence 1 AGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSG
           AGN-----NQQG-SQ--QQ-----------------QQ-QQ----N--SG
Sequence 2 AGN-----NQQGSSQ--QQ-----------------QQQQQ----NILSG

Sequence 1 FNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQERE
           F--Q-LAQAL------A--LQ-Q-D-R--I--V-G----V-PP--RQ--E
Sequence 2 FDPQVLAQALKIDVRLAQELQNQQDKRGNIVRVKGPFQVVRPPL-RQAYE

Sequence 1 HEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPR
           -E------------Q-------NGLEET-CS-R--ENI--P-RADI--P-
Sequence 2 SEQWRHPRGPPQSPQD------NGLEETICSMRTHENIDDPARADIYKPN

Sequence 1 AGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRG
           -GR----NS--LPIL---RLSA-RG---------P--N-NA----Y---G
Sequence 2 LGRVTSVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEILYCTQG

Sequence 1 NARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTE
           -AR-QVVN-NG---LDQ-VQ-GQL---PQ------Q--N--FE---FKT-
Sequence 2 QARIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQSQNN-FEWISFKTN

Sequence 1 ENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSS
           -NA-I-TLAGRTS-LRALP-EV--NAYQIS-E-AR--K-N--ET------
Sequence 2 ANAMISTLAGRTSALRALPLEVITNAYQISLEEARKIKFNTLETTLTRAR

Sequence 1 QQRRAVV-------
           --------------
Sequence 2 GGQQPQLIEEIVEV



Alignment 17
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 43.50 (231/531)
Sequence 1 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
           ----Q----N-CQ---L-A--PDNRI--E-G-IETWN-N---F-CAGVA-
Sequence 2 ---RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVAL

Sequence 1 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
           SR----RN-L--P-YSNAPQ-I-I-QGRG--G--F-GCP---EE------
Sequence 2 SRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHT---

Sequence 1 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
           QGR-------R-Q-Q-----R-QG----QQ-R------------------
Sequence 2 QGR-------RSQSQRPPR-RLQGEDQSQQQR------------------

Sequence 1 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
           -----------------D-HQK--R--EGD--A-P-GVA-W-YND-D---
Sequence 2 -----------------DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDV

Sequence 1 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEF---NQQG-----------
           VAV-L-------NQLDQ-PR-F-LAGN-E-EF----QQ------------
Sequence 2 VAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYS

Sequence 1 ----QSQPRQQGEQGRP-GQHQQPFGRPRQ-QEQQGNGNNVFSGFNTQLL
           ----QSQPRQ------P-GQH-----R-R--QE----G-N-FSGF----L
Sequence 2 PYSPQSQPRQEEREFSPRGQHSR---RERAGQEEENEGGNIFSGFTPEFL

Sequence 1 AQALNVNE-ETARNLQGQNDNRNQ--IIQVRGNLDFVQPPRGR---QERE
           -QA--V-------NL-G---------I--VRG-L----P-R-R----E-E
Sequence 2 EQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEE

Sequence 1 HEERQQEQLQQERQQ-QGEQLMANGLEETFCSLRLKENIGNPERADIFSP
           --E---E-----R----G-----NG-EET-C----K-NIG-----DI--P
Sequence 2 YDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNP

Sequence 1 RAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIR
           -AG---T-N--NL-ILR-L--SAE-G--YRN-----H-N-NAHS--Y--R
Sequence 2 QAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLR

Sequence 1 GNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKT
           G-A-VQVV--NG----D-E-Q-G----VPQN--V--------FEY-AFKT
Sequence 2 GRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKT

Sequence 1 EENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSS
           -----I--LAG--S----LP-EV-AN-Y---REQARQLK-N---------
Sequence 2 DSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPP

Sequence 1 SQQR-RAVV
           SQQ--RAV-
Sequence 2 SQQSPRAVA



Alignment 18
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 43.50 (231/531)
Sequence 1 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
           ----Q----N-CQ---L-A--PDNRI--E-G-IETWN-N---F-CAGVA-
Sequence 2 ISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVAL

Sequence 1 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
           SR----RN-L--P-YSNAPQ-I-I-QGRG--G--F-GCP---EE------
Sequence 2 SRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHT---

Sequence 1 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
           QGR-------R-Q-Q-----R-QG----QQ-R------------------
Sequence 2 QGR-------RSQSQRPPR-RLQGEDQSQQQR------------------

Sequence 1 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
           -----------------D-HQK--R--EGD--A-P-GVA-W-YND-D---
Sequence 2 -----------------DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDV

Sequence 1 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEF---NQQG-----------
           VAV-L-------NQLDQ-PR-F-LAGN-E-EF----QQ------------
Sequence 2 VAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYS

Sequence 1 ----QSQPRQQGEQGRP-GQHQQPFGRPRQ-QEQQGNGNNVFSGFNTQLL
           ----QSQPRQ------P-GQH-----R-R--QE----G-N-FSGF----L
Sequence 2 PYSPQSQPRQEEREFSPRGQHSR---RERAGQEEENEGGNIFSGFTPEFL

Sequence 1 AQALNVNE-ETARNLQGQNDNRNQ--IIQVRGNLDFVQPPRGR---QERE
           -QA--V-------NL-G---------I--VRG-L----P-R-R----E-E
Sequence 2 EQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEE

Sequence 1 HEERQQEQLQQERQQ-QGEQLMANGLEETFCSLRLKENIGNPERADIFSP
           --E---E-----R----G-----NG-EET-C----K-NIG-----DI--P
Sequence 2 YDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNP

Sequence 1 RAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIR
           -AG---T-N--NL-ILR-L--SAE-G--YRN-----H-N-NAHS--Y--R
Sequence 2 QAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLR

Sequence 1 GNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKT
           G-A-VQVV--NG----D-E-Q-G----VPQN--V--------FEY-AFKT
Sequence 2 GRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKT

Sequence 1 EENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSS
           -----I--LAG--S----LP-EV-AN-Y---REQARQLK-N---------
Sequence 2 DSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPP

Sequence 1 SQQR-RAVV
           SQQ--RAV-
Sequence 2 SQQSPRAVA



Alignment 19
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 43.69 (232/531)
Sequence 1 --------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEA
           ------------------------Q----N-CQ---L-A--PDNRI--E-
Sequence 2 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG

Sequence 1 GQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV
           G-IETWN-N---F-CAGVA-SR----RN-L--P-YSNAPQ-I-I-QGRG-
Sequence 2 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY

Sequence 1 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ
           -G--F-GCP-T-EE-----QQGR-----------------R-Q-Q-----
Sequence 2 FGLIFPGCPSTYEEP---AQQGR-----------------RYQSQRPP--

Sequence 1 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGD
           --------R--QEE---Q-QQ----------------D-HQK--R--EGD
Sequence 2 --------RRLQEEDQSQQQQ----------------DSHQKVHRFNEGD

Sequence 1 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN
           --A-P-GVA-W-YND-D---VAV-L-------NQLDQ-PR-F-LAGN-E-
Sequence 2 LIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQ

Sequence 1 EFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQ------------------Q
           EF----Q-Q-RQ------P-----P--RPR-------------------Q
Sequence 2 EFLRY-QQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQ

Sequence 1 EQQGNGNNVFSGFNTQLLAQALNVNE-ETARNLQGQNDNRNQ--IIQVRG
           E----G-N-FSGF----L-QA--V-------NL-G-N-------I--VRG
Sequence 2 EEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRG

Sequence 1 NLDFVQPP--RGR-QEREHEERQQEQLQQE-RQQQGEQLMANGLEETFCS
           -L----P---RG---E-E--E-Q-E---Q--R---G-----NG-EET-C-
Sequence 2 GLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICT

Sequence 1 LRLKENIGNPERADIFSPRAGRISTLNSH--NLPILRFLRLSAERGFFYR
           ---K-NIG------I--P---R--T-N-H--NL-ILR-L-LSAE-G--YR
Sequence 2 ACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWLGLSAEYGNLYR

Sequence 1 NGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQ
           N----PH-N-NAHS--Y--RG-A-VQVV--NG----D-E-Q-G----VPQ
Sequence 2 NALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQ

Sequence 1 NHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQI
           N--V--------FEY-AFKT-----I---AG--SF---LP-EV-AN-Y--
Sequence 2 NFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGL

Sequence 1 SREQARQLKYNRQETIALSSSQQR-RAVV
           -REQARQLK-N----------QQ--RAV-
Sequence 2 PREQARQLKNNNPFKFFVPPFQQSPRAVA



Alignment 20
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 40.68 (216/531)
Sequence 1 --------------------------------ARQSQLSPQNQCQLNQLQ
           ----------------------------------------Q-QC----L-
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT

Sequence 1 AREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNA
           A-EP--R---EAG--E-W------F-CAG--A-R--IQ--GL-LPSYSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGE
           P------QGRGV-G-V--GCPETF--S-------R-Q---Q---Q---GE
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQ-SGSEFEYPRSQ-RDQRSRQSESGE

Sequence 1 QGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQG-QQGRPQQQQQFRQL
           --R------------G-Q--RQ---E----E---G-Q--R------F---
Sequence 2 SSR------------GDQRSRQSESE----ESSRGDQRSRQSESEEFSRG

Sequence 1 DRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQ
           D-HQK--RIR-GDV---PAGV--W--N-GD--L----L----S--NQLD-
Sequence 2 DQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDE

Sequence 1 NPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGN
           N-R-F-LAG--------------RQ--E-G---Q------R--Q------
Sequence 2 NVRNFFLAGQSKQ--SREDRRSQRQTREEGSDRQ-----SRESQDDEALL

Sequence 1 GNNVFSGFNTQLLAQAL-NVNEETARNLQGQNDNRNQIIQVRGNLDFVQP
           --N--SGF----L-----NV--ET---L-G-ND-R--I-Q-R--L----P
Sequence 2 EANILSGFEDEILQEIFRNVDQETISKLRGENDQRGFIVQAR-DLKLRVP

Sequence 1 PRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPE
           -----E---EE-Q-E-----R---G-----NGLE--FC-L----N---P-
Sequence 2 -----EEYEEELQRERGDRKRGGSGR---SNGLEQAFCNLKFRQNVNRPS

Sequence 1 RADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAH
           RAD-F-PRAGRI-T--S-NLPIL-F--LSA-----Y-N-I--P-WN-NAH
Sequence 2 RADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAH

Sequence 1 SVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGF
           S--YV-RG--RVQVV---G----D--VQ-GQ---VPQ---V---AG--G-
Sequence 2 SALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGL

Sequence 1 EYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQ
           E----K---NA-----AG-TS-LRA-P-EVLAN-Y-IS---A--LK--RQ
Sequence 2 EWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQ

Sequence 1 ETIALSSSQQRRAVV-------
           E-------Q-R-----------
Sequence 2 EVEVFRPFQSRDEKERERFSIV



Alignment 21
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 44.07 (234/531)
Sequence 1 -------------------------------ARQSQLSPQNQCQLNQLQA
           --------------------------------RQ-Q---Q-QCQ---L-A
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 REPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAP
           -EP--RI--EAG--E-W--N----QCA-VA--R-TIQ--GL--PSY-NAP
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAP

Sequence 1 QLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQ
           -L-Y-VQG-G--GAVF-GCPETF-E--QS-----------ER-QQ--GEQ
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQSRSRS-------ERSQQS-GEQ

Sequence 1 GRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNP
           HQK-R-I-EGDV-A-PAGVA-W-YN-G---LV-V-L--V----NQLDQ--
Sequence 2 HQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYL

Sequence 1 RKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGN
           RKF-L-G-P--E----GQS--R-Q----R-GQ----------Q-QQ-N--
Sequence 2 RKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQ----------QGQQSN--

Sequence 1 NVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRG
           N--S-F----LAQ--N-----AR-LQ-----R--I--V---L----P-R-
Sequence 2 NILSAFDEEILAQSFNIDTQLARRLQKEKRQRGIIVRVQEDLEVLSPHRQ

Sequence 1 RQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERAD
           -QE-E-EE--------ER-Q-------NGLEETFC---LK-NI--P-RAD
Sequence 2 EQEQEYEE------ERERRQR------NGLEETFCTMTLKYNINDPSRAD

Sequence 1 IFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVV
           ---PR-GR-S--N--NLPILRFL-LSA--G---R--I--PHWNVNAHS-V
Sequence 2 VYNPRGGRVSSVNALNLPILRFLQLSAKKGVLHRDAILAPHWNVNAHSIV

Sequence 1 YVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYF
           Y--RGN-R-Q-V-ENG----D-E---GQL--VPQN--V---A----FE--
Sequence 2 YITRGNGRIQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDKFEWV

Sequence 1 AFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQET-
           -FKT--------LAGR-S--RALP--V--N---ISRE-AR-LK--R-ET-
Sequence 2 SFKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISREDARRLKESRSETT

Sequence 1 -IALSSSQQRRAVV--------------
           --A--SS-QR------------------
Sequence 2 IFAPGSSSQRKSQSERERQREREEREIH



Alignment 22
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 42.18 (224/531)
Sequence 1 -------------------------------ARQSQLSPQNQCQLNQLQA
           --------------------------------RQ-Q---Q-QCQ---L-A
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 REPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAP
           -EP--RI--EAG--E-W--N----QCA-VA--R-TIQ--GL--PSY-NAP
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAP

Sequence 1 QLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQ
           -L-Y-VQG-G--GAVF-GCPETF-E--QS--Q-R-Q----ER-QQ--GEQ
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQS--QSRSQHSRSERSQQS-GEQ

Sequence 1 GRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNP
           HQK-R-IREGD--A-PAGVA-W-YN-G---LV-V-L--V----NQLDQ--
Sequence 2 HQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYL

Sequence 1 RKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGN
           RKF-L-G-P--E---QG--Q---Q----R-GQ-----------------N
Sequence 2 RKFVLGGSPQQEI--QGGGQSWSQSRSSRKGQQS---------------N

Sequence 1 NVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRG
           N--S-F----LAQ--N--------LQ-----R--I--V---L----P-R-
Sequence 2 NILSAFDEEILAQSFNIDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQR-

Sequence 1 RQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERAD
           -QE-E----------------------NGLEETFC---LK-NI--P-RAD
Sequence 2 -QEKEYSD-------------------NGLEETFCTMTLKLNINDPSRAD

Sequence 1 IFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVV
           ---PR-GR----N--NLPILRFL-LS-E-G--Y-N-I--PHWN-NAHS-V
Sequence 2 VYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIV

Sequence 1 YVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYF
           Y--RGN-R-Q-V-ENG----D-E---GQL--VPQN--V---A---GFE--
Sequence 2 YITRGNGRMQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDGFEWV

Sequence 1 AFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETI
           -FKT---A-I--LAGR-S--R-LP--V--N---ISRE-A--LK--R-E--
Sequence 2 SFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISREDAWNLKESRSEMT

Sequence 1 AL---SSSQQRRAVV
           -----S-SQ--R---
Sequence 2 IFAPGSRSQRQRN--



Alignment 23
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 39.17 (208/531)
Sequence 1 -----------------------------------ARQSQLSPQNQCQLN
           ------------------------------------RQ-Q---Q-QC---
Sequence 2 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQ-QHQFQHQCDIQ

Sequence 1 QLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSY
           -L-A-EP--R---EAG--E-W------F-C-G--A-R--IQ--GL-LPSY
Sequence 2 RLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSY

Sequence 1 SNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQ
           SNAP------QGRGV-G-V--GCPETF-----------Q---E-E--Q-Q
Sequence 2 SNAPYITFVEQGRGVQGVVIPGCPETF-----------QSDSEFEYPQSQ

Sequence 1 QGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFR
           -G---RQ----E---------------------E---G------------
Sequence 2 RGRHSRQSESEE---------------------ESSRG------------

Sequence 1 QLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQL
           --D-HQK--RIREGDV---PAGV--W--NDG---L--V-L----S-H-QL
Sequence 2 --DQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYHKQL

Sequence 1 DQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQ
           D-N-R-F-LAG----------QSQ-R---E-G---Q------R-------
Sequence 2 DENVRSFFLAG----------QSQ-RETREEGSDRQ-----SRESDDDEA

Sequence 1 GNGNNVFSGFNTQLLAQAL-NVNEETARNLQGQNDNRNQIIQVRGNLDFV
           --G-N--SGF----L------V--ET---L-G-ND-R--I-Q--------
Sequence 2 LLGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQA-------

Sequence 1 QPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGN
           Q----R-----EE---------R--QG-----NG-E--FC-L----N---
Sequence 2 QDLKLRVPQDFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNT

Sequence 1 PERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVN
           P-----F-PRAGRI-T-NS--LPIL-FL-LSA-----Y-N-I--P-WN-N
Sequence 2 PTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLN

Sequence 1 AHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQ
           AHS--YV-RG--RVQVV---G----D--VQ-GQ---VPQ---V---AG--
Sequence 2 AHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGRE

Sequence 1 GFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYN
           G-E----K---NA------GRTS-LRA-P-EVLAN-Y-IS---A--LK--
Sequence 2 GLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNG

Sequence 1 RQETIALSSSQQRRAVV-------
           RQE-------Q-R-----------
Sequence 2 RQEVEVFRPFQSRDEKERERFSIV



Alignment 24
Sequence 1:
Sequence 2: Allergen Cuc ma 4.0101, Sequence: P13744
Sequence identity: 39.74 (211/531)
Sequence 1 -------------------------------------ARQSQLSPQNQCQ
           -------------------------------------------SP---C-
Sequence 2 MARSSLFTFLCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPRA-CR

Sequence 1 LNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLP
           L--L-A--P--R--AEA---E-W------FQCAGV---R-TI---GL-LP
Sequence 2 LENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLP

Sequence 1 SYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQ
           --SNAP-LI---QG-G--G----GC-ET---------------Q---R--
Sequence 2 GFSNAPKLIFVAQGFGIRGIAIPGCAETY--------------QTDLRRS

Sequence 1 QQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQ
           Q--G----------------------------------------------
Sequence 2 QSAG--------------------------------------------SA

Sequence 1 FRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHN
           F---D-HQK-R--REGD----PAGV--W-YN-G---LV-----------N
Sequence 2 FK--DQHQKIRPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVAN

Sequence 1 QLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQE
           Q-D---RKFYLAG-PE------G----------G--G------------E
Sequence 2 QIDPYLRKFYLAGRPEQV--ERGVEEWERSSRKGSSG------------E

Sequence 1 QQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDF
           --GN----FSGF----L--A--------R-L-G--D-R--I-QV------
Sequence 2 KSGN---IFSGFADEFLEEAFQIDGGLVRKLKGEDDERDRIVQVDEDFEV

Sequence 1 VQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIG
           --P-----E---EER--------R----E----NGLEET-C-LRLK-NIG
Sequence 2 LLP-----EKDEEERSRG-----RYIESESESENGLEETICTLRLKQNIG

Sequence 1 NPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNV
           ---RAD-F-PR-GRIST-N-H-LPILR--RLSAERG--Y-N----PH--V
Sequence 2 RSVRADVFNPRGGRISTANYHTLPILRQVRLSAERGVLYSNAMVAPHYTV

Sequence 1 NAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGN
           N-HSV-Y--RGNARVQVV---G----D-EV--GQ----PQN--VI--A--
Sequence 2 NSHSVMYATRGNARVQVVDNFGQSVFDGEVREGQVLMIPQNFVVIKRASD

Sequence 1 QGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKY
           -GFE--AFKT--NA--N-LAGR-S--R-LP--VL-N-Y-ISRE-A--LKY
Sequence 2 RGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVLSNMYRISREEAQRLKY

Sequence 1 NRQETIALSS--SQQRRAVV
           --QE---LS---SQ-RR---
Sequence 2 GQQEMRVLSPGRSQGRRE--



Alignment 25
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 41.24 (219/531)
Sequence 1 -------------------------------------ARQSQLSPQNQCQ
           ---------------------------------------Q--L-----C-
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR

Sequence 1 LNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLP
           ---L-A-EP--R---EAG--E-W--N---F-CAGVAA-R--IQ--GL-LP
Sequence 2 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP

Sequence 1 SYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQ
           -Y-NAPQL-Y-V-GRG--G-V--GC-ETFE---Q----------------
Sequence 2 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQ----------------

Sequence 1 QQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQ
           --------------------------------------------P-Q---
Sequence 2 --------------------------------------------PRQDRR

Sequence 1 FRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHN
           -R--DRHQK-R--R-GD--A-PAG---W-YN-G---L--V-L-------N
Sequence 2 RRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAAN

Sequence 1 QLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQE
           QLDQ--R-F-LAGNP------QG----------GR----Q--FGRP----
Sequence 2 QLDQTFRHFFLAGNP------QG----------GR----QSYFGRPQTEK

Sequence 1 QQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDF
           QQG---N-F-GF----LA-A--V---TAR-L-GQ-D-R--I------LD-
Sequence 2 QQGETKNIFNGFDDEILADAFGVDVQTARRLKGQDDLRGRIVRAE-RLDI

Sequence 1 VQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIG
           V-P--G--E-E--ER------------G----ANGLEET-C---L-EN--
Sequence 2 VLP--GEEEEERWERDP--------YSG----ANGLEETLCTAKLRENLD

Sequence 1 NPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNV
           -P-RAD---P--GRIS-LNS--LP-L--LRLSAE-G--YRNG---PHWN-
Sequence 2 EPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNL

Sequence 1 NAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAG-
           NAHS--Y--RG--R-QVV---G----D--V--GQL-IVPQN--V---A--
Sequence 2 NAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQ

Sequence 1 NQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLK
           --G-E---FKT--NA----LAGR-S--RA-P-EV---AYQ-SR--AR-LK
Sequence 2 DEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLK

Sequence 1 YNRQETIALSSSQQRRAVV-----------------------
           YNR-E----SS-------------------------------
Sequence 2 YNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVIKSMM



Alignment 26
Sequence 1:
Sequence 2: Allergen Zan b 2.0101, Sequence: QYU76045
Sequence identity: 38.61 (205/531)
Sequence 1 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
           ----------------------------EAG--E-W--N----QCA-VA-
Sequence 2 ----------------------------EAGVTEFWDQNNEQLQCANVAV

Sequence 1 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
           -R--IQ--GL--PSY-N---L-Y-VQGRG--GAVF-GCPET---------
Sequence 2 FRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGCPETY--------

Sequence 1 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
           ------Q-Q--QQ--Q-E--R-Q---------------------------
Sequence 2 ------QDQQQQQSHQSEGSRSQ---------------------------

Sequence 1 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
           -----------------D-HQK-R--REGD-VA-P-G-A-W-YN-G---L
Sequence 2 -----------------DQHQKVRQLREGDIVAVPTGSAHWIYNNGQSQL

Sequence 1 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG
           V-V-L--V----NQLDQ--RKFY--GNP--E---QG-SQ---QG---R--
Sequence 2 VLVALVDVGNSDNQLDQYLRKFYIGGNPQQEL--QGYSQ--SQG--SRSY

Sequence 1 QHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN
           Q--Q--G--R-------G-N-F-GF---LLA-A-NVN-E--R-LQ-----
Sequence 2 QGSQGEGSSRRS----SGGNIFNGFDERLLADAFNVNPEIIRRLQKPQLP

Sequence 1 RNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLE
           R--I--V---L----P-RG----------QEQ--QE----G-----NGLE
Sequence 2 RGIIVRVEEELEVLRPQRG----------QEQ-EQEQEFRGRD---NGLE

Sequence 1 ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF
           ET-C---LK-NI-NP--AD---PR-GRIST-NS-NLP-LR---LSAE-G-
Sequence 2 ETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGN

Sequence 1 FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI
           -Y-N----PHWN-N-HSVVYV-RG--RVQ-V-ENG----D-----GQL--
Sequence 2 LYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIV

Sequence 1 VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANA
           VPQ---V---A-NQG-E---FKT--NA----LAGR-S--RALP--V--N-
Sequence 2 VPQGYAVLKRASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN-

Sequence 1 YQISREQARQLKYNRQETIALSSSQQRRAVV
           -------------------------------
Sequence 2 -------------------------------



Alignment 27
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 41.24 (219/531)
Sequence 1 -------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEAG
           -------------------A----------C----L-A-EP--R--AEAG
Sequence 2 MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAG

Sequence 1 QIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVL
           --E-W------F-CAGVAA-R-TI---GL-LP-Y-NAP-L-Y--QGRG-L
Sequence 2 VSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGIL

Sequence 1 GAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQE
           G----GCPETF----Q-------------------------QG--EQ--E
Sequence 2 GVLMPGCPETFQSMSQF------------------------QGSREQEEE

Sequence 1 RQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDV
           R-GR-Q------------------------------D-HQK------GD-
Sequence 2 R-GRFQ------------------------------DQHQKVHHLKKGDI

Sequence 1 VAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENE
           -AIPAGVA-W-YNDGD--LV-V---H--SD-NQLDQNPR-F-LAGN----
Sequence 2 IAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQRS

Sequence 1 FNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLA
           --Q-G-------G--G--GQ-------------Q----NVF-GFN---LA
Sequence 2 QKQRGE----RYGLRG--GQ-------------QILADNVFKGFNMEALA

Sequence 1 QALN--VNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREHEERQ
           --L------ETAR---G--D-R--I--V---L----PPR-R-E-E-----
Sequence 2 DVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELE-----

Sequence 1 QEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIS
           --------QQ-G-----NGLEET-CS-----NI-NP--AD---PRAGR--
Sequence 2 --------QQEGGGY--NGLEETICSATFIQNIDNPAEADFYNPRAGRLT

Sequence 1 TLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQ
           T-NS---PIL-FL-LSA--G--Y-N----P-W--NA-SVVY--RG-ARVQ
Sequence 2 TVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQ

Sequence 1 VVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFI
           -V---G----D-----GQ---VPQN--V--QAG--GFE---F-T--NA--
Sequence 2 IVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALF

Sequence 1 NTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRA
           -T-AGRTS-LR--P--VLANAY--S-E-AR--K-NR-E----------R-
Sequence 2 STAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRG

Sequence 1 VV--
           ----
Sequence 2 RASA



Alignment 28
Sequence 1:
Sequence 2: Allergen Zan b 2.0102, Sequence: QYU76046
Sequence identity: 38.42 (204/531)
Sequence 1 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
           ----------------------------EAG--E-W--N----QCA-VA-
Sequence 2 ----------------------------EAGVTEFWDQNNEQLQCANVAV

Sequence 1 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
           -R--IQ--GL--PSY-N---L-Y-VQGRG--GAVF-GCPET---------
Sequence 2 FRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGCPETY--------

Sequence 1 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
           ------Q-Q--QQ--Q-E--R-Q---------------------------
Sequence 2 ------QDQQQQQSHQSEGSRSQ---------------------------

Sequence 1 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
           -----------------D-HQK-R--REGD-VA-P-G-A-W-YN-G---L
Sequence 2 -----------------DQHQKVRQLREGDIVAMPTGSAHWIYNNGQSQL

Sequence 1 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG
           V-V-L--V----NQLDQ--RKFY--GNP--E---QG-SQ---QG---R--
Sequence 2 VLVALVDVGNSDNQLDQYLRKFYIGGNPQQEL--QGYSQ--SQG--SRSY

Sequence 1 QHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN
           Q--Q--G--R-------G-N-F-GF---LLA-A-NVN-E--R-LQ-----
Sequence 2 QGSQGEGGSRRS----SGGNIFNGFDERLLADAFNVNPEIIRRLQKPQLP

Sequence 1 RNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLE
           R--I--V---L----P-RG-QE-E-E-R------------------NGLE
Sequence 2 RGIIVRVEEELEVLRPQRGEQEQEQEFRGRD---------------NGLE

Sequence 1 ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF
           ET-C---LK-NI-NP--AD---PR-GRIST-NS-NLP-LR---LSAE-G-
Sequence 2 ETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGN

Sequence 1 FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI
           -Y-N----PHWN-N-HSVVYV-RG--RVQ-V-ENG----D-----GQL--
Sequence 2 LYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIV

Sequence 1 VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANA
           VPQ---V---A-NQG-E---FKT--NA----LAGR-S--RALP--V--N-
Sequence 2 VPQGYAVLKKASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN-

Sequence 1 YQISREQARQLKYNRQETIALSSSQQRRAVV
           -------------------------------
Sequence 2 -------------------------------



Alignment 29
Sequence 1:
Sequence 2: Allergen Zan b 2.02, Sequence: QYU76044
Sequence identity: 37.48 (199/531)
Sequence 1 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
           ----------------------------EAG--E-W--N----QCA-VA-
Sequence 2 ----------------------------EAGVTEFWDQNNPQLQCANVAV

Sequence 1 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
           -R--IQ-NGL--P-Y-N---L-Y-VQGRG--GAVF-GCPET---------
Sequence 2 FRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGCPETYQD------

Sequence 1 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
           -----------QQQQQ--Q---QG---Q----------------------
Sequence 2 -----------QQQQQSYQS--QGSRSQ----------------------

Sequence 1 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
           -----------------D-HQK-R-IREGD--A-P-G-A-W-YN-G---L
Sequence 2 -----------------DQHQKVRQIREGDIIALPTGAAHWIYNNGGSQL

Sequence 1 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG
           V-V-L--V----NQLDQ--RKFYL-GNP--E---QG-SQ-RQQG--G--G
Sequence 2 VLVALVDVGNSDNQLDQYFRKFYLGGNPQPEL--QGTSQ-RQQG-GGYQG

Sequence 1 QHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN
           ------G--R---------N-F-GF---LLA-A-NVN-E--R-LQ-----
Sequence 2 SQGGGGGSRR--------GNMFNGFDERLLADAFNVNPELIRRLQRPQMQ

Sequence 1 RNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLE
           R--I--V--------P-RG---------------QE--Q--EQ---NG-E
Sequence 2 RGIIVRVEEEFRVLSPQRG---------------QEQEQEQEQDCDNGVE

Sequence 1 ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF
           ETFC---L--NI--P-RAD---PR-GR--T-N--NLP-LR-L-LSAE-G-
Sequence 2 ETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGN

Sequence 1 FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI
           -Y-N---SPHWN-N-HS-VY--RG--R-Q-V-ENG------E---GQL--
Sequence 2 LYQNALTSPHWNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIREGQLIV

Sequence 1 VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANA
           -PQ---V---A-N-G-E--AFKT--NA--N-LAGR-S--RALP--V----
Sequence 2 IPQGFAVVKKASNRGLEWIAFKTNDNAMTNQLAGRVSVMRALPLDV----

Sequence 1 YQISREQARQLKYNRQETIALSSSQQRRAVV
           -------------------------------
Sequence 2 -------------------------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Zan b 2.03, Sequence: QYS16039
Sequence identity: 36.91 (196/531)
Sequence 1 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
           ----------------------------EAG--E-W--N----QCA-VA-
Sequence 2 ----------------------------EAGVTEFWDQNNQQLQCANVAV

Sequence 1 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
           -R--IQ-NGL--P-Y-N-P-L-Y-VQGRG--GAV--GCPET---------
Sequence 2 FRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGCPETY--------

Sequence 1 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
           --------Q--QQQQQ-------G---Q----------------------
Sequence 2 --------QDEQQQQQSFSYPSEGSRSQ----------------------

Sequence 1 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
           -----------------D-HQK-R-IREGD--A-P-G-A-W-YN-G---L
Sequence 2 -----------------DQHQKVRQIREGDIIALPTGSAHWIYNNGQSQL

Sequence 1 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG
           V-V-L--V----NQLDQ--RKFYL-GNP------QG-SQ---QG-----G
Sequence 2 VLVALVDVGNSDNQLDQYFRKFYLGGNPQPQL--QGTSQ--SQG-----G

Sequence 1 QHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN
           --Q---G---------N----F-GF---LLA-A-NVN-E--R-LQ-----
Sequence 2 RYQERLGGGDSSRRSAN---IFNGFDERLLAEAFNVNPELIRRLQRPQMQ

Sequence 1 RNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLE
           R--II-V--------P-RG----E----------------------NG-E
Sequence 2 RGIIIRVEEEFRVLTPQRGQESYESDPYGRY---------------NGVE

Sequence 1 ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF
           ET-C--RL--NI--P-RAD---PRAGR--T-N--NLP-LR-L-LSAE-G-
Sequence 2 ETLCTMRLRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKGN

Sequence 1 FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI
           -Y-N----PHWN-NAHS-VY--RGN-RVQ-V-ENG----D-E---GQL--
Sequence 2 LYKNALTAPHWNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIREGQLIV

Sequence 1 VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANA
           VPQ---V---A-N-G-E---FKT---A--N-LAGR-S-LRALP--V--N-
Sequence 2 VPQGFAVVKRASNRGLEWISFKTNDYAMTNQLAGRVSVLRALPLDVIQN-

Sequence 1 YQISREQARQLKYNRQETIALSSSQQRRAVV
           -------------------------------
Sequence 2 -------------------------------



Alignment 31
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 43.50 (231/531)
Sequence 1 --------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEA
           --------------------------S--N-CQLN-L-A-EPD-R---E-
Sequence 2 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG

Sequence 1 GQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV
           G-I-TWN-------CAGV--S--T--RNGLHLPSYS--P--I-I-QG-G-
Sequence 2 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA

Sequence 1 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ
           LG----GCPETFEE-Q---------------------EQ----G---Q-Q
Sequence 2 LGVAIPGCPETFEEPQ---------------------EQSNRRGSRSQKQ

Sequence 1 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGD
           --Q----------------------------------D-HQK-R---EGD
Sequence 2 QLQ----------------------------------DSHQKIRHFNEGD

Sequence 1 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN
           V--IP-GV-YW-YN-GD---VA--L---S---NQLDQ-PR-FYLAGNP--
Sequence 2 VLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDI

Sequence 1 EFNQQGQSQPRQQGEQGRP-GQHQQPFGRPRQQEQQGNGNNVFSGFNTQL
           E-----Q-Q--Q----GR--GQHQQ--------E----G--V-SGF----
Sequence 2 EYPETMQQQQQQKSHGGRKQGQHQQ--------EEEEEGGSVLSGFSKHF

Sequence 1 LAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFV---------------
           LAQ--N-NE--A--LQ---D-R-QI--V-G-L------------------
Sequence 2 LAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDED

Sequence 1 ----------QPPR----GRQEREHEE----------------RQQEQLQ
           -----------PPR----G--E----E----------------R-Q-Q-Q
Sequence 2 EDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQ

Sequence 1 QERQQQGEQL----------------------------MANGLEETFCSL
           -E-----E--------------------------------NG-EE--C-L
Sequence 2 DEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTL

Sequence 1 RLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGI
           -L-ENI--P-RAD---P-AGRISTLNS--LP-LR---LSA-----Y-NGI
Sequence 2 KLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGI

Sequence 1 YSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHG
           YSPHWN-NA-SV-YV-RG---V-VVN--G-A--D-E---GQL--VPQN--
Sequence 2 YSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFV

Sequence 1 VIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISRE
           V--QAG-QGFEY--FKT--NA----L-------RA-P-EVLA--Y-----
Sequence 2 VAEQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQS

Sequence 1 QARQLKYNRQETIALSSSQQRRAVV----
           Q---LKY------------Q---------
Sequence 2 QVSELKYEGNWGPLVNPESQQGSPRVKVA



Alignment 32
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 44.63 (237/531)
Sequence 1 ---------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAE
           ---------------------------S--N-CQLN-L-A-EPD-R---E
Sequence 2 MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESE

Sequence 1 AGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRG
           -G-IETWN------QCAGV--S--T--RNGLHLPSYS--PQ-I--VQG-G
Sequence 2 GGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKG

Sequence 1 VLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQ
           --G--F-GCPETFE--QQ-------------------------------Q
Sequence 2 AIGFAFPGCPETFEKPQQ-------------------------------Q

Sequence 1 QERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREG
           --R-G----------------------R-QQQ-Q----D-HQK-R---EG
Sequence 2 SSRRG---------------------SRSQQQLQ----DSHQKIRHFNEG

Sequence 1 DVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPE
           DV--IP-GV-YW-YN-GD---VA--L---S---NQLDQNPR-FYLAGNP-
Sequence 2 DVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPD

Sequence 1 NEFNQQGQSQPRQQGEQGRP-GQHQQPFGRPRQQEQQGNGNNVFSGFNTQ
           -E-----Q-Q--Q----GR--GQHQQ------Q-E----G--V-SGF---
Sequence 2 IEHPETMQQQQQQKSHGGRKQGQHQQ------QEEE---GGSVLSGFSKH

Sequence 1 LLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQP------------
           -LAQ--N-NE-TA--L----D-R-QI--V-G-L----P------------
Sequence 2 FLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDE

Sequence 1 -----------PR----GRQEREHEERQQEQL--------------QQER
           -----------PR----G--E----E---E----------------QQE-
Sequence 2 DEEYEQTPSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEP

Sequence 1 QQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLP
           ---G-Q---NG-EE--C---L-ENI--P-RAD---P-AGRISTLNS--LP
Sequence 2 RGRGCQTR-NGVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLP

Sequence 1 ILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDA
           -LR---LSA-----YRNGIYSPHWN-NA-SV-YV-RG--RV-VVN--G-A
Sequence 2 ALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNA

Sequence 1 ILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTS
           --D-E---GQL--VPQN--V--Q-G-QG-EY--FKT--NA----------
Sequence 2 VFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIK---D

Sequence 1 FLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAVV
           --RA-P-EVL-N-Y-----Q-RQLKY------------------
Sequence 2 VFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP--------



Alignment 33
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 36.91 (196/531)
Sequence 1 ----------------------ARQSQLSPQNQCQLNQLQAREPDNRIQA
           -----------------------R---L----QC---------P--RIQ-
Sequence 2 MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQS

Sequence 1 EAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGR
           E-G--E-W---Q--FQCAG--A-R-TI--NGL-LP-Y---P-L-YI--G-
Sequence 2 EGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQ

Sequence 1 GVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQ
           G-------GC-ET---------------------------------Q---
Sequence 2 GLISIMVPGCAETY--------------------------------QVHR

Sequence 1 QQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIRE
           -Q----R-----QQ--G----------------------D-HQK--R-R-
Sequence 2 SQRTMERTEASEQQDRGSVR-------------------DLHQKVHRLRQ

Sequence 1 GDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNP
           GD-VAIP-G-A-W-YNDG---LVAV----V----NQLDQ--R-FYLAG--
Sequence 2 GDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGV

Sequence 1 ENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQ
           -----------PR--GEQ----Q--Q-F-------------N-F--F---
Sequence 2 -----------PRS-GEQEQ--QARQTF------------HNIFRAFDAE

Sequence 1 LLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREHEER
           LL--A-NV--ET-R--Q-----R--I---R----FV-P-----E-EH--R
Sequence 2 LLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRPDEEEGEQEHRGR

Sequence 1 QQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRI
           Q-----------------NGLEETFC------N------ADIFS--AGR-
Sequence 2 Q---------------LDNGLEETFCTMKFRTNVESRREADIFSRQAGRV

Sequence 1 STLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARV
           -------LPIL----LSAE-G--Y-N---SP-W----H--VYV-RG-A-V
Sequence 2 HVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQV

Sequence 1 QVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAF
           QVV--NG-A-----V-QG--F-VPQ-------AGN-GFE--AFKT-----
Sequence 2 QVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPM

Sequence 1 INTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRR
           ---LAG-TS--RA-P--V--N-YQIS--QA--LK-NR-----L-S---RR
Sequence 2 RSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRR

Sequence 1 AVV
           ---
Sequence 2 S--



Alignment 34
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA27052
Sequence identity: 22.03 (117/531)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DQQLRDISPECHPVVVSPVAGQYEQQIVVPKGGSFYPGETTPPQQLQQRI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FWGIPALLKRYYPSVTSPQQVSYYPGQASPQRPGQGQQPGQGQQSGQGQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GYYPTSPQQPGQWQQPEQGQPGYYPTSPQQPGQLQQPAQGQQPGQGQQGR

Sequence 1 -----------------------------------ARQSQLSPQNQCQLN
           -------------------------------------Q-Q---Q-Q----
Sequence 2 QPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQGQQGQQPGQGQQPGQ

Sequence 1 QLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSY
           --Q---P----Q---GQ-------QG-----G--------Q--G---P-Y
Sequence 2 GQQGQQPGQGQQPGQGQ-QGQQLGQGQ---QGYYPT--SLQQSGQGQPGY

Sequence 1 --SNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQ
           ------QL-----G-G--G------P-------Q--Q-G-Q--Q----QQ
Sequence 2 YPTSLQQL-----GQGQSGYY----PTSPQQPGQGQQPG-QLQQPAQGQQ

Sequence 1 QQQGEQGRQQGQ-QEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRP----
           --QG-QG-Q-GQ-Q--QQ--QG-Q-G--Q--------QQ-GQ-G-P----
Sequence 2 PEQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQ-GQPGYYP

Sequence 1 ---QQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNL
           ---QQ--Q--Q----Q-------G-----P----------G-Q-------
Sequence 2 TSSQQPTQSQQPGQGQQGQQVGQGQQAQQPG--------QGQQPGQGQPG

Sequence 1 FHVSSDHNQLDQNPRKFYLAGNPENEFNQQ-GQSQPRQQGEQGR-PGQHQ
           ----S---Q--Q-----YL---------QQ-GQ-Q---QG--G--PGQ-Q
Sequence 2 YYPTSPL-QSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKGQQPGQGQ

Sequence 1 QPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQ
           QP-G---Q--Q-G-G-----G---Q---Q-------T-----GQ-----Q
Sequence 2 QP-GQGQQGQQPGQGQQ---G---QQPGQGQPGYYPTSPQQSGQGQQPGQ

Sequence 1 IIQV-RGNLDF-----VQPPRGRQEREHEERQQE-------QLQQERQ-Q
           --Q---G----------QP--G---------QQ--------QLQQ--Q-Q
Sequence 2 WQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQQPGQLQQPAQGQ

Sequence 1 QGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPIL
           QG-QL-A-G--------------------------------------P--
Sequence 2 QGQQL-AQGQQGQQPAQVQQGQQPAQGQQGQQLGQGQQGQQPGQGQQPAQ

Sequence 1 RFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAIL
           ---------G----------------------------------------
Sequence 2 GQQGQQPGQGQQGQQPGQGQQPGQGQPWYYPTSPQESGQGQQPGQWQQPG

Sequence 1 DQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFL
           ----------------------G-QG------------------------
Sequence 2 QWQQPGQGQPGYYLTSPLQLGQGQQGYYPTSLQQPGQGQQPGQWQQSGQG

Sequence 1 RALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAVV--------
           ---------------------L------------S-Q-------------
Sequence 2 QHGYYPTSPQLSGQGQRPGQWLQPGQGQQGYYPTSPQQSGQGQQLGQWLQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PGQGQQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKAQ

Sequence 1 ----------------------
           ----------------------
Sequence 2 QLAAQLPAMCRLEGGDALSASQ



Alignment 35
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: AAB02788
Sequence identity: 21.47 (114/531)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQEYYLTSPQQSGQWQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QPGQGQSGYYPTSPQQSGQKQPGYYPTSPWQPEQLQQPTQGQQRQQPGQG

Sequence 1 --------------------------------------------ARQSQL
           ----------------------------------------------Q-Q-
Sequence 2 QQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPERGQQGQQ

Sequence 1 SPQNQCQLNQ-LQAREPDNRIQAEAGQ-----IETWNFNQGDFQCAG-VA
           S-Q-Q-QL-Q--Q---P----Q---GQ-----I------QG-----G---
Sequence 2 SGQGQ-QLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSGQGQLG

Sequence 1 ASRITIQRNGL----HLPSYSNAP-QLIYIVQGRGVLGAVFSGCPETFEE
           ------Q--G-------P-----P-QL----Q----LG----------E-
Sequence 2 YYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQ-LGQ---------EQ

Sequence 1 SQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQ-------QQERQGR--
           --Q-S-QGRQ--Q---RQQ-QQ--QG-Q-GQ----------QQ--QG---
Sequence 2 QDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPR

Sequence 1 ------QQGRQQQEEGRQQEQQQGQQGR-PQQQQQFRQLDRHQKTRRIRE
           ------QQ--Q-Q-----Q---QGQQG--P-Q-QQ--Q------------
Sequence 2 YYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQQRQGEQGQQPGQ

Sequence 1 GDVVAIPAGVAYWSYNDGDQE--LVAVNLFHVSSDHNQLDQNPRKFYLAG
           G-----P-------Y----Q------------S-------Q-P------G
Sequence 2 GQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPG

Sequence 1 NPENEFNQQGQSQPRQQGEQGR-PGQHQQPFGRPRQQEQ-QGNGNNVFSG
           --E----Q-GQ-Q---QG--G--P---QQ--G---Q-EQ-Q--G------
Sequence 2 Q-EQQGQQPGQGQQPGQGQPGYYPTSPQQS-GQEQQLEQWQQSGQGQPGH

Sequence 1 FNTQLL--AQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQE
           --T--L---Q-------T-----GQ-----Q--Q--------QP--G-Q-
Sequence 2 YPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQQG

Sequence 1 REHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFS
           ----E-QQ-Q-----QQ-G-------------S-----------------
Sequence 2 QQPGEGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQGQP

Sequence 1 PRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVI
           ------S-------------------------------------------
Sequence 2 GYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTSPQ

Sequence 1 RGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFK
           ------Q-----------Q------------------Q------------
Sequence 2 QSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQGYY

Sequence 1 TEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALS
           -----------------------------Q-----------------A--
Sequence 2 PTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAASL

Sequence 1 SSQQRRAVV-------------------
           ----------------------------
Sequence 2 KVAKAQQLAAQLPAMCRLEGGDALLASQ



Alignment 36
Sequence 1:
Sequence 2: Allergen Tri a 26.0101, Sequence: P10388
Sequence identity: 21.28 (113/531)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SPQQPGQWEEPEQGQQGYYPTSPQQPGQLQQPAQGQQPGQGQQGQQPGQG

Sequence 1 ------------------------------ARQSQLSPQNQCQLNQLQAR
           ------------------------------A-Q-Q---Q-Q------Q--
Sequence 2 QPGYYPTSSQLQPGQLQQPAQGQQGQQPGQAQQGQQPGQGQQPGQGQQGQ

Sequence 1 EPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSY--SNA
           -P----Q---GQ-------QG-----G--------Q--G---P-Y-----
Sequence 2 QPGQGQQPGQGQ-QGQQLGQGQ---QGYYPT--SLQQSGQGQPGYYPTSL

Sequence 1 PQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGE
           -QL-----G-G--G------P-------Q--Q-G-Q--Q----QQ--QG-
Sequence 2 QQL-----GQGQSGYY----PTSPQQPGQGQQPG-QLQQPAQGQQPGQGQ

Sequence 1 QGRQQGQ-QEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRP-------QQ
           QG-Q-GQ-Q--QQ--QG-Q-G--Q--------QQ-GQ-G-P-------QQ
Sequence 2 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQ-GQPGYYPTSSQQ

Sequence 1 QQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSS
           --Q--Q----Q-------G-----P----------G-Q-----------S
Sequence 2 PTQSQQPGQGQQGQQVGQGQQAQQPG--------QGQQPGQGQPGYYPTS

Sequence 1 DHNQLDQNPRKFYLAGNPENEFNQQ-GQSQPRQQGEQGR-PGQHQQPFGR
           ---Q--Q-----YL---------QQ-GQ-Q---QG--G--PGQ-QQP-G-
Sequence 2 PQ-QSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKGQQPGQGQQP-GQ

Sequence 1 PRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQV-
           --Q--Q-G-G-----G---Q---Q-------T-----GQ-----Q--Q--
Sequence 2 GQQGQQPGQGQQ---G---QQPGQGQPGYYPTSPQQSGQGQQPGQWQQPG

Sequence 1 RGNLDF-----VQPPRGRQEREHEERQQE-------QLQQERQ-QQGEQL
           -G----------QP--G---------QQ--------QLQQ--Q-QQG-QL
Sequence 2 QGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQQPGQLQQPAQGQQGQQL

Sequence 1 MANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRL
           -A-G----------------------------------------------
Sequence 2 -AQGQQGQQPAQVQQGQQPAQGQQGQQLGQGQQGQQPGQGQQGQQPAQGQ

Sequence 1 SAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQ
           ----------G------------------G--------------------
Sequence 2 QGQQPGQGQHGQQPGQGQQGQQPGQGQQPGQGQPWYYPTSPQESGQGQQP

Sequence 1 QGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPD
           -----------G--------------------------------------
Sequence 2 GQWQQPGQGQPGYYLTFSVAARTGQQGYYPTSLQQPGQGQQPGQWQQSGQ

Sequence 1 EVLANAYQISREQARQLKYNRQETIALSSSQQRRAVV-------------
           --------------------------------------------------
Sequence 2 GQHWYYPTSPKLSGQGQRPGQWLQPGQGQQGYYPTSPQQPPQGQQLGQWL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKA

Sequence 1 -----------------------
           -----------------------
Sequence 2 QQLAAQLPAMCRLEGGDALSASQ



Alignment 37
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA31395
Sequence identity: 21.28 (113/531)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SPQQPGQWQQPEQGQQGYYPTSPQQPGQLQQPAQGQQPGQGQQGQQPGQG

Sequence 1 ------------------------------ARQSQLSPQNQCQLNQLQAR
           ------------------------------A-Q-Q---Q-Q------Q--
Sequence 2 QPGYYPTSSQLQPGQLQQPAQGQQGQQPGQAQQGQQPGQGQQPGQGQQGQ

Sequence 1 EPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSY--SNA
           -P----Q---GQ-------QG-----G--------Q--G---P-Y-----
Sequence 2 QPGQGQQPGQGQ-QGQQLGQGQ---QGYYPT--SLQQSGQGQPGYYPTSL

Sequence 1 PQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGE
           -QL-----G-G--G------P-------Q--Q-G-Q--Q----QQ--QG-
Sequence 2 QQL-----GQGQSGYY----PTSPQQPGQGQQPG-QLQQPAQGQQPGQGQ

Sequence 1 QGRQQGQ-QEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRP-------QQ
           QG-Q-GQ-Q--QQ--QG-Q-G--Q--------QQ-GQ-G-P-------QQ
Sequence 2 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQ-GQPGYYPTSSQQ

Sequence 1 QQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSS
           --Q--Q----Q-------G-----P----------G-Q-----------S
Sequence 2 PTQSQQPGQGQQGQQVGQGQQAQQPG--------QGQQPGQGQPGYYPTS

Sequence 1 DHNQLDQNPRKFYLAGNPENEFNQQ-GQSQPRQQGEQGR-PGQHQQPFGR
           ---Q--Q-----YL---------QQ-GQ-Q---QG--G--PGQ-QQP-G-
Sequence 2 PQ-QSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKGQQPGQGQQP-GQ

Sequence 1 PRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQV-
           --Q--Q-G-G-----G---Q---Q-------T-----GQ-----Q--Q--
Sequence 2 GQQGQQPGQGQQ---G---QQPGQGQPGYYPTSPQQSGQGQQPGQWQQPG

Sequence 1 RGNLDF-----VQPPRGRQEREHEERQQE-------QLQQERQ-QQGEQL
           -G----------QP--G---------QQ--------QLQQ--Q-QQG-QL
Sequence 2 QGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQQPGQLQQPAQGQQGQQL

Sequence 1 MANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRL
           -A-G----------------------------------------------
Sequence 2 -AQGQQGQQPAQVQQGQQPAQGQQGQQLGQGQQGQQPGQGQQGQQPAQGQ

Sequence 1 SAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQ
           ----------G------------------G--------------------
Sequence 2 QGQQPGQGQHGQQPGQGQQGQQPGQGQQPGQGQPWYYPTSPQESGQGQQP

Sequence 1 QGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPD
           -----------G--------------------------------------
Sequence 2 GQWQQPGQGQPGYYLTFSVAARTGQQGYYPTSLQQPGQGQQPGQWQQSGQ

Sequence 1 EVLANAYQISREQARQLKYNRQETIALSSSQQRRAVV-------------
           --------------------------------------------------
Sequence 2 GQHWYYPTSPKLSGQGQRPGQWLQPGQGQQGYYPTSPQQPPQGQQLGQWL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKA

Sequence 1 -----------------------
           -----------------------
Sequence 2 QQLAAQLPAMCRLEGGDALSASQ



Alignment 38
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA43331
Sequence identity: 21.09 (112/531)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER

Sequence 1 ARQSQLSPQNQCQLNQ-LQAREPDNRIQAEAGQIETWNFNQGDFQCAGVA
           --Q-Q-S-Q-Q-QL-Q--Q---P----Q---GQ-------QG--------
Sequence 2 GQQGQQSGQGQ-QLGQGQQGQQPGQKQQSGQGQ-------QGYYPISPQQ

Sequence 1 ASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSS
           ---------G--L--Y---PQ------G-G--G-------------QQS-
Sequence 2 LGQGQQSGQG-QLGYYPTSPQQ----SGQGQSG-YYPTSAQQPGQLQQST

Sequence 1 QQGRQQEQEQERQQQQQGEQGRQQGQQEQ-QQERQGRQQGRQQ-------
           Q---Q--QEQ--QQ--QG-QG-Q-GQ--Q-QQ--QG-Q-G--Q-------
Sequence 2 QE-QQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTS

Sequence 1 -QEEGRQQE-------QQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVA
           -Q--G--Q--------QQ-GQ---P-Q-QQ--Q----Q-------G----
Sequence 2 PQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPG

Sequence 1 I-PAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEF
           ----G--------G-Q-----------S--------P-------------
Sequence 2 QGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQL

Sequence 1 NQQGQSQPRQQGEQGR-PGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLA
           -Q--Q-Q---Q--QG--PGQ-QQ----P-Q--Q-G-G---------Q---
Sequence 2 QQPAQGQQPGQEQQGQQPGQGQQG-QQPGQGQQPGQGQPGYYPTSPQQSG

Sequence 1 QALNVNEETARNLQGQNDNR-NQIIQVRGNLDFVQPPRGRQEREHEERQQ
           Q-----E------QGQ---------Q---------P----Q-------Q-
Sequence 2 QEQQL-EQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQ--QP

Sequence 1 EQLQQERQ-QQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIS
           -QLQQ--Q-QQG-Q-------------------G---------P-----S
Sequence 2 GQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTS

Sequence 1 TLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQ
           ---S------------------Y---------------------------
Sequence 2 LQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGP

Sequence 1 VVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFI
           -----------Q------------------Q----G--------------
Sequence 2 QPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQ

Sequence 1 NTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRA
           --------------------------------------------S-Q---
Sequence 2 LGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSG

Sequence 1 VV-----------------------------------------------
           -------------------------------------------------
Sequence 2 QGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ



Alignment 39
Sequence 1:
Sequence 2: Allergen Coc n 1.0101, Sequence: A0A0S3B0K0
Sequence identity: 15.25 (81/531)
Sequence 1 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
           -----------------------------------S--------------
Sequence 2 ---------------------------------MVSAMGDRTASAILALL

Sequence 1 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ
           -------------Q--G--GR-----E-----------------------
Sequence 2 LLSSWSLMVVMAYQGRGMEGREKRVEEKAPRSPEDRGLFILRRSKEVLKT

Sequence 1 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL
           --G------------------------E-----IP---------------
Sequence 2 DAGEVRLMMGYRYRGNHSPMHIGFITMEPNTLYIPQYIDASLILFVRRGE

Sequence 1 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG
           --V----------------------------------S------------
Sequence 2 AKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTL

Sequence 1 QHQQPFGRPRQQEQQGNG---NNVFSGFNTQLLAQALNVNEETARNLQGQ
           ------G---Q----G-G-----V-SGF----L--A-NV-----------
Sequence 2 ESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFNVSSDQLEMIL--

Sequence 1 NDNRN-QIIQVRGNL----DFVQPPRGRQEREHEERQQEQLQQERQQQGE
           N--R---II---G------D---------ER---E------------Q-E
Sequence 2 NSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEE

Sequence 1 Q-------LMANGLEETFCSLRLKENIGN-PERADIFSPRA------GRI
           --------L----L----C----K------P----------------G--
Sequence 2 DDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYS

Sequence 1 STLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARV
           -----H----L----L-------------SPH-N--A-------RG----
Sequence 2 IAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTI

Sequence 1 QVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQG-FEYFAFKTE-EN
           QVV--NG-A-----V--G--F--P------Q-A------E-F-F-T----
Sequence 2 QVVFPNGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARK

Sequence 1 AFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQ
           -----L-G--S-L-------LA-A---S-EQ---------E---L--S--
Sequence 2 NRPQFLVGKSSLLHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTSPH

Sequence 1 RRAVV--------------------
           R------------------------
Sequence 2 REMEEINGKKWKGEEVLVMKRGLFA



Alignment 40
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA31396
Sequence identity: 20.90 (111/531)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFAAVVIALVALTTAEGEASRQLQCERELQESSLEACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LAGRLPWSTGLQMRCCQQLRDVSAKCRSVAVSQVARQYEQTVVPPKGGSF

Sequence 1 ---------------------------------ARQSQLSPQNQCQLNQL
           ----------------------------------RQ----P---------
Sequence 2 YPGETTPLQQLQQGIFWGTSSQTVQGYYPGVTSPRQGSYYPGQASPQQPG

Sequence 1 QAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSN
           Q---P------E-GQ---W-------Q--G-----I-----G---P----
Sequence 2 QGQQPGK--WQEPGQGQQWYYPTS-LQQPG-QGQQIGKGQQGYY-PTSLQ

Sequence 1 APQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ--QGRQQEQEQERQQQQ
           -P-------G-G--G------P-------Q--Q--QG-Q-EQ-Q---Q-Q
Sequence 2 QP-------GQGQQGYY----PTSLQHTGQRQQPVQGQQPEQGQQPGQWQ

Sequence 1 QG-----EQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQG----
           QG------Q---QGQQ--Q----G--QG-Q-------Q---QGQQG----
Sequence 2 QGYYPTSPQQLGQGQQPRQWQQSG--QGQQGHYPTSLQQPGQGQQGHYLA

Sequence 1 ---RPQQQQQFRQLDRHQKTRRIREGDVVAI---PAGVAYWSYNDGDQEL
           ----P-Q-QQ-------Q-------G---A----P-------Y----QE-
Sequence 2 SQQQPGQGQQGHYPASQQQPGQGQQGHYPASQQQPGQGQQGHYPASQQEP

Sequence 1 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQS----QPRQQGEQ
           -------------Q--Q-----Y-A--------QQG------Q---QG-Q
Sequence 2 GQGQQGQIPASQQQPGQGQQGHYPASLQQPGQGQQGHYPTSLQQLGQGQQ

Sequence 1 -GRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQ
           -G-PGQ-QQP-G---Q--Q-G-G---------Q---Q-------T-----
Sequence 2 TGQPGQKQQP-G---QGQQTGQGQQ---PEQEQQPGQGQQGYYPTSLQQP

Sequence 1 GQNDNRNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQ--ERQQQGEQ
           GQ-----Q--Q--------QP--G-Q-------QQ----Q---RQQ-G--
Sequence 2 GQGQQQGQGQQGYYPTSLQQPGQGQQGHYPASLQQPGQGQPGQRQQPGQG

Sequence 1 LMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLR
           --------------------------------G-----------------
Sequence 2 QHPEQGKQPGQGQQGYYPTSPQQPGQGQQLGQGQQGYYPTSPQQPGQGQQ

Sequence 1 LSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEV
           -----------------------------------Q-----------Q--
Sequence 2 PGQGQQGHCPTSPQQSGQAQQPGQGQQIGQVQQPGQGQQGYYPTSVQQPG

Sequence 1 QQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALP
           Q--Q-----Q-----Q----Q----------------------S---A--
Sequence 2 QGQQSGQGQQSGQGHQPGQGQQSGQEQQGYDSPYHVSAEQQAASPMVAKA

Sequence 1 DEVLANAYQISREQARQLKYNRQETIALSSSQQRRAVV
           -----------R----------Q---------------
Sequence 2 QQPATQLPTVCRMEGGDALSASQ---------------



Alignment 41
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA26847
Sequence identity: 19.59 (104/531)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFAAVVIALVALTTAEGEASRQLQCERELQESSLEACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LAGRLPWSTGLQMRCCQQLRDVSAKCRSVAVSQVARQYEQTVVPPKGGSF

Sequence 1 ---------------------------------ARQSQLSPQNQCQLNQL
           ----------------------------------RQ----P---------
Sequence 2 YPGETTPLQQLQQGIFWGTSSQTVQGYYPSVTSPRQGSYYPGQASPQQPG

Sequence 1 QAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSN
           Q---P----Q-E-GQ---W-------Q--G-----I-----G---P----
Sequence 2 QGQQP-GKWQ-EPGQGQQWYYPTS-LQQPG-QGQQIGKGKQGYY-PTSLQ

Sequence 1 APQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQG
           -P------QG----G----G-------S-Q---Q--Q--Q-Q---Q-QQ-
Sequence 2 QPG-----QGQQI-G---QGQQGYYPTSPQHTGQRQQPVQGQQIGQGQQP

Sequence 1 EQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQG-------RPQQ
           EQG-Q-GQ--Q-------QQ--Q-Q--G--Q---QGQQG--------P-Q
Sequence 2 EQGQQPGQWQQGYYPTSPQQLGQGQQPGQWQQSGQGQQGHYPTSLQQPGQ

Sequence 1 QQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSS
           -QQ---L---Q-------G-----PA---------G-Q--------H---
Sequence 2 GQQGHYLASQQQPAQGQQGHY---PA--SQQQPGQGQQG-------HYPA

Sequence 1 DHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPR
           ---Q--Q-----Y-A---E----QQGQ----QQ-----PGQ-QQ----P-
Sequence 2 SQQQPGQGQQGHYPASQQEPGQGQQGQIPASQQ----QPGQGQQGH-YPA

Sequence 1 QQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRGN
           ---Q-G-----------Q-L-Q-------------GQ-----Q--Q----
Sequence 2 SLQQPGQQGHYPTSL--QQLGQGQQIGQPGQKQQPGQGQQTGQGQQPEQE

Sequence 1 LDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKE
           ----QP--G-Q-------QQ---Q---Q-QG-Q-----------------
Sequence 2 Q---QPGQGQQGYYPTSLQQPG-QGQQQGQGQQGYYPTSLQQPGQGQQGH

Sequence 1 NIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPH
           ---------------G----------P-----------G-----------
Sequence 2 YPASLQQPGQGQGQPGQRQQPGQGQHPEQGQQPGQGQQGYYPTSPQQPGQ

Sequence 1 WNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQ
           -------------------------------------------------Q
Sequence 2 GQQLGQGQQGYYPTSPQQPGQGQQPGQGQQGHCPMSPQQTGQAQQLGQGQ

Sequence 1 AGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQ
           ---Q-------------------G--------------------------
Sequence 2 QIGQVQQPGQGQQGYYPTSLQQPGQGQQSGQGQQSGQGHQPGQGQQSGQE

Sequence 1 LKYNRQETIALSSSQQRRAVV--------------------------
           --------------Q-----V--------------------------
Sequence 2 KQGYDSPYHVSAEQQAASPMVAKAQQPATQLPTVCRMEGGDALSASQ



Alignment 42
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA43361
Sequence identity: 20.15 (107/531)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKRLVLFATVVITLVALTAAEGEASRQLQCERELQESSLEACRQVVDQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LAGRLPWSTGLQMRCCQQLRDVSAKCRPVAVSQVVRQYEQTVVPPKGGSF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YPGETTPLQQLQQVIFWGTSSQTVQGYYPSVSSPQQGPYYPGQASPQQPG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QGQQPGKWQELGQGQQGYYPTSLHQSGQGQQGYYPSSLQQPGQGQQIGQG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQGYYPTSLQQPGQGQQIGQGQQGYYPTSPQHPGQRQQPGQGQQIGQGQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LGQGRQIGQGQQSGQGQQGYYPTSPQQLGQGQQPGQWQQSGQGQQGYYPT

Sequence 1 -------ARQSQLSPQNQCQLNQ-LQAREPDNRIQAEAGQIETWNFNQ--
           ---------Q-Q--P--Q-Q--Q--Q---P----Q---GQ-------Q--
Sequence 2 SQQQPGQGQQGQY-PASQQQPGQGQQGQYPASQQQPGQGQQGQYPASQQQ

Sequence 1 -GDFQCAGVAASRITI-QRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGC
           -G--Q-----AS-----Q----H-P-----P-----------L-----G-
Sequence 2 PGQGQQGHYLASQQQPGQGQQRHYPASLQQPGQGQQGHYTASLQQPGQGQ

Sequence 1 PETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQ-QQERQGRQQ
           ------S-Q---QG-Q--Q---RQQ--QG-Q-RQ--Q-EQ-QQ--QG-QQ
Sequence 2 QGHYPASLQQVGQGQQIGQLGQRQQPGQGQQTRQGQQLEQGQQPGQG-QQ

Sequence 1 GRQQQEEGRQQEQQQGQQGR----PQQQQQFRQLDRHQKTRRIREGDVVA
           -RQ-Q-----Q---QGQQG-----PQQ--Q--Q----Q-------G----
Sequence 2 TRQGQQLEQGQQPGQGQQGYYPTSPQQSGQGQQPGQSQQPGQGQQGYYSS

Sequence 1 IPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFN
           ------------G-Q------L------H----Q-P------G-------
Sequence 2 -----SLQQPGQGLQGHYPASLQQPGQGHPGQRQQPGQ----GQQPEQGQ

Sequence 1 QQGQSQ-------PRQQGEQGRPGQHQQPF-----GRPRQQEQQGNGNNV
           Q-GQ-Q-------P-Q-G-----GQ-QQ---------P-Q--Q-G-G---
Sequence 2 QPGQGQQGYYPTSPQQPGQGKQLGQGQQGYYPTSPQQPGQGQQPGQGQQG

Sequence 1 FSGFNTQLLAQALNVNEETARNLQ-GQNDNRNQIIQVRGNLDFVQPPRGR
           ------Q---QA-----------Q-GQ-----Q--Q--------Q---G-
Sequence 2 HCPTSPQQTGQA----QQPGQGQQIGQVQQPGQGQQGYYPISLQQSGQGQ

Sequence 1 QEREHEER-QQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERAD
           Q--------Q--QL-Q--Q---EQ----G----------------P--A-
Sequence 2 QSGQGQQSGQGHQLGQGQQSGQEQ---QGYDNPY-HVNTEQQTASPKVAK

Sequence 1 IFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVV
           ---P---------------L------------------------------
Sequence 2 VQQPATQLPIMCRMEGGDALSASQ--------------------------

Sequence 1 YVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 AFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ALSSSQQRRAVV
           ------------
Sequence 2 ------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.