The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Art v 3.0101

Sequence P0C088

Full FASTA alignment

Sequence name:
Query sequence:
ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Art v 3.0101P0C088Go!3748.94.1e-09
2Art gm 3.0102ANC85023Go!11748.61.7e-08
3Art si 3.0101ANC85026Go!11648.41.9e-08
4Art v 3.0202ACE07187Go!11648.12.3e-08
5Art si 3.0102ANC85027Go!11648.12.3e-08
6Art ar 3.0102ANC85020Go!11648.12.3e-08
7Art ca 3.0102QIN55516Go!11748.12.3e-08
8Art gm 3.0101ANC85022Go!11747.63.2e-08
9Art la 3.0102ANC85025Go!11547.34.0e-08
10Art v 3.0301EU564847Go!11747.34.0e-08
11Art v 3.0201EU564845Go!11446.56.9e-08
12Art la 3.0101ANC85024Go!11646.56.9e-08
13Art ar 3.0101ANC85019Go!11646.56.9e-08
14Art ca 3.0101ANC85021Go!11744.72.6e-07
15Art an 3.0101ANC85017Go!11744.72.6e-07
16Art an 3.0102ANC85018Go!11743.17.6e-07
17Fra a 3.0101Q8VX12Go!11736.38.3e-05
18Fra a 3.0102Q4PLT9Go!11735.81.2e-04
19Fra a 3.0202Q4PLT6Go!11735.21.8e-04
20Fra a 3.0201Q4PLU0Go!11735.21.8e-04
21Mor n 3.0101P85894Go!9134.72.0e-04
22Rub i 3.0101Q0Z8V0Go!11734.62.8e-04
23Pyr c 3Q9M5X6Go!11533.65.3e-04
24Pru av 3Q9M5X8Go!11733.55.9e-04
25Pla or 3.0101ABY21307Go!11833.27.4e-04
26Cor a 8AAK28533Go!11532.71.0e-03
27Pru d 3P82534Go!9132.31.0e-03
28Pla a 3.0101CAL07989Go!11832.51.1e-03
29Mal d 3Q9M5X7Go!11532.11.6e-03
30Lup an 3.0101XP_019446786Go!11632.11.6e-03
31Can s 3.0101W0U0V5Go!9131.71.6e-03
32Pru ar 3P81651Go!9131.71.6e-03
33Hel a 3.0101P82007Go!11631.91.8e-03
34Pha v 3.0201ADC80503Go!11831.91.8e-03
35Pru p 3CAB96876Go!9131.51.8e-03
36Pru p 3P81402Go!9131.42.0e-03
37Ara h 17.0101A0A510A9S3Go!9331.22.2e-03
38Sola l 7.0101NP_001316123Go!11531.42.4e-03
39Api g 2ACV04796Go!11831.42.4e-03
40Ara h 9.0101ABX56711Go!11631.03.4e-03
41Pha v 3.0101ADC80502Go!11530.83.8e-03
42Hev b 12AAL25839Go!11630.64.2e-03
43Pun g 1.0101A0A059STC4Go!12029.78.2e-03
44Hor v 1AAA32970Go!11729.69.0e-03
45Zea m 14.0101P19656-1Go!12029.69.1e-03
46Ara h 9.0201ABX75045Go!9229.29.2e-03
47Zea m 14.0102P19656-2Go!12829.69.3e-03
48Hor v 1CAA42832Go!13429.79.5e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 100.00 (37/37)
Sequence 1 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND
           ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND
Sequence 2 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND



Alignment 2
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 94.59 (35/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------ALTCSDVSNKISPCLS-LKQGGEVP
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           ADCC-GVKGLND--------------------------------------
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VNIPYKISLETDCNKVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 94.59 (35/37)
Sequence 1 ------------------------ALTCSDVSNKISPCLSYLKQGGEVPA
           ------------------------ALTCSDVSNKISPCL-YLKQGGEVPA
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPA

Sequence 1 DCCAGVKGLND---------------------------------------
           -CCAGVKGLND---------------------------------------
Sequence 2 NCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 TIPYKLSMETDCNKVK



Alignment 4
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 91.89 (34/37)
Sequence 1 ------------------------ALTCSDVSNKISPCLSYLKQGGEVPA
           ------------------------ALTCSDVSNKI-PCL-YLKQGGEVPA
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 DCCAGVKGLND---------------------------------------
           DCC-GVKGLND---------------------------------------
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NIPYKISLETDCNKVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 91.89 (34/37)
Sequence 1 ------------------------ALTCSDVSNKISPCLSYLKQGGEVPA
           ------------------------ALTCSDVSNKI-PCL-YLKQGGEVPA
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 DCCAGVKGLND---------------------------------------
           DCC-GVKGLND---------------------------------------
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NIPYKISLETDCNKVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 91.89 (34/37)
Sequence 1 ------------------------ALTCSDVSNKISPCLSYLKQGGEVPA
           ------------------------ALTCSDVSNKI-PCL-YLKQGGEVPA
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 DCCAGVKGLND---------------------------------------
           DCC-GVKGLND---------------------------------------
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NIPYKISLETDCNKVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 91.89 (34/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------ALTCSDVSNKI-PCLS-LKQGGEVP
Sequence 2 MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           ADCC-GVKGLND--------------------------------------
Sequence 2 ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VNIPYKISLETDCNTVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 91.89 (34/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------ALTCSDVSNKISPC-S-LKQGGEVP
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           ADCC-GVKGLND--------------------------------------
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VNIPYKISLETDCNKVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 91.89 (34/37)
Sequence 1 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD
           -----------------------ALTCSDVS-KISPCLSYLK-GGEVPAD
Sequence 2 MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPAD

Sequence 1 CCAGVKGLND----------------------------------------
           CC-GVKGLND----------------------------------------
Sequence 2 CCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLN

Sequence 1 ---------------
           ---------------
Sequence 2 LPYKLSLETDCNKVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 91.89 (34/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------ALTCSDVS-KISPCLSYLK-GGEVP
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           ADCC-GVKGLND--------------------------------------
Sequence 2 ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCG

Sequence 1 -----------------
           -----------------
Sequence 2 LNLPYKLSLETDCNKVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 91.89 (34/37)
Sequence 1 ----------------------ALTCSDVSNKISPCLSYLKQGGEVPADC
           ----------------------AL-CSDVSNKIS-CLSYLKQGGEVPADC
Sequence 2 MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADC

Sequence 1 CAGVKGLND-----------------------------------------
           C-GVKGLND-----------------------------------------
Sequence 2 CTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNI

Sequence 1 --------------
           --------------
Sequence 2 PYKISLETDCNKVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 91.89 (34/37)
Sequence 1 ------------------------ALTCSDVSNKISPCLSYLKQGGEVPA
           ------------------------AL-CSDVSNKIS-CLSYLKQGGEVPA
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 DCCAGVKGLND---------------------------------------
           DCC-GVKGLND---------------------------------------
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NIPYKISLETDCNKVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 91.89 (34/37)
Sequence 1 ------------------------ALTCSDVSNKISPCLSYLKQGGEVPA
           ------------------------AL-CSDVSNKIS-CLSYLKQGGEVPA
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 DCCAGVKGLND---------------------------------------
           DCC-GVKGLND---------------------------------------
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NIPYKISLETDCNKVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 86.49 (32/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------ALTCSDVSNKI-PC-S-LKQGGEV-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 ADCCAGVKGLND--------------------------------------
           ADCC-GVKGLND--------------------------------------
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VNIPYKISLETDCNKVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 86.49 (32/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------ALTCSDVSNKI-PC-S-LKQGGEV-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 ADCCAGVKGLND--------------------------------------
           ADCC-GVKGLND--------------------------------------
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VNIPYKISLETDCNKVK



Alignment 16
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 75.68 (28/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------ALTC-DV--KISPC-S-L--GGEVP
Sequence 2 MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           -DCC-GVKGLND--------------------------------------
Sequence 2 VDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VNIPYKISLETDCNKVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 56.76 (21/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------A-TC--V---ISPCL-Y-K-GG-VP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           A-CC-G---LN---------------------------------------
Sequence 2 AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 54.05 (20/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------A-TC--V---ISPC--Y-K-GG-VP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           A-CC-G---LN---------------------------------------
Sequence 2 APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 54.05 (20/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------A-TC--V---ISPC--Y-K-GG-VP
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           A-CC-G---LN---------------------------------------
Sequence 2 AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VNVPYKISTSTNCAAVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 54.05 (20/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------A-TC--V---ISPC--Y-K-GG-VP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           A-CC-G---LN---------------------------------------
Sequence 2 AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VSVPYKISTSTNCAAVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 51.35 (19/37)
Sequence 1 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------
           --TC--VS----PC--YL--GG-VPA-CC-GV--LN--------------
Sequence 2 -ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACN

Sequence 1 ------------------------------------------
           ------------------------------------------
Sequence 2 CLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK



Alignment 22
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 51.35 (19/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------A-TC--V-----PC--Y-K-GG-VP
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           A-CC-GV--LN---------------------------------------
Sequence 2 AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VSVPYKISTSTNCATVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 48.65 (18/37)
Sequence 1 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD
           -----------------------A-TCS-VS----PC--Y---GG-VP--
Sequence 2 MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVPPA

Sequence 1 CCAGVKGLND----------------------------------------
           CC-G-K--N-----------------------------------------
Sequence 2 CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVN

Sequence 1 ---------------
           ---------------
Sequence 2 VPYKISTSTNCATVK



Alignment 24
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 45.95 (17/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------ALTC--VS----PC--Y---GG-VP
Sequence 2 MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           --CC-G----N---------------------------------------
Sequence 2 PACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCG

Sequence 1 -----------------
           -----------------
Sequence 2 VNVPYKISPSTNCATVK



Alignment 25
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 51.35 (19/37)
Sequence 1 --------------------------ALTCSDVSNKISPCLSYLKQGGEV
           --------------------------A-TC--V-----PCL-YL--GG-V
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 PADCCAGVKGLND-------------------------------------
           ---CC-GVK-LN--------------------------------------
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 ------------------
           ------------------
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 45.95 (17/37)
Sequence 1 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD
           ------------------------LTC--------PC--YLK-GG--P--
Sequence 2 MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS

Sequence 1 CCAGVKGLND----------------------------------------
           CC-GV---ND----------------------------------------
Sequence 2 CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVN

Sequence 1 ---------------
           ---------------
Sequence 2 IPYKISPSTNCNNVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 43.24 (16/37)
Sequence 1 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------
           --TC--VS----PC--Y-K-GG-VP--CC-G----N--------------
Sequence 2 -ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACN

Sequence 1 ------------------------------------------
           ------------------------------------------
Sequence 2 CLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK



Alignment 28
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 48.65 (18/37)
Sequence 1 --------------------------ALTCSDVSNKISPCLSYLKQGGEV
           --------------------------A-TC--V-----PCL--L--GG-V
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 PADCCAGVKGLND-------------------------------------
           ---CC-GVK-LN--------------------------------------
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 ------------------
           ------------------
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 40.54 (15/37)
Sequence 1 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD
           -----------------------A-TC--V-----PC--Y---GG-VP--
Sequence 2 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA

Sequence 1 CCAGVKGLND----------------------------------------
           CC-G----N-----------------------------------------
Sequence 2 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN

Sequence 1 ---------------
           ---------------
Sequence 2 VPYKISTSTNCATVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 45.95 (17/37)
Sequence 1 ------------------------ALTCSDVSNKISPCLSYLKQGGEVPA
           ------------------------A-TC--V------CL-YL--GG-VPA
Sequence 2 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA

Sequence 1 DCCAGVKGLND---------------------------------------
           -CC-G-K-------------------------------------------
Sequence 2 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NIPYKISTSTNCASIK



Alignment 31
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 48.65 (18/37)
Sequence 1 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------
           --TC--V-----PCLSYLK-GG-VP--CC---K-L---------------
Sequence 2 -ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACK

Sequence 1 ------------------------------------------
           ------------------------------------------
Sequence 2 CLKSAASSIKGVNFNLASGLPGKCGVSIPYKISPSTDCSSVK



Alignment 32
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 40.54 (15/37)
Sequence 1 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------
           --TC--VS----PC--Y---GG-VP--CC-G----N--------------
Sequence 2 -ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACN

Sequence 1 ------------------------------------------
           ------------------------------------------
Sequence 2 CLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK



Alignment 33
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 48.65 (18/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------A-TC-DV-----PCL-YL--GG---
Sequence 2 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT

Sequence 1 ADCCAGVKGLND--------------------------------------
           --CCAG-K-L----------------------------------------
Sequence 2 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCGI

Sequence 1 ----------------
           ----------------
Sequence 2 STSIPINPNVNCNTIP



Alignment 34
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 43.24 (16/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------A--C--V------C---L--GG-VP
Sequence 2 MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP

Sequence 1 ADCCAGVKGLND--------------------------------------
           A-CC-GV--LN---------------------------------------
Sequence 2 ASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCG

Sequence 1 ------------------
           ------------------
Sequence 2 VSIPYKISTSTNCATIKF



Alignment 35
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 40.54 (15/37)
Sequence 1 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------
           --TC--VS----PC--Y---GG-VP--CC-G----N--------------
Sequence 2 -ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACN

Sequence 1 ------------------------------------------
           ------------------------------------------
Sequence 2 CLKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK



Alignment 36
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 40.54 (15/37)
Sequence 1 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------
           --TC--VS----PC--Y---GG-VP--CC-G----N--------------
Sequence 2 -ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACN

Sequence 1 ------------------------------------------
           ------------------------------------------
Sequence 2 CLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK



Alignment 37
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 45.95 (17/37)
Sequence 1 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------
           A--CS-V---I-PC--YLK-GG-V---CC-G----N--------------
Sequence 2 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK



Alignment 38
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 48.65 (18/37)
Sequence 1 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD
           -----------------------A-TC--V-----PC---L-QGGE--A-
Sequence 2 MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAA

Sequence 1 CCAGVKGLND----------------------------------------
           CC-GV--LN-----------------------------------------
Sequence 2 CCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGIS

Sequence 1 ---------------
           ---------------
Sequence 2 LTVPISRTVNCDTIS



Alignment 39
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 54.05 (20/37)
Sequence 1 --------------------------ALTCSDVSNKISPCLSYLKQGGEV
           ---------------------------LTC--V--K---CL-YLK-GG--
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP

Sequence 1 PADCCAGVKGLND-------------------------------------
           ---CC-GVKGLN--------------------------------------
Sequence 2 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC

Sequence 1 ------------------
           ------------------
Sequence 2 GIRIPYPISPSTDCSRVN



Alignment 40
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 40.54 (15/37)
Sequence 1 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD
           -----------------------A--C--V-----PC---L--GG--P--
Sequence 2 MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPA

Sequence 1 CCAGVKGLND----------------------------------------
           CC-GV-GL------------------------------------------
Sequence 2 CCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVS

Sequence 1 ----------------
           ----------------
Sequence 2 IPYKISTSTNCATIKF



Alignment 41
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 40.54 (15/37)
Sequence 1 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD
           -------------------------TC--V-----PC---L--GG-VPA-
Sequence 2 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG

Sequence 1 CCAGVKGLND----------------------------------------
           CC-GV---------------------------------------------
Sequence 2 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN

Sequence 1 ---------------
           ---------------
Sequence 2 IPYKISTSTNCASIN



Alignment 42
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 51.35 (19/37)
Sequence 1 -----------------------ALTCSDVSNKISPCLSYLKQGGEVP-A
           -----------------------A-TC--V-----PCLSYLK--G--P-A
Sequence 2 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA

Sequence 1 DCCAGVKGLND---------------------------------------
           -CC-GV---N----------------------------------------
Sequence 2 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV

Sequence 1 ----------------
           ----------------
Sequence 2 NIPYKISLSTNCATVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 43.24 (16/37)
Sequence 1 ---------------------------ALTCSDVSNKISPCLSYLKQ-GG
           ---------------------------A-TC--V-----PC--Y----GG
Sequence 2 MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGG

Sequence 1 EVPADCCAGVKGLND-----------------------------------
           -VP--CC-G-K-L-------------------------------------
Sequence 2 AVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLPA

Sequence 1 --------------------
           --------------------
Sequence 2 KCGVNIPYKISPSTDCARVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 48.65 (18/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------AL-C--V--K--PCL-Y--QGG--P
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYV-QGGPGP

Sequence 1 A-DCCAGVKGLND-------------------------------------
           ---CC-GV--L---------------------------------------
Sequence 2 SGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKC

Sequence 1 ------------------
           ------------------
Sequence 2 NVNVPYTISPDIDCSRIY



Alignment 45
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 45.95 (17/37)
Sequence 1 ---------------------------ALTCSDVSNKISPCLSYLKQGGE
           ---------------------------A--C--V---I-PC-SY----G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VP-ADCCAGVKGLND-----------------------------------
           -P-A-CC-GV--LN------------------------------------
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 --------------------
           --------------------
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 46
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 37.84 (14/37)
Sequence 1 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------
           -L-C--V-----PC---L--GG-----CC-GV-GL---------------
Sequence 2 -LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACN

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 CLKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF



Alignment 47
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 45.95 (17/37)
Sequence 1 ---------------------------ALTCSDVSNKISPCLSYLKQGGE
           ---------------------------A--C--V---I-PC-SY----G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VP-ADCCAGVKGLND-----------------------------------
           -P-A-CC-GV--LN------------------------------------
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 ----------------------------
           ----------------------------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 48
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 48.65 (18/37)
Sequence 1 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP
           -------------------------AL-C--V--K--PCL-Y--QGG--P
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYV-QGGPGP

Sequence 1 A-DCCAGVKGLND-------------------------------------
           ---CC-GV--L---------------------------------------
Sequence 2 SGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKC

Sequence 1 -----------------------------------
           -----------------------------------
Sequence 2 NVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.