The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ant o 1.0101

Sequence Q7M1X6

Full FASTA alignment

Sequence name:
Query sequence:
IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ant o 1.0101Q7M1X6Go!3267.96.1e-15
2Dac g 1.0101Q7M1X8Go!3466.32.0e-14
3Poa p aCAA10520Go!26368.82.6e-14
4Hol l 1CAA10140Go!26368.82.6e-14
5Hol l 1.0102CAA93121Go!24867.56.4e-14
6Hol l 1P43216Go!26567.56.7e-14
7Lol p 1.0102AAA63278Go!25267.27.8e-14
8Lol p 1P14946Go!26367.28.1e-14
9Phl p 1P43213Go!26367.28.1e-14
10Lol p 1.0101AAA63279Go!26367.28.1e-14
11Lol p 1.0103CAB63699Go!26367.28.1e-14
12Pha a 1Q41260Go!26967.28.2e-14
13Phl p 1.0101CAA81613Go!26365.13.6e-13
14Ory s 1AAF72983Go!26757.85.7e-11
15Ory s 1AAF72991Go!26755.92.1e-10
16Pas n 1.0101ACA23876Go!26552.91.7e-09
17Zea m 1P58738Go!26952.12.9e-09
18Cyn d 1.0204AAF80379Go!24449.12.2e-08
19Cyn d 1.0201AAK96255Go!24449.12.2e-08
20Cyn d 1AAL14078Go!26249.12.3e-08
21Cyn d 1.0203AAL14079Go!26249.12.3e-08
22Cyn d 1.0202AAL14077Go!26249.12.3e-08
23Uro m 1.0101A0A4D6FZ45Go!26249.12.3e-08
24Ory s 1AAF72990Go!26948.34.1e-08
25Sor h 1.0101ABC58726Go!23946.99.5e-08
26Cyn d 1O04701Go!24644.55.3e-07
27Ory s 1Q40638Go!26342.42.5e-06
28Zoy m 1.0101QCX36431Go!27242.13.0e-06
29Uro m 1.0201A0A4D6G2J8Go!22938.04.5e-05
30Ory s 1AAF72987Go!27536.21.9e-04
31Ory s 1AAB61710Go!26133.41.2e-03
32Tri a ps93AAD10496Go!27132.91.8e-03
33Ory s 1AAF72988Go!32732.23.5e-03
34Ory s 1AAF72985Go!28631.35.7e-03
35Ory s 1AAF72984Go!26830.77.9e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ant o 1.0101, Sequence: Q7M1X6
Sequence identity: 100.00 (32/32)
Sequence 1 IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA
           IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA
Sequence 2 IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA



Alignment 2
Sequence 1:
Sequence 2: Allergen Dac g 1.0101, Sequence: Q7M1X8
Sequence identity: 96.88 (31/32)
Sequence 1 IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA--
           I-KVPPGPNITATYGDKWLDAKSTWYGKPTGA--
Sequence 2 IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGP



Alignment 3
Sequence 1:
Sequence 2: Allergen Poa p a, Sequence: CAA10520
Sequence identity: 100.00 (32/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTGA---------------------------------------------
           KPTGA---------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKLRSA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTAYASK



Alignment 4
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: CAA10140
Sequence identity: 100.00 (32/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTGA---------------------------------------------
           KPTGA---------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLRSA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTAYESK



Alignment 5
Sequence 1:
Sequence 2: Allergen Hol l 1.0102, Sequence: CAA93121
Sequence identity: 96.88 (31/32)
Sequence 1 --------IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA----------
           --------IAKVPPGPNITATYGD-WLDAKSTWYGKPTGA----------
Sequence 2 VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKES

Sequence 1 ------------------------------------------------
           ------------------------------------------------
Sequence 2 WGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK



Alignment 6
Sequence 1:
Sequence 2: Allergen Hol l 1, Sequence: P43216
Sequence identity: 96.88 (31/32)
Sequence 1 -------------------------IAKVPPGPNITATYGDKWLDAKSTW
           -------------------------IAKVPPGPNITATYGD-WLDAKSTW
Sequence 2 MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTW

Sequence 1 YGKPTGA-------------------------------------------
           YGKPTGA-------------------------------------------
Sequence 2 YGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAED

Sequence 1 ---------------
           ---------------
Sequence 2 VIPEGWKADTAYEAK



Alignment 7
Sequence 1:
Sequence 2: Allergen Lol p 1.0102, Sequence: AAA63278
Sequence identity: 96.88 (31/32)
Sequence 1 ------------IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA------
           ------------IAKVPPGPNITA-YGDKWLDAKSTWYGKPTGA------
Sequence 2 ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS

Sequence 1 --
           --
Sequence 2 AK



Alignment 8
Sequence 1:
Sequence 2: Allergen Lol p 1, Sequence: P14946
Sequence identity: 96.88 (31/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -----------------------IAKVPPGPNITA-YGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 KPTGA---------------------------------------------
           KPTGA---------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTSYSAK



Alignment 9
Sequence 1:
Sequence 2: Allergen Phl p 1, Sequence: P43213
Sequence identity: 96.88 (31/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -----------------------I-KVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTGA---------------------------------------------
           KPTGA---------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTSYESK



Alignment 10
Sequence 1:
Sequence 2: Allergen Lol p 1.0101, Sequence: AAA63279
Sequence identity: 96.88 (31/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -----------------------IAKVPPGPNITA-YGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 KPTGA---------------------------------------------
           KPTGA---------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTSYSAK



Alignment 11
Sequence 1:
Sequence 2: Allergen Lol p 1.0103, Sequence: CAB63699
Sequence identity: 96.88 (31/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -----------------------IAKVPPGPNITA-YGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYG

Sequence 1 KPTGA---------------------------------------------
           KPTGA---------------------------------------------
Sequence 2 KPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTSYSAK



Alignment 12
Sequence 1:
Sequence 2: Allergen Pha a 1, Sequence: Q41260
Sequence identity: 96.88 (31/32)
Sequence 1 -----------------------------IAKVPPGPNITATYGDKWLDA
           -----------------------------IAKVPPGPNITA-YGDKWLDA
Sequence 2 MMKMVCSSSSSSLLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDA

Sequence 1 KSTWYGKPTGA---------------------------------------
           KSTWYGKPTGA---------------------------------------
Sequence 2 KSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CFELKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKA

Sequence 1 -------------------
           -------------------
Sequence 2 EFEDVIPEGWKADTHDASK



Alignment 13
Sequence 1:
Sequence 2: Allergen Phl p 1.0101, Sequence: CAA81613
Sequence identity: 93.75 (30/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -----------------------I-KVPPGPNITATYGDKWLDAKSTWYG
Sequence 2 MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYG

Sequence 1 KPTGA---------------------------------------------
           KPT-A---------------------------------------------
Sequence 2 KPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVI

Sequence 1 -------------
           -------------
Sequence 2 PEGWKADTAYESK



Alignment 14
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72983
Sequence identity: 75.00 (24/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -------------------------KVPPGPNIT--YGDKWL-AK-TWYG
Sequence 2 MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYG

Sequence 1 KPTGA---------------------------------------------
           -P-GA---------------------------------------------
Sequence 2 APKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAI

Sequence 1 -----------------
           -----------------
Sequence 2 PDGWKADSVYKSNVQAK



Alignment 15
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72991
Sequence identity: 71.88 (23/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -------------------------KVPPGPNITA-YG--WL-A--TWYG
Sequence 2 MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYG

Sequence 1 KPTGA---------------------------------------------
           KP-GA---------------------------------------------
Sequence 2 KPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVI

Sequence 1 -----------------
           -----------------
Sequence 2 PDNWKANALYKSEIQVD



Alignment 16
Sequence 1:
Sequence 2: Allergen Pas n 1.0101, Sequence: ACA23876
Sequence identity: 68.75 (22/32)
Sequence 1 ------------------------IAKVPPGPNITATYGDKWLDAKSTWY
           --------------------------KVPPGPNIT--Y--KWL-AK-TWY
Sequence 2 MGSLAKIVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWY

Sequence 1 GKPTGA--------------------------------------------
           G-P-GA--------------------------------------------
Sequence 2 GQPNGAGPDDNGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CNKPECSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAMAKPGLNDKLRHY

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVLME

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LKEKSSDWKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQDVIP

Sequence 1 ---------------
           ---------------
Sequence 2 VNWKPDTVYNSNVQF



Alignment 17
Sequence 1:
Sequence 2: Allergen Zea m 1, Sequence: P58738
Sequence identity: 65.62 (21/32)
Sequence 1 -------------------------IAKVPPGPNITATYGDKWLDAKSTW
           ---------------------------KVPPGPNIT--Y--KWL-A--TW
Sequence 2 MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATW

Sequence 1 YGKPTGA-------------------------------------------
           YG-P-GA-------------------------------------------
Sequence 2 YGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKD

Sequence 1 -------------------
           -------------------
Sequence 2 VIPANWRPDAVYTSNVQFY



Alignment 18
Sequence 1:
Sequence 2: Allergen Cyn d 1.0204, Sequence: AAF80379
Sequence identity: 71.88 (23/32)
Sequence 1 IAKVPPGPNITATYGDKWLDAKSTWYGK-PTGA-----------------
           -----PGPNITATYGDKWLDAK-T-YG--P-GA-----------------
Sequence 2 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRM

Sequence 1 --------------------------------------------
           --------------------------------------------
Sequence 2 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF



Alignment 19
Sequence 1:
Sequence 2: Allergen Cyn d 1.0201, Sequence: AAK96255
Sequence identity: 71.88 (23/32)
Sequence 1 IAKVPPGPNITATYGDKWLDAKSTWYGK-PTGA-----------------
           -----PGPNITATYGDKWLDAK-T-YG--P-GA-----------------
Sequence 2 AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI

Sequence 1 --------------------------------------------
           --------------------------------------------
Sequence 2 DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF



Alignment 20
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: AAL14078
Sequence identity: 71.88 (23/32)
Sequence 1 ------------------IAKVPPGPNITATYGDKWLDAKSTWYGK-PTG
           -----------------------PGPNITATYGDKWLDAK-T-YG--P-G
Sequence 2 MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 A-------------------------------------------------
           A-------------------------------------------------
Sequence 2 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDW

Sequence 1 ------------
           ------------
Sequence 2 KPDTVYKSKIQF



Alignment 21
Sequence 1:
Sequence 2: Allergen Cyn d 1.0203, Sequence: AAL14079
Sequence identity: 71.88 (23/32)
Sequence 1 ------------------IAKVPPGPNITATYGDKWLDAKSTWYGK-PTG
           -----------------------PGPNITATYGDKWLDAK-T-YG--P-G
Sequence 2 MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 A-------------------------------------------------
           A-------------------------------------------------
Sequence 2 AAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDW

Sequence 1 ------------
           ------------
Sequence 2 KPDTVYKSKIQF



Alignment 22
Sequence 1:
Sequence 2: Allergen Cyn d 1.0202, Sequence: AAL14077
Sequence identity: 71.88 (23/32)
Sequence 1 ------------------IAKVPPGPNITATYGDKWLDAKSTWYGK-PTG
           -----------------------PGPNITATYGDKWLDAK-T-YG--P-G
Sequence 2 MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 A-------------------------------------------------
           A-------------------------------------------------
Sequence 2 AAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDW

Sequence 1 ------------
           ------------
Sequence 2 KPDTVYKSKIQF



Alignment 23
Sequence 1:
Sequence 2: Allergen Uro m 1.0101, Sequence: A0A4D6FZ45
Sequence identity: 71.88 (23/32)
Sequence 1 ------------------IAKVPPGPNITATYGDKWLDAKSTWYGK-PTG
           -----------------------PGPNITATYGDKWLDAK-T-YG--P-G
Sequence 2 MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRG

Sequence 1 A-------------------------------------------------
           A-------------------------------------------------
Sequence 2 AAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELM

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDW

Sequence 1 ------------
           ------------
Sequence 2 KPDTVYKSKIQF



Alignment 24
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72990
Sequence identity: 59.38 (19/32)
Sequence 1 -------------------------IAKVPPGPNITATYGDKWLDAKSTW
           ---------------------------KVPPGPNIT--Y---WL-A--TW
Sequence 2 MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATW

Sequence 1 YGKPTGA-------------------------------------------
           YG-P-G--------------------------------------------
Sequence 2 YGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKD

Sequence 1 -------------------
           -------------------
Sequence 2 VIPVNWMPDAIYVSNVQFY



Alignment 25
Sequence 1:
Sequence 2: Allergen Sor h 1.0101, Sequence: ABC58726
Sequence identity: 65.62 (21/32)
Sequence 1 IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA------------------
           --KV--G-NIT-TYG--WL--K-TWYGKPTGA------------------
Sequence 2 PPKVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FNSMGACGNLPIFKDGLCGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IAAYHFDLAGHAFGAMAKKGQEEKLAKAGIIDMKFRRVKCKYGEKVTFHV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EKGSNPNYLALLVKYVDGDGDIVGVDIKEKGGDAYQPLKHSWGAIWRKDS

Sequence 1 ---------------------------------------
           ---------------------------------------
Sequence 2 PDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK



Alignment 26
Sequence 1:
Sequence 2: Allergen Cyn d 1, Sequence: O04701
Sequence identity: 62.50 (20/32)
Sequence 1 IAKVPPGPNITATYGDKWLDAKSTWYGK-PTGA-----------------
           -----PGPNITATYG-KWL-A--T-YG--P-GA-----------------
Sequence 2 AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PFDGMTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRI

Sequence 1 ----------------------------------------------
           ----------------------------------------------
Sequence 2 DPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA



Alignment 27
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: Q40638
Sequence identity: 53.12 (17/32)
Sequence 1 -----------------------IAKVPPGPNITATYGDKWLDAKSTWYG
           -------------------------KVPPGPNIT--YGDKWL-A------
Sequence 2 MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMV

Sequence 1 KPTGA---------------------------------------------
           -P------------------------------------------------
Sequence 2 RPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAMAKDGKDEELRKAGII

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPDP

Sequence 1 -------------
           -------------
Sequence 2 GRRQRVQVNVQAK



Alignment 28
Sequence 1:
Sequence 2: Allergen Zoy m 1.0101, Sequence: QCX36431
Sequence identity: 59.38 (19/32)
Sequence 1 ----------------------------IAKVPPGPNITATYGDKWLDAK
           ---------------------------------PGPNITATY---W-DAK
Sequence 2 MASSSARRQAQLAAVAVLLSAMVGSALCEIGDKPGPNITATYNEEWQDAK

Sequence 1 STWYGK-PTGA---------------------------------------
           -T-YG--P-GA---------------------------------------
Sequence 2 ATFYGSNPRGAAPDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CFEIKCKEPAECSDKPVLIRITDKNYEHIAAYHFDLSGKAFGSMAKQGQE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKL

Sequence 1 ----------------------
           ----------------------
Sequence 2 VQEDVIPADWKPNTAYTSNLQY



Alignment 29
Sequence 1:
Sequence 2: Allergen Uro m 1.0201, Sequence: A0A4D6G2J8
Sequence identity: 46.88 (15/32)
Sequence 1 IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA------------------
           ----------------KWLDAK-TWYGKPTGA------------------
Sequence 2 --------------DGKWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FNSMGACGNPPIFKDGLGCGSCYEIKCDKPAECSGEPVIVHITDQNYEPI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRRVKCKYPANTKIAFH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAIWRID

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 SPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF



Alignment 30
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72987
Sequence identity: 46.88 (15/32)
Sequence 1 ------------------------IAKVPPGPNIT--ATYGDKWLDAKST
           ----------------------------P---N------YG--WL-A--T
Sequence 2 MAARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARAT

Sequence 1 WYGKPTGA------------------------------------------
           WYG-PTGA------------------------------------------
Sequence 2 WYGAPTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGK

Sequence 1 -------------------------
           -------------------------
Sequence 2 TLVANNVIPANWSPNSNYRSIVQFS



Alignment 31
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAB61710
Sequence identity: 40.62 (13/32)
Sequence 1 -------------IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA-----
           -------------------G------Y---WL-AK-TWYG-P-GA-----
Sequence 2 MAGASAKVVAMLLSVLATYGFAAGVVYTNDWLPAKATWYGQPNGAGPDDN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRA

Sequence 1 -----------
           -----------
Sequence 2 NTNYGSKVQFR



Alignment 32
Sequence 1:
Sequence 2: Allergen Tri a ps93, Sequence: AAD10496
Sequence identity: 40.62 (13/32)
Sequence 1 ----------------------IAKVPPGPNITATYGDKWLDAKSTWYGK
           -------------------------V---------Y---WL-AK-TWYG-
Sequence 2 MAGVSSNAIALVALLSMLFTSVRSAVNYDTAVARSYTSGWLPAKATWYGA

Sequence 1 PTGA----------------------------------------------
           P-GA----------------------------------------------
Sequence 2 PNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRLRH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AGIIDMQFRRVPCNFPGMKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRME

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVA

Sequence 1 ---------------------
           ---------------------
Sequence 2 NNAIPAYWQQDHAYWSNLQFY



Alignment 33
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72988
Sequence identity: 34.38 (11/32)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSS

Sequence 1 ------------------------IAKVPPGPNITATYGDKWLDAKSTWY
           --------------------------------------G--WL-A--TWY
Sequence 2 SNSSTPSIPPPVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWY

Sequence 1 GKPTGA--------------------------------------------
           G-P-GA--------------------------------------------
Sequence 2 GAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 AGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 GKTLIADQVIPADWQPNTVYSSIVQFD



Alignment 34
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72985
Sequence identity: 34.38 (11/32)
Sequence 1 -------------------------------------IAKVPPGPNITAT
           ------------------------------------------------A-
Sequence 2 MGSLSSLAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAV

Sequence 1 YGDKWLDAKSTWYGKPTGA-------------------------------
           Y---W--A--TWYG-P-GA-------------------------------
Sequence 2 YWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RLAKPGLNDKLRHSGIIDIEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRLDTNHRLQAP

Sequence 1 ------------------------------------
           ------------------------------------
Sequence 2 FSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS



Alignment 35
Sequence 1:
Sequence 2: Allergen Ory s 1, Sequence: AAF72984
Sequence identity: 50.00 (16/32)
Sequence 1 ----------------------IAKVPPGPNITA---TYGDKWLDAKSTW
           -----------------------A---PG-N--A---T----W--A--TW
Sequence 2 MAFSISKKAAVAALFSFLVVTCVAGARPG-NFSASDFTADPNWEVARATW

Sequence 1 YGKPTGA-------------------------------------------
           YG-PTGA-------------------------------------------
Sequence 2 YGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQV

Sequence 1 -------------------
           -------------------
Sequence 2 IPANWAPMAVYRSFVQYSS


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.