The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Der p 1.0124

Sequence 256095986

Full FASTA alignment

Sequence name:
Query sequence:
RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
IL

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Der p 1.0124CAQ68250Go!302482.39.5e-138
2Der p 1P08176Go!320479.85.8e-137
3Der p 1.0113ABA39435Go!302479.66.5e-137
4Eur m 1.0101P25780Go!321415.41.4e-117
5Eur m 1.0101AAC82351Go!321415.41.4e-117
6Eur m 1.0102AAC82352Go!321414.72.3e-117
7Der f 1.01022428875Go!303410.92.9e-116
8Der f 1.0101BAC53948Go!321409.49.4e-116
9Der f 1.01072428875Go!303409.11.1e-115
10Der f 1.0109ABL84750Go!321408.22.1e-115
11Der f 1.0108ABL84749Go!321408.22.1e-115
12Der f 1.0110ABL84751Go!321408.02.5e-115
13Der f 1.01052428875Go!303407.23.9e-115
14Der f 1.01032428875Go!303407.23.9e-115
15Der f 1P16311Go!321407.04.7e-115
16Der f 1.01042428875Go!303404.03.7e-114
17Der p 1.01186771329Go!222361.91.3e-101
18Der p 1.01156771329Go!222361.91.3e-101
19Der p 1.01176771329Go!222361.91.3e-101
20Der p 1.01226771329Go!222361.71.5e-101
21Der p 1.01206771329Go!222361.71.5e-101
22Der p 1.01146771329Go!222361.41.7e-101
23Der p 1.01236771329Go!222361.02.4e-101
24Der p 1.01166771329Go!222360.33.9e-101
25Der p 1.01196771329Go!222359.85.3e-101
26Der p 1.01216771329Go!222358.41.4e-100
27Eur m 1.0101CAA42677Go!211300.05.2e-83
28Der f 1CAA46316Go!212292.11.2e-80
29Der p 1AAA28296Go!96156.43.9e-40
30Blo t 1.0201AAQ24541Go!333134.94.0e-33
31Blo t 1.0101AAK58415Go!221120.84.6e-29
32Cari p 2.0101P14080Go!352119.42.0e-28
33Act d 1P00785Go!380117.67.5e-28
34Act d 1AAA32629Go!380116.41.7e-27
35Ana c 2BAA21849Go!351114.17.9e-27
36Amb a 11.0101V5LU01Go!386108.64.0e-25
37Car p papainAAB02650Go!345104.65.6e-24
38Gly m 1AAB09252Go!379101.84.1e-23
39Gly m 1P22895Go!379101.64.9e-23
40Tyr p 1.0101ABM53753Go!33664.27.7e-12
41Der m 1P16312Go!3040.78.3e-06

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Der p 1.0124, Sequence: CAQ68250
Sequence identity: 100.00 (302/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
Sequence 2 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
Sequence 2 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 2
Sequence 1:
Sequence 2: Allergen Der p 1, Sequence: P08176
Sequence identity: 99.34 (300/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
Sequence 2 MKIVLAIASLLALSAVYARPSSIKTFEEYKKAFNKSYATFEDEEAARKNF

Sequence 1 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
           LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
Sequence 2 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN

Sequence 1 ACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN
           ACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN
Sequence 2 ACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN

Sequence 1 QSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQS
           QSLDLAEQELVDCASQHGC-GDTIPRGIEYIQHNGVVQESYYRYVAREQS
Sequence 2 QSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQS

Sequence 1 CRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRH
           CRRPNAQRFGISNYCQIYPPN-NKIREALAQTHSAIAVIIGIKDLDAFRH
Sequence 2 CRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRH

Sequence 1 YDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYG
           YDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYG
Sequence 2 YDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYG

Sequence 1 YFAANIDLMMIEEYPYVVIL
           YFAANIDLMMIEEYPYVVIL
Sequence 2 YFAANIDLMMIEEYPYVVIL



Alignment 3
Sequence 1:
Sequence 2: Allergen Der p 1.0113, Sequence: ABA39435
Sequence identity: 99.34 (300/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           RPSSIK-FEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
Sequence 2 RPSSIKPFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
Sequence 2 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 4
Sequence 1:
Sequence 2: Allergen Eur m 1.0101, Sequence: P25780
Sequence identity: 84.11 (254/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNF
Sequence 2 MKIILAIASLLVLSAVYARPASIKTFEEFKKAFNKTYATPEKEEVARKNF

Sequence 1 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
           LES-KYV-SN-GAINHLSDLSLDEFKN-FLM-A-AFE-LKTQFDLNAET-
Sequence 2 LESLKYVESNKGAINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETY

Sequence 1 ACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
           ACSIN----P-E-DLR--RTVTPIRMQGGCGSCWAFSGVA-TESAYLAYR
Sequence 2 ACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYR

Sequence 1 NQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQ
           N-SLDLAEQELVDCASQ-GC-GDTIPRGIEYIQ-NGVVQE-YY-YVAREQ
Sequence 2 NMSLDLAEQELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQ

Sequence 1 SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFR
           SC-RPNAQR-G--NYCQI-PP--NKIR-AL-QTH-A-AVIIGIKDL-AFR
Sequence 2 SCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFR

Sequence 1 HYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY
           HYDGRTI-Q-DNGYQPNYHAVNIVGY-N-QGVDYWIVRNSWDT-WGDNGY
Sequence 2 HYDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGY

Sequence 1 GYFAANIDLMMIEEYPYVVIL
           GYFAANI-LMMIE-YPYVV-L
Sequence 2 GYFAANINLMMIEQYPYVVML



Alignment 5
Sequence 1:
Sequence 2: Allergen Eur m 1.0101, Sequence: AAC82351
Sequence identity: 84.11 (254/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNF
Sequence 2 MKIILAIASLLVLSAVYARPASIKTFEEFKKAFNKTYATPEKEEVARKNF

Sequence 1 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
           LES-KYV-SN-GAINHLSDLSLDEFKN-FLM-A-AFE-LKTQFDLNAET-
Sequence 2 LESLKYVESNKGAINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETY

Sequence 1 ACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
           ACSIN----P-E-DLR--RTVTPIRMQGGCGSCWAFSGVA-TESAYLAYR
Sequence 2 ACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYR

Sequence 1 NQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQ
           N-SLDLAEQELVDCASQ-GC-GDTIPRGIEYIQ-NGVVQE-YY-YVAREQ
Sequence 2 NMSLDLAEQELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQ

Sequence 1 SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFR
           SC-RPNAQR-G--NYCQI-PP--NKIR-AL-QTH-A-AVIIGIKDL-AFR
Sequence 2 SCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFR

Sequence 1 HYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY
           HYDGRTI-Q-DNGYQPNYHAVNIVGY-N-QGVDYWIVRNSWDT-WGDNGY
Sequence 2 HYDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGY

Sequence 1 GYFAANIDLMMIEEYPYVVIL
           GYFAANI-LMMIE-YPYVV-L
Sequence 2 GYFAANINLMMIEQYPYVVML



Alignment 6
Sequence 1:
Sequence 2: Allergen Eur m 1.0102, Sequence: AAC82352
Sequence identity: 84.44 (255/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------RP-SIKTFEE-KKAFNKSYAT-E-EE-ARKNF
Sequence 2 MKIILAIASLLVLSAVYARPASIKTFEEFKKAFNKSYATPEKEEVARKNF

Sequence 1 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
           LES-KYV-SN-GAINHLSDLSLDEFKN-FLM-A-AFE-LKTQFDLNAET-
Sequence 2 LESLKYVESNKGAINHLSDLSLDEFKNQFLMNANAFEQLKTQFDLNAETY

Sequence 1 ACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
           ACSIN----P-E-DLR--RTVTPIR-QGGCGSCWAFSGVA-TESAYLAYR
Sequence 2 ACSINSVSLPSELDLRSLRTVTPIRNQGGCGSCWAFSGVASTESAYLAYR

Sequence 1 NQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQ
           N-SLDLAEQELVDCASQ-GC-GDTIPRGIEYIQ-NGVVQE-YY-YVAREQ
Sequence 2 NMSLDLAEQELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQ

Sequence 1 SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFR
           SC-RPNAQR-G--NYCQI-PP--NKIR-AL-QTH-A-AVIIGIKDL-AFR
Sequence 2 SCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFR

Sequence 1 HYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY
           HYDGRTI-Q-DNGYQPNYHAVNIVGY-N-QGVDYWIVRNSWDT-WGDNGY
Sequence 2 HYDGRTIMQHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGY

Sequence 1 GYFAANIDLMMIEEYPYVVIL
           GYFAANI-LMMIE-YPYVVIL
Sequence 2 GYFAANINLMMIEQYPYVVIL



Alignment 7
Sequence 1:
Sequence 2: Allergen Der f 1.0102, Sequence: 2428875
Sequence identity: 83.11 (251/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNFLES-KYV--N-GAINHLS
Sequence 2 RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLS

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQM
           DLSLDEFKNR-LMSAEAFE-LKTQFDLNAET-AC-IN--N-P-E-DLR--
Sequence 2 DLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSL

Sequence 1 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQH
           RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN-SLDL-EQELVDCASQH
Sequence 2 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQH

Sequence 1 GCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI
           GC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ-CRRPN-Q--GISNYCQI
Sequence 2 GCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI

Sequence 1 YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY
           YPP----IREAL-QTH-AIAVIIGIKDL-AF-HYDGRTIIQRDNGYQPNY
Sequence 2 YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQRDNGYQPNY

Sequence 1 HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV
           HAVNIVGY---QGVDYWIVRNSWDT-WGD-GYGYF-A---LMMIE-YPYV
Sequence 2 HAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV

Sequence 1 VIL
           VI-
Sequence 2 VIM



Alignment 8
Sequence 1:
Sequence 2: Allergen Der f 1.0101, Sequence: BAC53948
Sequence identity: 82.78 (250/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNF
Sequence 2 MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNF

Sequence 1 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
           LES-KYV--N-GAINHLSDLSLDEFKNR-LMSAEAFE-LKTQFDLNAET-
Sequence 2 LESLKYVEANKGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETS

Sequence 1 ACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
           AC-IN--N-P-E-DLR--RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
Sequence 2 ACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR

Sequence 1 NQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQ
           N-SLDL-EQELVDCASQHGC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ
Sequence 2 NTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQ

Sequence 1 SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFR
           -CRRPN-Q--GISNYCQIYPP----IREAL-QTH-AIAVIIGIKDL-AF-
Sequence 2 QCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQ

Sequence 1 HYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY
           HYDGRTIIQ-DNGYQPNYHAVNIVGY---QGVDYWIVRNSWDT-WGD-GY
Sequence 2 HYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY

Sequence 1 GYFAANIDLMMIEEYPYVVIL
           GYF-A---LMMIE-YPYVVI-
Sequence 2 GYFQAGNNLMMIEQYPYVVIM



Alignment 9
Sequence 1:
Sequence 2: Allergen Der f 1.0107, Sequence: 2428875
Sequence identity: 82.78 (250/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNFLES-KYV--N-GAINHLS
Sequence 2 RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLS

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQM
           DLSLDEFKNR-LMSAEAFE-LKTQFDLNAET-AC-IN--N-P-E-DLR--
Sequence 2 DLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSL

Sequence 1 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQH
           RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN-SLDL-EQELVDCASQH
Sequence 2 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQH

Sequence 1 GCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI
           GC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ-CRRPN-Q--GISNYCQI
Sequence 2 GCHGDTIPRGIEYIQQNGVVEERSYPYVAREQRCRRPNSQHYGISNYCQI

Sequence 1 YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY
           YPP----IREAL-QTH-AIAVIIGIKDL-AF-HYDGRTIIQ-DNGYQPNY
Sequence 2 YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNY

Sequence 1 HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV
           HAVNIVGY---QGVDYWIVRNSWDT-WGD-GYGYF-A---LMMIE-YPYV
Sequence 2 HAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV

Sequence 1 VIL
           VI-
Sequence 2 VIM



Alignment 10
Sequence 1:
Sequence 2: Allergen Der f 1.0109, Sequence: ABL84750
Sequence identity: 82.45 (249/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNF
Sequence 2 MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNF

Sequence 1 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
           LES-KYV--N-GAINHLSDLSLDEFKNR-LMSAEAFE-LKTQFDLNAET-
Sequence 2 LESLKYVEANKGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETS

Sequence 1 ACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
           AC-IN--N-P-E-DLR--RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
Sequence 2 ACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR

Sequence 1 NQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQ
           N-SLDL-EQ-LVDCASQHGC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ
Sequence 2 NTSLDLSEQKLVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQ

Sequence 1 SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFR
           -CRRPN-Q--GISNYCQIYPP----IREAL-QTH-AIAVIIGIKDL-AF-
Sequence 2 QCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQ

Sequence 1 HYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY
           HYDGRTIIQ-DNGYQPNYHAVNIVGY---QGVDYWIVRNSWDT-WGD-GY
Sequence 2 HYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY

Sequence 1 GYFAANIDLMMIEEYPYVVIL
           GYF-A---LMMIE-YPYVVI-
Sequence 2 GYFQAGNNLMMIEQYPYVVIM



Alignment 11
Sequence 1:
Sequence 2: Allergen Der f 1.0108, Sequence: ABL84749
Sequence identity: 82.45 (249/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNF
Sequence 2 MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNF

Sequence 1 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
           LES-KYV--N-GAINHLSDLSLDEFKNR-LMSAEAFE-LKTQFDLNAET-
Sequence 2 LESLKYVEANKGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETS

Sequence 1 ACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
           AC-IN--N-P-E-DLR--RT-TPIRMQGGCGSCWAFSGVAATESAYLAYR
Sequence 2 ACRINSVNVPSELDLRSLRTATPIRMQGGCGSCWAFSGVAATESAYLAYR

Sequence 1 NQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQ
           N-SLDL-EQELVDCASQHGC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ
Sequence 2 NTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQ

Sequence 1 SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFR
           -CRRPN-Q--GISNYCQIYPP----IREAL-QTH-AIAVIIGIKDL-AF-
Sequence 2 QCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQ

Sequence 1 HYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY
           HYDGRTIIQ-DNGYQPNYHAVNIVGY---QGVDYWIVRNSWDT-WGD-GY
Sequence 2 HYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY

Sequence 1 GYFAANIDLMMIEEYPYVVIL
           GYF-A---LMMIE-YPYVVI-
Sequence 2 GYFQAGNNLMMIEQYPYVVIM



Alignment 12
Sequence 1:
Sequence 2: Allergen Der f 1.0110, Sequence: ABL84751
Sequence identity: 82.45 (249/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNF
Sequence 2 MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNF

Sequence 1 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
           LES-KYV--N-GAINHLSDLSLDEFKNR-LMSAEAFE-LKTQFDLNAET-
Sequence 2 LESLKYVEANKGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETS

Sequence 1 ACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
           AC-IN--N-P-E-DLR--RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
Sequence 2 ACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR

Sequence 1 NQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQ
           N-SLDL-EQELVDCASQHGC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ
Sequence 2 NTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQ

Sequence 1 SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFR
           -CRRPN-Q--GISNYCQIYPP----IREAL-QTH-AIAVIIGIKDL-AF-
Sequence 2 QCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQ

Sequence 1 HYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY
           HYDGRTII--DNGYQPNYHAVNIVGY---QGVDYWIVRNSWDT-WGD-GY
Sequence 2 HYDGRTIIRHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY

Sequence 1 GYFAANIDLMMIEEYPYVVIL
           GYF-A---LMMIE-YPYVVI-
Sequence 2 GYFQAGNNLMMIEQYPYVVIM



Alignment 13
Sequence 1:
Sequence 2: Allergen Der f 1.0105, Sequence: 2428875
Sequence identity: 82.45 (249/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNFLES-KYV--N-GAINHLS
Sequence 2 RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLS

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQM
           DLSLDEFKNR-LMSAEAFE-LKTQFDLNAET-AC-IN--N-P-E-DLR--
Sequence 2 DLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSL

Sequence 1 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQH
           RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN-SLDL-EQELVDCASQH
Sequence 2 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQH

Sequence 1 GCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI
           GC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ-CRRPN-Q---ISNYCQI
Sequence 2 GCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYDISNYCQI

Sequence 1 YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY
           YPP----IREAL-QTH-AIAVIIGIKDL-AF-HYDGRTIIQ-DNGYQPNY
Sequence 2 YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNY

Sequence 1 HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV
           HAVNIVGY---QGVDYWIVRNSWDT-WGD-GYGYF-A---LMMIE-YPYV
Sequence 2 HAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV

Sequence 1 VIL
           VI-
Sequence 2 VIM



Alignment 14
Sequence 1:
Sequence 2: Allergen Der f 1.0103, Sequence: 2428875
Sequence identity: 82.45 (249/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNFLES-KYV--N-GAINHLS
Sequence 2 RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLS

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQM
           DLSLDEFKNR-LMSAEAFE-LKTQFDLNAET-AC-IN--N-P-E-DLR--
Sequence 2 DLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSL

Sequence 1 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQH
           RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN-SLDL-EQELVDCASQH
Sequence 2 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQH

Sequence 1 GCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI
           GC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ-CRRPN-Q--GISNYCQI
Sequence 2 GCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI

Sequence 1 YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY
           YPP----IREAL-QTH-AIAVIIGIKDL-AF-HY-GRTIIQ-DNGYQPNY
Sequence 2 YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYGGRTIIQHDNGYQPNY

Sequence 1 HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV
           HAVNIVGY---QGVDYWIVRNSWDT-WGD-GYGYF-A---LMMIE-YPYV
Sequence 2 HAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV

Sequence 1 VIL
           VI-
Sequence 2 VIM



Alignment 15
Sequence 1:
Sequence 2: Allergen Der f 1, Sequence: P16311
Sequence identity: 82.45 (249/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNF
Sequence 2 MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNF

Sequence 1 LESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETN
           LES-KYV--N-GAINHLSDLSLDEFKNR-LMSAEAFE-LKTQFDLNAET-
Sequence 2 LESLKYVEANKGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETS

Sequence 1 ACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
           AC-IN--N-P-E-DLR--RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR
Sequence 2 ACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYR

Sequence 1 NQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQ
           N-SLDL-EQELVDCASQHGC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ
Sequence 2 NTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQ

Sequence 1 SCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFR
           -CRRPN-Q--GISNYCQIYPP----IREAL-QTH-AIAVIIGIKDL-AF-
Sequence 2 RCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQ

Sequence 1 HYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGY
           HYDGRTIIQ-DNGYQPNYHAVNIVGY---QG-DYWIVRNSWDT-WGD-GY
Sequence 2 HYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGDDYWIVRNSWDTTWGDSGY

Sequence 1 GYFAANIDLMMIEEYPYVVIL
           GYF-A---LMMIE-YPYVVI-
Sequence 2 GYFQAGNNLMMIEQYPYVVIM



Alignment 16
Sequence 1:
Sequence 2: Allergen Der f 1.0104, Sequence: 2428875
Sequence identity: 82.12 (248/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           RP-SIKTFEE-KKAFNK-YAT-E-EE-ARKNFLES-KYV--N-GAINHLS
Sequence 2 RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLS

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQM
           DLSLDEFKNR-LMSAEAFE-LKTQFDLNAE--AC-IN--N-P-E-DLR--
Sequence 2 DLSLDEFKNRYLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSL

Sequence 1 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQH
           RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN-SLDL-EQELVDCASQH
Sequence 2 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQH

Sequence 1 GCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI
           G--GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ-CRRPN-Q--GISNYCQI
Sequence 2 GRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI

Sequence 1 YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY
           YPP----IREAL-QTH-AIAVIIGIKDL-AF-HYDGRTIIQ-DNGYQPNY
Sequence 2 YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNY

Sequence 1 HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV
           HAVNIVGY---QGVDYWIVRNSWDT-WGD-GYGYF-A---LMMIE-YPYV
Sequence 2 HAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV

Sequence 1 VIL
           VI-
Sequence 2 VIM



Alignment 17
Sequence 1:
Sequence 2: Allergen Der p 1.0118, Sequence: 6771329
Sequence identity: 72.85 (220/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQ-R
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQIR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 18
Sequence 1:
Sequence 2: Allergen Der p 1.0115, Sequence: 6771329
Sequence identity: 72.85 (220/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQMR
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPN-QRFGISNYCQIY
Sequence 2 CHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNTQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 19
Sequence 1:
Sequence 2: Allergen Der p 1.0117, Sequence: 6771329
Sequence identity: 72.85 (220/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQMR
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREAL-QTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNANKIREALTQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 20
Sequence 1:
Sequence 2: Allergen Der p 1.0122, Sequence: 6771329
Sequence identity: 72.85 (220/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQMR
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFG-SNYCQIY
Sequence 2 CHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGTSNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 21
Sequence 1:
Sequence 2: Allergen Der p 1.0120, Sequence: 6771329
Sequence identity: 72.85 (220/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQMR
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTII-RDNGYQPNYH
Sequence 2 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIRRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 22
Sequence 1:
Sequence 2: Allergen Der p 1.0114, Sequence: 6771329
Sequence identity: 72.85 (220/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQMR
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGI-YIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CHGDTIPRGIAYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 23
Sequence 1:
Sequence 2: Allergen Der p 1.0123, Sequence: 6771329
Sequence identity: 72.85 (220/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQMR
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE-YPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 24
Sequence 1:
Sequence 2: Allergen Der p 1.0116, Sequence: 6771329
Sequence identity: 72.52 (219/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQ-R
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQLR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY-
Sequence 2 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYY

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 25
Sequence 1:
Sequence 2: Allergen Der p 1.0119, Sequence: 6771329
Sequence identity: 72.52 (219/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQMR
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGI-YIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CHGDTIPRGIGYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPN-NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 26
Sequence 1:
Sequence 2: Allergen Der p 1.0121, Sequence: 6771329
Sequence identity: 72.19 (218/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------------------------TNACSINGNAPAEIDLRQMR
Sequence 2 ------------------------------TNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLAYR-QSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
Sequence 2 CHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           PPN-NKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
Sequence 2 PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIE-YPYVV
Sequence 2 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVV

Sequence 1 IL
           IL
Sequence 2 IL



Alignment 27
Sequence 1:
Sequence 2: Allergen Eur m 1.0101, Sequence: CAA42677
Sequence identity: 58.61 (177/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQM
           ------------------------------T-ACSIN----P-E-DLR--
Sequence 2 ------------------------------TYACSINSVSLPSELDLRSL

Sequence 1 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQH
           RTVTPIRMQGGCGSCWAFSGVA-TESAYLAYRN-SLDLAEQELVDCASQ-
Sequence 2 RTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQN

Sequence 1 GCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI
           GC-GDTIPRGIEYIQ-NGVVQE-YY-YVAREQSC-RPNAQR-G--NYCQI
Sequence 2 GCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQI

Sequence 1 YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY
           -PP--NKIR-AL-QTH-A-AVIIGIKDL-AFRHYDGRTI-Q-DNGYQPNY
Sequence 2 SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNY

Sequence 1 HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV
           HAVNIVGY-N-QGVDYWIVRNSWDT-WGDNGYGYFAANI-L---------
Sequence 2 HAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGYGYFAANINL---------

Sequence 1 VIL
           ---
Sequence 2 ---



Alignment 28
Sequence 1:
Sequence 2: Allergen Der f 1, Sequence: CAA46316
Sequence identity: 57.28 (173/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQM
           -----------------------------ET-AC-IN--N-P-E-DLR--
Sequence 2 -----------------------------ETSACRINSVNVPSELDLRSL

Sequence 1 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQH
           RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN-SLDL-EQELVDCASQH
Sequence 2 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQH

Sequence 1 GCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI
           GC-GDTIPRGIEYIQ-NGVV-E--Y-YVAREQ-CRRPN-Q--GISNYCQI
Sequence 2 GCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQI

Sequence 1 YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY
           YPP----IREAL-QTH-AIAVIIGIKDL-AF-HYDGRTIIQ-DNGYQPNY
Sequence 2 YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNY

Sequence 1 HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV
           HAVNIVGY---QGVDYWIVRNSWDT-WGD-GYGYF-A---L---------
Sequence 2 HAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL---------

Sequence 1 VIL
           ---
Sequence 2 ---



Alignment 29
Sequence 1:
Sequence 2: Allergen Der p 1, Sequence: AAA28296
Sequence identity: 31.13 (94/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ------------MSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
Sequence 2 ------------MSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHG
           TVTPIRMQGGCGSCWAFSGVAATESAYLA-RNQSLDLAEQELVDCASQHG
Sequence 2 TVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLDLAEQELVDCASQHG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY
           C-GDTIPR------------------------------------------
Sequence 2 CHGDTIPR------------------------------------------

Sequence 1 PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 AVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IL
           --
Sequence 2 --



Alignment 30
Sequence 1:
Sequence 2: Allergen Blo t 1.0201, Sequence: AAQ24541
Sequence identity: 36.42 (110/302)
Sequence 1 --------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARK
           ------------------------IKTFE--KK-F-K-Y---E-E-----
Sequence 2 MKFLLVAALCALVAIGSCKPTREEIKTFEQFKKVFGKVYRNAEEEARREH

Sequence 1 NFLESVKYVQSNGG------AINHLSDLSLDEFKNRFLMSAEAFEHLKTQ
           -F-E--K-V----G------AIN--SD-S--EF----------F---K--
Sequence 2 HFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFSFHLSGGGLNFTYMKME

Sequence 1 FDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATE
           ----A--------G--P---D-RQ----T-IR-QG-CGSCWAF------E
Sequence 2 ---AAKEPLINTYGSLPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAE

Sequence 1 SAYLAYRNQSLDLAEQELVDCA-----SQHGCNG---DTIPRGIEYIQHN
           S-Y-----QS--L-EQELVDC------S---CNG-----------Y----
Sequence 2 SLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRT

Sequence 1 GVVQESYYRYVAREQSCRRPNA--QRFGISNYCQIYPPNANKIREALAQT
           G-V-E--Y-Y--R-Q-C--P----QR---S-Y-Q--------------Q-
Sequence 2 GLVEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQ

Sequence 1 HSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY--HAVNIVGYSNAQG
           H--------------FR---G-----R---Y---Y--HAV--VG----QG
Sequence 2 HGPVVIYMHGSN-NYFRNL-GNGVL-RGVAYNDAYTDHAVILVGWGTVQG

Sequence 1 VDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL
           VDYWI-RNSW-T-WG--GYGY---------I--------L
Sequence 2 VDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNFVTYATL



Alignment 31
Sequence 1:
Sequence 2: Allergen Blo t 1.0101, Sequence: AAK58415
Sequence identity: 27.81 (84/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMR
           ----------------------------------------PA--D-RQ--
Sequence 2 ---------------------------------------IPANFDWRQKT

Sequence 1 TVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ--
           -V-PIR-QGGCGSCWAF------E--Y---R-Q---L-EQEL-DC-----
Sequence 2 HVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY

Sequence 1 ------HGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--R
           ------HGC-----P----Y----G---ES-Y-Y------C---NA---R
Sequence 2 DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTR

Sequence 1 FGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTII
           ---S-Y-------------A----H----V-I-I----A-FR----R--I
Sequence 2 YHVSSYNSLRYRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGI

Sequence 1 QRDNGYQPNY--HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAAN
           -R--GY------HAV--VG-----G-DYWIVR-SW-T-WGD-GYG-----
Sequence 2 LRGAGYNDAQIDHAVVLVGWGTQNGIDYWIVRTSWGTQWGDAGYGFVERH

Sequence 1 IDLMMIEEYPYVVIL
           -----I--YP----L
Sequence 2 HNSLGINNYPIYASL



Alignment 32
Sequence 1:
Sequence 2: Allergen Cari p 2.0101, Sequence: P14080
Sequence identity: 32.12 (97/302)
Sequence 1 ----------------------------------------RPSSIKTFEE
           --------------------------------------------I--F--
Sequence 2 MATMSSISKIIFLATCLIIHMGLSSADFYTVGYSQDDLTSIERLIQLFDS

Sequence 1 YKKAFNKSYATFEDE----EAARKNFL---ESVKYVQSNGGAINHLSDLS
           -----NK-Y----------E--R-N-----E--K---S-----N---DLS
Sequence 2 WMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNNSYWLGLNGFADLS

Sequence 1 LDEFKNRFL-MSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTV
           -DEFK-------AE-F--L---FD-N----------N-P--ID-R----V
Sequence 2 NDEFKKKYVGFVAEDFTGLE-HFD-NEDFTYKHVT-NYPQSIDWRAKGAV

Sequence 1 TPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-HGC
           TP---QG-CGSCWAFS--A--E----------L-L-EQELVDC-----GC
Sequence 2 TPVKNQGACGSCWAFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGC

Sequence 1 NGDTIPRGIEYIQHNGVVQESYYRYVAREQSCR---RPNAQRFGISNYCQ
           -G--------Y---NGV-----Y-Y-A----CR----P------I--Y--
Sequence 2 KGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGP-KVKITGYKR

Sequence 1 IYPPNANKIREALAQTHSAIAVIIGIKDLDAFRH--YDGRTIIQRDNGYQ
           -----------ALA-------V--G-K----------DG------D----
Sequence 2 VPSNCETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLD----

Sequence 1 PNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEY
           ---HAV--VGY----G--Y-I--NSW--NWG--GY---------------
Sequence 2 ---HAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCG

Sequence 1 PYVVIL-------
           -Y-----------
Sequence 2 VYKSSYYPFKGFA



Alignment 33
Sequence 1:
Sequence 2: Allergen Act d 1, Sequence: P00785
Sequence identity: 30.46 (92/302)
Sequence 1 ----------------------------------RPSSIKTFEEYKKAFN
           ------------------------------------------E-------
Sequence 2 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG

Sequence 1 KSYATFEDEEAARKNFLESVKYVQSNGG--------AINHLSDLSLDEFK
           KSY------E-----F-E--------------------N---DL---EF-
Sequence 2 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR

Sequence 1 NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQ
           ---L---------KT------E----------P---D-R----V--I--Q
Sequence 2 STYLGFTSGSN--KTKVSNRYEPRFGQV---LPSYVDWRSAGAVVDIKSQ

Sequence 1 GGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCNGDT
           G-CG-CWAFS--A--E------------L-EQEL-DC---Q---GCNG--
Sequence 2 GECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGY

Sequence 1 IPRGIEYIQHNG-VVQESYYRYVAREQSCRRP--NAQRFGISNYCQIYPP
           I--G---I--NG----E--Y-Y-A----C-----N-----I--Y-----P
Sequence 2 ITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYENV--P

Sequence 1 NANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAV
           --N------A-T-----V-------DAF-HY----I-----G-----HAV
Sequence 2 YNNEWALQTAVTYQPVSVALDAAG-DAFKHYSS-GIFTGPCGTAID-HAV

Sequence 1 NIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL
           -IVGY----G-DYWIV-NSWDT-WG--GY-----N---------------
Sequence 2 TIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSY

Sequence 1 ----------------------------------------
           ----------------------------------------
Sequence 2 PVKYNNQNHPKPYSSLINPPAFSMSKDGPVGVDDGQRYSA



Alignment 34
Sequence 1:
Sequence 2: Allergen Act d 1, Sequence: AAA32629
Sequence identity: 30.13 (91/302)
Sequence 1 ----------------------------------RPSSIKTFEEYKKAFN
           ------------------------------------------E-------
Sequence 2 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG

Sequence 1 KSYATFEDEEAARKNFLESVKYVQSNGG--------AINHLSDLSLDEFK
           KSY------E-----F-E--------------------N---DL---EF-
Sequence 2 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR

Sequence 1 NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQ
           ---L---------KT------E----------P---D-R----V--I--Q
Sequence 2 STYLGFTSGSN--KTKVSNRYEPRVGQV---LPSYVDWRSAGAVVDIKSQ

Sequence 1 GGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCNGDT
           G-CG-CWAFS--A--E------------L-EQEL-DC---Q---GCNG--
Sequence 2 GECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGY

Sequence 1 IPRGIEYIQHNG-VVQESYYRYVAREQSC--RRPNAQRFGISNYCQIYPP
           I--G---I--NG----E--Y-Y-A----C-----N-----I--Y-----P
Sequence 2 ITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--P

Sequence 1 NANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAV
           --N------A-T-----V-------DAF--Y----I-----G-----HAV
Sequence 2 YNNEWALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAV

Sequence 1 NIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL
           -IVGY----G-DYWIV-NSWDT-WG--GY-----N---------------
Sequence 2 TIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSY

Sequence 1 ----------------------------------------
           ----------------------------------------
Sequence 2 PVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA



Alignment 35
Sequence 1:
Sequence 2: Allergen Ana c 2, Sequence: BAA21849
Sequence identity: 30.13 (91/302)
Sequence 1 -----------------------------RPSSIKTFEEYKKAFNKSYAT
           ----------------------------------K-FEE--------Y--
Sequence 2 MASKVQLVFLFLFLCAMWASPSAASRDEPNDPMMKRFEEWMAEYGRVYKD

Sequence 1 FEDEEAAR-KNFLESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAF--
           --DE---R---F---VK--------------L----F-----M----F--
Sequence 2 -DDEKMRRFQIFKNNVKHIETFNSRNENSYTLGINQFTD---MTKSEFVA

Sequence 1 EHLKTQFDLNAETNAC----SINGNA-PAEIDLRQMRTVTPIRMQGGCGS
           --------LN-E----------N--A-P--ID-R----V-----Q--CGS
Sequence 2 QYTGVSLPLNIEREPVVSFDDVNISAVPQSIDWRDYGAVNEVKNQNPCGS

Sequence 1 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQHGCNGDTIPRGIEYI
           CW-F---A--E--Y---------L-EQE--DCA---GC-G---------I
Sequence 2 CWSFAAIATVEGIYKIKTGYLVSLSEQEVLDCAVSYGCKGGWVNKAYDFI

Sequence 1 -QHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIYPP-NANKIREAL
           ---NGV--E--Y-Y-A----C---NA--F--S-Y---Y-----N--R---
Sequence 2 ISNNGVTTEENYPYLAYQGTC---NANSFPNSAYITGYSYVRRNDERSMM

Sequence 1 -AQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYS-N
           -A-----IA--I-------F--Y-G--------G---N-HA--I-GY---
Sequence 2 YAVSNQPIAALIDASE--NFQYYNG-GVFSGPCGTSLN-HAITIIGYGQD

Sequence 1 AQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL-------
           --G--YWIVRNSW---WG--GY---A----------------L-------
Sequence 2 SSGTKYWIVRNSWGSSWGEGGYVRMARGVSSSSGVCGIAMAPLFPTLQSG

Sequence 1 ------------
           ------------
Sequence 2 ANAEVIKMVSET



Alignment 36
Sequence 1:
Sequence 2: Allergen Amb a 11.0101, Sequence: V5LU01
Sequence identity: 27.15 (82/302)
Sequence 1 -----------------------------------RPSSIKTFEEYKKAF
           --------------------------------------------E-----
Sequence 2 MEINKLVCFSFSLVLILGLVESFHYHERELESEEGFMGMYDRWREQHNIE

Sequence 1 NKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNRFLMSA
           --S---F-----------ES-K---------N---D----EF-N----S-
Sequence 2 MRSPERFNVFKYNVRRIHESNKMDKPYKLKVNEFADMTNLEFVNTYANSK

Sequence 1 -EAFEHLKTQF--DLNAETNACSINGNA---PAEIDLRQMRTVTPIRMQG
           ---F--L------------N---I--N----P---D-R----VT----QG
Sequence 2 ISHFQALRGSAPGSIDTDPNKDFIYANVTKIPDKVDWREKNAVTDVKGQG

Sequence 1 GCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDC-ASQHGCNGDTIPR
           GCGSCWAF--V-A-E--------------EQ-LVDC-----GC-G-----
Sequence 2 GCGSCWAFAAVVALEGINAIRTGKLVKFSEQQLVDCDMTNAGCDGGLMEP

Sequence 1 GIEY-IQHNGVVQESYYRYVAREQSCRRPNAQR-FGISNYCQIYPPNANK
           ---Y-I-H-G---E--Y-YV-----C----------I-------------
Sequence 2 AFTYVIKHGGIAPEASYPYVGKRETCDKAKIKDVLKIDGRQNVPGLDEEA

Sequence 1 IREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVG
           -R-A-A--H---A---GI-----------------D-G--PN-H-V-IVG
Sequence 2 LRKAVA--HQPVAT--GIQLSGHGLQFYSEGVYTGDCGTEPN-HGVGIVG

Sequence 1 YS-NAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL---
           Y--N--G---W-V-NSW---WG--GY------------------------
Sequence 2 YGENEKGIKFWTVKNSWGPTWGEKGYIHLQRGARKEGLCGVAMHSSFPIM

Sequence 1 -----------------------------------------
           -----------------------------------------
Sequence 2 NDPNPPKDDPNGPKDDPDAPKDPKFKTTQRLQGIRTKLLEL



Alignment 37
Sequence 1:
Sequence 2: Allergen Car p papain, Sequence: AAB02650
Sequence identity: 30.46 (92/302)
Sequence 1 ----------------------------------------RPSSIKTFEE
           --------------------------------------------I--FE-
Sequence 2 MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFES

Sequence 1 YKKAFNKSYATFEDEEAAR-KNFLESVKYV----QSNGG---AINHLSDL
           -----NK-Y----DE---R---F----KY-------N-------N---D-
Sequence 2 WMLKHNKIYKNI-DEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADM

Sequence 1 SLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTV
           S-DEFK-----S--A-----T--------N----N---P---D-RQ---V
Sequence 2 SNDEFKEKYTGSI-AGNYTTTELSYEEVLNDGDVN--IPEYVDWRQKGAV

Sequence 1 TPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLD-LAEQELVDCASQ-HG
           TP---QG-CGSCWAFS-V---E------R---L----EQEL-DC-----G
Sequence 2 TPVKNQGSCGSCWAFSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYG

Sequence 1 CNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRR----PNAQRF-GISN
           CNG-------------G------Y-Y------CR-----P-A----G---
Sequence 2 CNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVR-

Sequence 1 YCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGY
           --Q--P-N--------A------------KD---F--Y-G--------G-
Sequence 2 --QVQPYNEGALLYSIANQPVSVVLEAAGKD---FQLYRGGIFVG-PCGN

Sequence 1 QPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEE
           ----HAV--VGY----G--Y----NSW-T-WG-NGY--------------
Sequence 2 KVD-HAVAAVGY----GPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVC

Sequence 1 YPYVVIL-----
           --Y---------
Sequence 2 GLYTSSFYPVKN



Alignment 38
Sequence 1:
Sequence 2: Allergen Gly m 1, Sequence: AAB09252
Sequence identity: 29.14 (88/302)
Sequence 1 ------------------------------------RPSSIKTFEEYKKA
           -------------------------------------------F---K--
Sequence 2 MGFLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSE

Sequence 1 FNKSYATFEDEEAARKNFLESVKYVQ----------SNGGAINHLSDLSL
           ----Y---E-E------F-----Y------------S-----N---D---
Sequence 2 HGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITP

Sequence 1 DEFKNRFLMSA-EAFEHLK-TQFDLNAETNACSINGNAPAEIDLRQMRTV
           -EF----L----------K--------E---C------PA--D-R-----
Sequence 2 QEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCD---HPPASWDWRKKGVI

Sequence 1 TPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCA--SQHG
           T----QGGCG--WAFS---A-E-A----------L-EQELVDC---S---
Sequence 2 TQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGS

Sequence 1 CNGDTIPRGIEYI-QHNGVVQESYYRYVAREQSCRRPNAQ-RFGISNYCQ
           -NG-------E----H-G------Y-Y-A-E--C-----Q----I--Y--
Sequence 2 YNGWQY-QSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYET

Sequence 1 IYPPNANKIREALAQTHSAI-----AVIIGIKDLDAFRH--YDGRTIIQR
           ----------E------SAI------V-I--KD--------YDG------
Sequence 2 LIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYTGGIYDGENCT--

Sequence 1 DNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLM
           ---Y--N-H-V--VGY--A-GVDYWI--NSW---WG--GY-----N----
Sequence 2 -SPYGIN-HFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQRNTGNL

Sequence 1 MIEEYPYVVIL--------------------------
           -------------------------------------
Sequence 2 LGVCGMNYFASYPTKEESETLVSARVKGHRRVDHSPL



Alignment 39
Sequence 1:
Sequence 2: Allergen Gly m 1, Sequence: P22895
Sequence identity: 29.14 (88/302)
Sequence 1 ------------------------------------RPSSIKTFEEYKKA
           -------------------------------------------F---K--
Sequence 2 MGFLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSE

Sequence 1 FNKSYATFEDEEAARKNFLESVKYVQ----------SNGGAINHLSDLSL
           ----Y---E-E------F-----Y------------S-----N---D---
Sequence 2 HGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITP

Sequence 1 DEFKNRFLMSA-EAFEHLK-TQFDLNAETNACSINGNAPAEIDLRQMRTV
           -EF----L----------K--------E---C------PA--D-R-----
Sequence 2 QEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCD---HPPASWDWRKKGVI

Sequence 1 TPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCA--SQHG
           T----QGGCG--WAFS---A-E-A----------L-EQELVDC---S---
Sequence 2 TQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGS

Sequence 1 CNGDTIPRGIEYI-QHNGVVQESYYRYVAREQSCRRPNAQ-RFGISNYCQ
           -NG-------E----H-G------Y-Y-A-E--C-----Q----I--Y--
Sequence 2 YNGWQY-QSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYET

Sequence 1 IYPPNANKIREALAQTHSAI-----AVIIGIKDLDAFRH--YDGRTIIQR
           ----------E------SAI------V-I--KD--------YDG------
Sequence 2 LIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYTGGIYDGENCT--

Sequence 1 DNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLM
           ---Y--N-H-V--VGY--A-GVDYWI--NSW---WG--GY-----N----
Sequence 2 -SPYGIN-HFVLLVGYGSADGVDYWIAKNSWGFDWGEDGYIWIQRNTGNL

Sequence 1 MIEEYPYVVIL--------------------------
           -------------------------------------
Sequence 2 LGVCGMNYFASYPTKEESETLVSARVKGHRRVDHSPL



Alignment 40
Sequence 1:
Sequence 2: Allergen Tyr p 1.0101, Sequence: ABM53753
Sequence identity: 33.11 (100/302)
Sequence 1 ------------------RPSSIKTFEEYKKAFNKSYATFEDEEAARKNF
           ------------------------T-E-YK--F-K-Y-T---E-----N-
Sequence 2 MALLFYILFLFFTFIQCRHLEKVPTWEQYKVKFGKNYLTINEENFRKNNY

Sequence 1 LESV-KYVQSNG--GA---INHLSDLSLDEFKNRFLMSAEAFEHLKTQFD
           --S--K-V--NG--G-----N--SD-S--EF---F---------------
Sequence 2 FNSLTKIVKNNGKNGVTLGLNDMSDWSDEEF---FSLNSKS----PSSVF

Sequence 1 LNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESA
           --A-----------P---D-R-------I--QG-C-SCWAF------E-A
Sequence 2 VSARPTSTVNTSPFPKSWDWRNIIAFNSIEQQGRCSSCWAFAAATTVEAA

Sequence 1 YLAYRNQ-SLDLAEQELVDCAS----QH----GCNGDTIPRGIEYIQHNG
           Y----N---L-L--QELVDC------QH----GC-G--------YI---G
Sequence 2 YAHQKNKHNLHLSRQELVDCTNRTFDQHYLNYGCKGGWPTEAYKYIMDHG

Sequence 1 VVQESYYRYVAR-EQSCR-------RPNAQRFGISNYCQIYPPNANKIRE
           V-----Y-Y-------C----------------ISNY-------------
Sequence 2 VYEDKLYHYTETFNEVCYADKVAHDKGHPVKYYISNYGRLAYNDTDEAIM

Sequence 1 ALAQTHSAIAV-IIGIKDLDAFRHYDG---RTIIQRDNGYQPNYHAVNIV
           A---T-----V-I-G--D---FR-Y-G---R------N----N-H-V--V
Sequence 2 AMLVTYGPGTVDIHGTSD--TFRFYKGGIMRNVMP--NSAYTN-HIVVVV

Sequence 1 GY-SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLM-MIEEYPYVVIL
           GY-----GVDYWI-RNSW---WG--GYG-------L------Y-Y----
Sequence 2 GYGTDSSGVDYWIIRNSWGKTWGEHGYGRLERHPNLLGFNNKYNYPIL-



Alignment 41
Sequence 1:
Sequence 2: Allergen Der m 1, Sequence: P16312
Sequence identity: 7.28 (22/302)
Sequence 1 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSIN-GNAPAEIDLRQM
           ------------------------------T-AC-IN-GN-P-E-DLR--
Sequence 2 ------------------------------TQACRINSGNVPSELDLRSL

Sequence 1 RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQH
           RTVTPIRMQG----------------------------------------
Sequence 2 RTVTPIRMQG----------------------------------------

Sequence 1 GCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VIL
           ---
Sequence 2 ---


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.