The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Hol l 5.0201

Sequence 2266623

Full FASTA alignment

Sequence name:
Query sequence:
QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEET
KMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVH
AVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFET
AFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAAL
TKAITAMSQAQKVAQPAAAATGAATVAAGAATTAAGGYKV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Hol l 5.0201CAB10766Go!240299.28.2e-83
2Dac g 5.02AAK62277Go!265231.91.6e-62
3Dac g 5.01AAK62276Go!265230.54.3e-62
4Lol p 5AAD20386Go!301230.16.4e-62
5Hol l 5.0101CAB10765Go!264226.76.0e-61
6Phl p 5.0204AAC25996Go!265213.75.0e-57
7Phl p 5.0201Q40963Go!284213.75.4e-57
8Phl p 5.0202CAB05371Go!281211.72.1e-56
9Phl p 5.02059249029Go!265209.97.0e-56
10Phl p 5.0109CAD87529Go!284206.76.9e-55
11Phl p 5.0107AAC16527Go!276205.91.2e-54
12Phl p 5.0101CAA52753Go!312204.73.0e-54
13Phl p 5.0106AAC16526Go!276203.65.4e-54
14Phl p 5.0108AAC16528Go!276202.61.1e-53
15Poa p 5.0101Q9FPR0Go!303202.11.8e-53
16Poa p 5P22284Go!373201.92.5e-53
17Poa p 5P22286Go!307200.55.5e-53
18Phl p 5.0105AAC16525Go!276199.68.7e-53
19Phl p 5.0104CAB05372Go!276199.68.7e-53
20Phl p 5.0102Q40962Go!286199.41.0e-52
21Poa p 5P22285Go!333199.71.0e-52
22Phl p 5AAK25823Go!275189.41.0e-49
23Lol p 5Q40237Go!339185.22.3e-48
24Sec c 5.0101CBG76811Go!292184.82.6e-48
25Pha a 5P56164Go!320183.01.0e-47
26Pha a 5P56167Go!175168.31.5e-43
27Hor v 5.0101U57845Go!313165.61.7e-42
28Lol p 5Q40240Go!308137.07.1e-34
29Pha a 5P56165Go!305121.33.6e-29
30Pha a 5P56166Go!294114.92.9e-27
31Phl p 6.0101P43215Go!13277.03.5e-16
32Phl p 6.0102CAA76556Go!13875.41.1e-15

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Hol l 5.0201, Sequence: CAB10766
Sequence identity: 100.00 (240/240)
Sequence 1 QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEET
           QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEET
Sequence 2 QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEET

Sequence 1 KMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVH
           KMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVH
Sequence 2 KMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVH

Sequence 1 AVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFET
           AVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFET
Sequence 2 AVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFET

Sequence 1 AFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAAL
           AFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAAL
Sequence 2 AFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAAL

Sequence 1 TKAITAMSQAQKVAQPAAAATGAATVAAGAATTAAGGYKV
           TKAITAMSQAQKVAQPAAAATGAATVAAGAATTAAGGYKV
Sequence 2 TKAITAMSQAQKVAQPAAAATGAATVAAGAATTAAGGYKV



Alignment 2
Sequence 1:
Sequence 2: Allergen Dac g 5.02, Sequence: AAK62277
Sequence identity: 78.33 (188/240)
Sequence 1 ------------------------QKLLEDVNASFKAAVAAAAKVPPADK
           ------------------------QKL-EDVNA-FKAAVAAA---PPADK
Sequence 2 ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADK

Sequence 1 YKTFLRAFTVLDRGSTEQSKAEETKMPELSSKLVDAYMAAFKASTGGTQE
           -KTF---FT-----------A--TK-P----KL--AY--A-K---G-T-E
Sequence 2 FKTFEATFTAACKANIA---AAATKVPLFVAKLDAAYAVAYKTAAGPTPE

Sequence 1 AKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKID
           AKYDAFV--LTEALRVIAGALEVHAVKPA-EEVPAAKIPAG-LQ-VDKID
Sequence 2 AKYDAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKID

Sequence 1 ASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAA
           A--KIAATAANAAPANDKFTVFE-AFNKA-KESTGGAYESYKFIP-LEAA
Sequence 2 AAYKIAATAANAAPANDKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAA

Sequence 1 VKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATV
           VKQAYA-TVAAAPEVKYAVFEAALTKAITAMS-AQKVA-PAAAATGAAT-
Sequence 2 VKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAAATGAATA

Sequence 1 AA----GAATTAAGGYKV
           AA----GAAT-AAGGYKV
Sequence 2 AASAATGAATAAAGGYKV



Alignment 3
Sequence 1:
Sequence 2: Allergen Dac g 5.01, Sequence: AAK62276
Sequence identity: 77.92 (187/240)
Sequence 1 ------------------------QKLLEDVNASFKAAVAAAAKVPPADK
           ------------------------Q-L-EDVNA-FKAAVAAA---PPADK
Sequence 2 ADAGYTPAAAATPATAGGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADK

Sequence 1 YKTFLRAFTVLDRGSTEQSKAEETKMPELSSKLVDAYMAAFKASTGGTQE
           -KTF---FT-----------A--TK-P----KL--AY--A-K--TG-T-E
Sequence 2 FKTFEATFTAACKANIA---AAATKVPLFVAKLDAAYAVAYKTATGPTPE

Sequence 1 AKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKID
           AKYDAFV--LTEALRVIAGALEVHAVKPA-EEVPAAKIPAG-LQ-VDKID
Sequence 2 AKYDAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKID

Sequence 1 ASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAA
           A--KIAATAANAAPANDKFTVFE-AFNKA-KESTGGAYESYKFIP-LEAA
Sequence 2 AAYKIAATAANAAPANDKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAA

Sequence 1 VKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATV
           VKQAYA-TVAAAPEVKYAVFEAALTKAITAMS-AQKVA-PAA-ATGAAT-
Sequence 2 VKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAVATGAATA

Sequence 1 AA----GAATTAAGGYKV
           AA----GAAT-AAGGYKV
Sequence 2 AASAATGAATAAAGGYKV



Alignment 4
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: AAD20386
Sequence identity: 78.75 (189/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLAVALVAGPAASYAADAGYTPAAAATPATPAATPAAAGG

Sequence 1 ------QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQ
           ------QKLLEDVNA-FKAAVAAAA--PPADK-K-F--AF-----G----
Sequence 2 KATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLAT

Sequence 1 SKAEETKMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIA
           S-A---K-P-L--KL--AY--A-KA--G-T-EAKYDAFVT-LTEALRVIA
Sequence 2 SAA---KAPGLIPKLDTAYDVAYKAAEGATPEAKYDAFVTALTEALRVIA

Sequence 1 GALEVHAVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDK
           GALEVHAVKPATEEVPAAKIP-G-LQ-VDKIDA-FKIAATAANAAP-NDK
Sequence 2 GALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDK

Sequence 1 FTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYA
           FTVFE-AFNKAL-E-TGGAYE-YKFIPSLEAAVKQAYA-TVAAAPEVKYA
Sequence 2 FTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYA

Sequence 1 VFEAALTKAITAMSQAQKVAQPAAAA--------TGAATVAAGAATTAAG
           VFEAALTKAITAM-QAQK---PAAAA--------TGAAT-AAGAAT-AAG
Sequence 2 VFEAALTKAITAMTQAQKAGKPAAAAATGAATVATGAATAAAGAATAAAG

Sequence 1 GYKV
           GYK-
Sequence 2 GYKA



Alignment 5
Sequence 1:
Sequence 2: Allergen Hol l 5.0101, Sequence: CAB10765
Sequence identity: 77.92 (187/240)
Sequence 1 -----------------------QKLLEDVNASFKAAVAAAAKVPPADKY
           -----------------------QKLLEDVNA-FK-AVAAAA-VPPADKY
Sequence 2 ADAGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKY

Sequence 1 KTFLRAFTVLDRGSTEQSKAEETKMPELSSKLVDAYMAAFKASTGGTQEA
           KTF--AFT-----S-----A--TK-P-L---L--A---A--A--G-T-EA
Sequence 2 KTFEAAFTASSKASIA---AAATKAPGLIPQLNAATNTAYAAAQGATPEA

Sequence 1 KYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKIDA
           KYDAFVTTLTEALRVIAGALEVHAVKPATEEV-AAKIPAG-LQ-VDKIDA
Sequence 2 KYDAFVTTLTEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDA

Sequence 1 SFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAV
           -F-IAATAANAAP-NDKFTVFE-AFNKA-KESTGGAYE-YKFIPSLE-AV
Sequence 2 AFRIAATAANAAPVNDKFTVFEGAFNKAIKESTGGAYEAYKFIPSLETAV

Sequence 1 KQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAAT--
           KQAYA-TVA-APEVKY-VFE-AL-KAITAMS-AQK-A-P-AAATGAAT--
Sequence 2 KQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAAATGAATAA

Sequence 1 --VAAGAATTAAGGYKV
           --VAAGAAT-AAGGYKV
Sequence 2 AGVAAGAATAAAGGYKV



Alignment 6
Sequence 1:
Sequence 2: Allergen Phl p 5.0204, Sequence: AAC25996
Sequence identity: 72.08 (173/240)
Sequence 1 ------------------------QKLLEDVNASFKAAVAAAAKVPPADK
           ------------------------QKL-ED-N--FKAAVAAAA-VP-ADK
Sequence 2 ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAADK

Sequence 1 YKTFLRAFTVLDRGSTEQSKAEETKMPELSSKLVDAYMAAFKASTGGTQE
           -KTF--AFT---------SKA---K-P-L--KL--AY--A-KA--G-T-E
Sequence 2 FKTFEAAFT-------SSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPE

Sequence 1 AKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKID
           AK-D-FV--LTEALRVIAGALEVHAVKP-TEE---AKIPAG-LQ--DKID
Sequence 2 AKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKID

Sequence 1 ASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAA
           A-FK-AATAA--APA-DKFTVFE-AFNKA-KESTGGAY--YK-IPSLEAA
Sequence 2 AAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAA

Sequence 1 VKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATV
           VKQAYA-TVAAAP-VKYAVFEAALTKAITAMS--QKV-QPA---TGAATV
Sequence 2 VKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPA---TGAATV

Sequence 1 AAGAATTAAGGYKV-----------
           AAGAATTAAG---------------
Sequence 2 AAGAATTAAGAASGAATVAAGGYKV



Alignment 7
Sequence 1:
Sequence 2: Allergen Phl p 5.0201, Sequence: Q40963
Sequence identity: 72.08 (173/240)
Sequence 1 -------------------------------------------QKLLEDV
           -------------------------------------------QKL-ED-
Sequence 2 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI

Sequence 1 NASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEETKMPELSS
           N--FKAAVAAAA-VP-ADK-KTF--AFT---------SKA---K-P-L--
Sequence 2 NVGFKAAVAAAASVPAADKFKTFEAAFT-------SSSKAAAAKAPGLVP

Sequence 1 KLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATE
           KL--AY--A-KA--G-T-EAK-D-FV--LTEALRVIAGALEVHAVKP-TE
Sequence 2 KLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTE

Sequence 1 EVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALK
           E---AKIPAG-LQ--DKIDA-FK-AATAA--APA-DKFTVFE-AFNKA-K
Sequence 2 EPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIK

Sequence 1 ESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAM
           ESTGGAY--YK-IPSLEAAVKQAYA-TVAAAP-VKYAVFEAALTKAITAM
Sequence 2 ESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAM

Sequence 1 SQAQKVAQPAAAATGAATVAAGAATTAAGGYKV-----------
           S--QKV-QPA---TGAATVAAGAATTAAG---------------
Sequence 2 SEVQKVSQPA---TGAATVAAGAATTAAGAASGAATVAAGGYKV



Alignment 8
Sequence 1:
Sequence 2: Allergen Phl p 5.0202, Sequence: CAB05371
Sequence identity: 71.25 (171/240)
Sequence 1 ----------------------------------------QKLLEDVNAS
           ----------------------------------------QKL-ED-N--
Sequence 2 AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDINVG

Sequence 1 FKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEETKMPELSSKLV
           FKAAVAAAA-VP--DK-KTF--AFT---------SKA---K-P-L--KL-
Sequence 2 FKAAVAAAASVPAGDKFKTFEAAFT-------SSSKAATAKAPGLVPKLD

Sequence 1 DAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVP
           -AY--A-KA--G-T-EAK-D-FV--LTEALRVIAGALEVHAVKP-TEE--
Sequence 2 AAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPG

Sequence 1 AAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKEST
           -AKIPAG-LQ--DKIDA-FK-AATAA--APA-DKFTVFE-AFNKA-KEST
Sequence 2 MAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKEST

Sequence 1 GGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQA
           GGAY--YK-IPSLEAAVKQAYA-TVAAAP-VKYAVFEAALTKAITAMS--
Sequence 2 GGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEV

Sequence 1 QKVAQPAAAATGAATVAAGAATTAAGGYKV-----------
           QKV-QPA---TGAATVAAGAATTA-G---------------
Sequence 2 QKVSQPA---TGAATVAAGAATTATGAASGAATVAAGGYKV



Alignment 9
Sequence 1:
Sequence 2: Allergen Phl p 5.0205, Sequence: 9249029
Sequence identity: 70.83 (170/240)
Sequence 1 ------------------------QKLLEDVNASFKAAVAAAAKVPPADK
           ------------------------QKL-ED-N--F-AAVAAAA-VP-ADK
Sequence 2 ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFNAAVAAAASVPAADK

Sequence 1 YKTFLRAFTVLDRGSTEQSKAEETKMPELSSKLVDAYMAAFKASTGGTQE
           -KTF--AFT---------SKA---K-P-L--KL--AY--A-KA--G-T-E
Sequence 2 FKTFEAAFT-------SSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPE

Sequence 1 AKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKID
           AK-D--V--LTEALRVIAGALEVHAVKP-TEE---AKIPAG-LQ--DKID
Sequence 2 AKFDSLVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKID

Sequence 1 ASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAA
           A-FK-AATAA--APA-DKFTVFE-AFNKA-KESTGGAY--YK-IPSLEAA
Sequence 2 AAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAA

Sequence 1 VKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATV
           VKQ-YA-TVAAAP-VKYAVFEAALTKAITAMS--QKV-QPA---TGAATV
Sequence 2 VKQPYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPA---TGAATV

Sequence 1 AAGAATTAAGGYKV-----------
           AAGAATTAAG---------------
Sequence 2 AAGAATTAAGAASGAATVAAGGYKV



Alignment 10
Sequence 1:
Sequence 2: Allergen Phl p 5.0109, Sequence: CAD87529
Sequence identity: 70.42 (169/240)
Sequence 1 -----------------------------------QKLLEDVNASFKAAV
           -----------------------------------QKL-E--NA-FKAA-
Sequence 2 ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAAL

Sequence 1 AAAAKVPPADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMPELSSK
           AAAA-VPPADKY-TF---F----------G-----K--AE------L-SK
Sequence 2 AAAAGVPPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSK

Sequence 1 LVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEE
           L--AY--A-K---G-T-EAKYDA-V-TL-EALR-IAG-LEVHAVKPA-EE
Sequence 2 LDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEE

Sequence 1 VPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKE
           V----IPAG-LQV--K-DA-FK-AATAANAAPANDKFTVFE-AFN-A-K-
Sequence 2 VKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNNAIKA

Sequence 1 STGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMS
           STGGAYESYKFIP-LEAAVKQAYA-TVA-APEVKY-VFE-AL-KAITAMS
Sequence 2 STGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS

Sequence 1 QAQKVAQPAAAATGAATVAAGAATTAA----GGYKV
           -AQK-A-PAAAAT--AT-A-GAAT-AA----GGYKV
Sequence 2 EAQKAAKPAAAATATATSAVGAATGAATAATGGYKV



Alignment 11
Sequence 1:
Sequence 2: Allergen Phl p 5.0107, Sequence: AAC16527
Sequence identity: 70.00 (168/240)
Sequence 1 ---------------------------QKLLEDVNASFKAAVAAAAKVPP
           ---------------------------QKL-E--N--FKAA-AAAA-VPP
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 ADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMPELSSKLVDAYMAA
           ADKYKTF---F----------G-----K--AE------L-SKL--AY--A
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLA

Sequence 1 FKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPA
           -K---G-T-EAKYDA-V-TL-EALR-IAG-LEVHAVKPA-EEV----IPA
Sequence 2 YKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYES
           G-LQV--K-D--FK-AATAANAAPANDKFTVFE-AFN-A-K-STGGAYES
Sequence 2 GELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYES

Sequence 1 YKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQP
           YKFIP-LEAAVKQAYA-TVA-APEVKY-VFE-AL-KAITAMS-AQK-A-P
Sequence 2 YKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKP

Sequence 1 AAAATGAATVAAGAAT----TAAGGYKV
           AAAAT--AT-A-GAAT-----AAGGYKV
Sequence 2 AAAATATATSAVGAATGATTAAAGGYKV



Alignment 12
Sequence 1:
Sequence 2: Allergen Phl p 5.0101, Sequence: CAA52753
Sequence identity: 70.00 (168/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADLGYGPATPAAPAAGYTPATPAAP

Sequence 1 -------------QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAF---
           -------------QKL-E--NA-FKAA-AAAA-V-PADKY-TF---F---
Sequence 2 AEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAA

Sequence 1 --TVLDRGSTEQSK--AEETKMPELSSKLVDAYMAAFKASTGGTQEAKYD
           -------G-----K--AE------L-SKL--AY--A-K---G-T-EAKYD
Sequence 2 SNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYD

Sequence 1 AFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKIDASFK
           A-V-TL-EALR-IAG-LEVHAVKPA-EEV----IPAG-LQV--K-DA-FK
Sequence 2 AYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFK

Sequence 1 IAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQA
           -AATAANAAPANDKFTVFE-AFN-A-K-STGGAYESYKFIP-LEAAVKQA
Sequence 2 VAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQA

Sequence 1 YASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAAGA
           YA-TVA-APEVKY-VFE-AL-KAITAMS-AQK-A-PAAAAT--AT-A-GA
Sequence 2 YAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGA

Sequence 1 ATTAA----GGYKV
           AT-AA----GGYKV
Sequence 2 ATGAATAATGGYKV



Alignment 13
Sequence 1:
Sequence 2: Allergen Phl p 5.0106, Sequence: AAC16526
Sequence identity: 69.17 (166/240)
Sequence 1 ---------------------------QKLLEDVNASFKAAVAAAAKVPP
           ---------------------------QKL-E--N--FKAA-AAAA-VPP
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 ADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMPELSSKLVDAYMAA
           ADKYKTF---F----------G-----K--AE------L-SKL--AY--A
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLA

Sequence 1 FKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPA
           -K---G-T-EAKYDA-V-TL-EALR-IAG-LEVHAVKPA-EEV----IPA
Sequence 2 YKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYES
           G-LQV--K-D--FK-AATAANAAPANDKFTVFE-AFN-A-K-STGGAYES
Sequence 2 GELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYES

Sequence 1 YKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQP
           YKFIP-LEAAVKQAYA-TVA-APEVKY-VFE-AL-KAITAMS-AQK-A-P
Sequence 2 YKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKP

Sequence 1 AAAATGAATVAAGAATTAA----GGYKV
           A--AT--AT-A-GAAT-AA----GGYKV
Sequence 2 ATEATATATAAVGAATGAATAATGGYKV



Alignment 14
Sequence 1:
Sequence 2: Allergen Phl p 5.0108, Sequence: AAC16528
Sequence identity: 68.75 (165/240)
Sequence 1 ---------------------------QKLLEDVNASFKAAVAAAAKVPP
           ---------------------------QKL-E--N--FKAA-AAAA-VPP
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 ADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMPELSSKLVDAYMAA
           ADKYKTF---F----------G-----K--AE------L-SKL--AY--A
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLA

Sequence 1 FKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPA
           -K---G-T-EAKYDA-V-TL-EALR-IAG-LEVHAVKPA-EEV----IPA
Sequence 2 YKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYES
           G-LQV--K-D--FK-AATAANAAPANDKFTVFE-AFN-A-K-STGGAYES
Sequence 2 GELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYES

Sequence 1 YKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQP
           YKFIP-LEAAVKQAYA-TVA-APEVKY-VFE-AL-KA-TAMS-AQK-A-P
Sequence 2 YKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAFTAMSEAQKAAKP

Sequence 1 AAAATGAATVAAGAATTAA----GGYKV
           A--AT--AT-A-GAAT-AA----GGYKV
Sequence 2 ATEATATATAAVGAATGAATAATGGYKV



Alignment 15
Sequence 1:
Sequence 2: Allergen Poa p 5.0101, Sequence: Q9FPR0
Sequence identity: 67.08 (161/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQE

Sequence 1 QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEET
           QKL-ED-N--FKAAVAAAA--PPADK-KTF--AF------S----K----
Sequence 2 QKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFSASVEASA--AKLNAA

Sequence 1 KMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVH
           --P---S-------A--KA--G-T-EAK-D-FV---TEALR-IAG-L-VH
Sequence 2 QAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVH

Sequence 1 AVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFET
           AVKP-TEE--AAKIPAG--Q--DKIDA-FK-AATAANAAPANDKFTVFE-
Sequence 2 AVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEA

Sequence 1 AFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAAL
           AFN-A-KESTGGAY--YK-IPSLEAAVKQAYA-T-AAAPEVK-AVF-AAL
Sequence 2 AFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAAL

Sequence 1 TKAITAMSQAQKVAQPAA---------------AATGAATVAAGAATTAA
           TKAITAM---QKV--P-A---------------AATGAA--A-GAAT--A
Sequence 2 TKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSA

Sequence 1 GGYKV
           GGYKV
Sequence 2 GGYKV



Alignment 16
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22284
Sequence identity: 69.58 (167/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSGPDAVGFAKK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKAPPASKFPAK

Sequence 1 ------------------------QKLLEDVNASFKAAVAAAAKVPPADK
           ------------------------QKL-E--N--FKAAVAAAA-VP-A-K
Sequence 2 PAPKVAAYTPAAPAGAAPKATTDEQKLIEKINVGFKAAVAAAAGVPAASK

Sequence 1 YKTFLRAFTVLDRG------STE-QSKAEETKMPELSSKLVDAYMAAFKA
           YKTF---F------------STE----A-------L-SKL--AY--A-K-
Sequence 2 YKTFVATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKS

Sequence 1 STGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDL
           --G-T-EAKYDA-V-TL-EALR-IAG-LEVH-VKPA-EEV-A--IPAG-L
Sequence 2 AEGATPEAKYDAYVATLSEALRIIAGTLEVHGVKPAAEEVKA--IPAGEL

Sequence 1 QVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKF
           QV-DK-DA-FK-AATAANAAPANDKFTVFE-AFN-A-K-STGGAY-SYKF
Sequence 2 QVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKF

Sequence 1 IPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAA
           IP-LEAAVKQ-YA-TVA-AP-VKY-VFE-AL-KAITAMSQAQK-A-PAAA
Sequence 2 IPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAA

Sequence 1 ATGAAT----VAAGAATTAAGGYKV
           -TG-AT-----A-GAAT-AAGGYKV
Sequence 2 VTGTATSAVGAATGAATAAAGGYKV



Alignment 17
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22286
Sequence identity: 68.33 (164/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLVALVVGPAASYAADLSYGAPATPAAPAAGYTPAAPAGA

Sequence 1 --------QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRG--
           --------QK--E--N--FKAAVAAA--VP-A-KYKTF---F--------
Sequence 2 APKATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAASNKAF

Sequence 1 ----STE-QSKAEETKMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTT
           ----STE----A-------L-SKL--AY--A-K---G-T-EAKYD--V-T
Sequence 2 AEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKYDDYVAT

Sequence 1 LTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATA
           L-EALR-IAG-LEVH-VKPA-EEV-A---PAG-LQV-DK-DA-FK-AATA
Sequence 2 LSEALRIIAGTLEVHGVKPAAEEVKAT--PAGELQVIDKVDAAFKVAATA

Sequence 1 ANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQAYASTV
           ANAAPANDKFTVFE-AFN-A-K-STGGAY-SYKFIP-LEAAVKQ-YA-TV
Sequence 2 ANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATV

Sequence 1 AAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAAGAAT---
           A-AP-VKY-VFE-AL-KAITAMSQAQK-A-PAAAATG-AT-A-GAAT---
Sequence 2 ATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAATGTATAAVGAATGAA

Sequence 1 -TAAGGYKV
           --AAGGYKV
Sequence 2 TAAAGGYKV



Alignment 18
Sequence 1:
Sequence 2: Allergen Phl p 5.0105, Sequence: AAC16525
Sequence identity: 67.92 (163/240)
Sequence 1 ---------------------------QKLLEDVNASFKAAVAAAAKVPP
           ---------------------------QKL-E--N--FKAA-AAAA-VPP
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 ADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMPELSSKLVDAYMAA
           ADKYKTF---F----------G-----K--AE------L-SKL--AY--A
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLA

Sequence 1 FKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPA
           -K---G-T-EA-YDA-V-TL-EALR-IAG-LEVHAVKPA-EEV----IPA
Sequence 2 YKTAEGATPEAEYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYES
           G-LQV--K-D---K-AATAANAAPANDKFTVFE-AFN-A-K-STGGAYES
Sequence 2 GELQVIEKVDSALKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYES

Sequence 1 YKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQP
           YKFIP-LEAAVKQAYA-TVA-APEVKY-VFE-AL-KAITA-S-AQK-A-P
Sequence 2 YKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITATSEAQKAAKP

Sequence 1 AAAATGAATVAAGAATTAA----GGYKV
           A--AT--AT-A-GAAT-AA----GGYKV
Sequence 2 ATEATATATAAVGAATGAATAATGGYKV



Alignment 19
Sequence 1:
Sequence 2: Allergen Phl p 5.0104, Sequence: CAB05372
Sequence identity: 68.33 (164/240)
Sequence 1 ---------------------------QKLLEDVNASFKAAVAAAAKVPP
           ---------------------------QKL-E--N--FKAA-AAAA-VPP
Sequence 2 ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPP

Sequence 1 ADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMPELSSKLVDAYMAA
           ADKYKTF---F----------G-----K--AE------L-SKL--AY--A
Sequence 2 ADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLA

Sequence 1 FKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPA
           -K-S-G-T-EAKYDA-V-TL-EALR-IAG-LEVHAVKPA-EEV----IPA
Sequence 2 YKTSEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPA

Sequence 1 GDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYES
           G-LQ---K-D---K-AATAANAA-ANDKFTVFE-AFN-A-K-STGGAYES
Sequence 2 GELQFIEKVDSALKVAATAANAAAANDKFTVFEAAFNHAIKASTGGAYES

Sequence 1 YKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQP
           YKFIP-LEAAVKQAYA-TVA-APEVKY-VFE-AL-KAITAMS-AQK-A-P
Sequence 2 YKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKP

Sequence 1 AAAATGAATVAAGAATTAA----GGYKV
           A--AT--AT-A-GAAT-AA----GGYKV
Sequence 2 ATEATATATAAVGAATGAATAATGGYKV



Alignment 20
Sequence 1:
Sequence 2: Allergen Phl p 5.0102, Sequence: Q40962
Sequence identity: 68.75 (165/240)
Sequence 1 --------------------------------------QKLLEDVNASFK
           --------------------------------------QKL-E--NA-FK
Sequence 2 ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFK

Sequence 1 AAVAAAAKVPPADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMPEL
           AA-A-A--V-PADKY-TF---F----------G-----K--AE------L
Sequence 2 AALAGAG-VQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAAL

Sequence 1 SSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPA
           -SKL--AY--A-K---G-T-EAKYDA-V-TL-EALR-IAG-LEVHAVKPA
Sequence 2 TSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPA

Sequence 1 TEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKA
           -EEV----IPAG-LQV--K-DA-FK-AATAANAAPANDKFTVFE-AFN--
Sequence 2 AEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDE

Sequence 1 LKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAIT
           -K-STGGAYESYKFIP-LEAAVKQAYA-TVA-APEVKY-VFE-AL-KAIT
Sequence 2 IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT

Sequence 1 AMSQAQKVAQPAAAATGAATVAAGAATTAA----GGYKV
           AMS-AQK-A-PAAAAT--AT-A-GAAT-AA----GGYKV
Sequence 2 AMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV



Alignment 21
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22285
Sequence identity: 70.42 (169/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAAPAAGYT

Sequence 1 ---------------QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAF-
           ---------------QKL-E--NA-FKAAVAAAA-VP--DKYKTF---F-
Sequence 2 PAAPAGAAPKATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFG

Sequence 1 TVLDRG-----STE-QSKAEETKMPELSSKLVDAYMAAFKASTGGTQEAK
           T----------STE----A-------L-SKL--AY--A-K---G-T-EAK
Sequence 2 TASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGATPEAK

Sequence 1 YDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKIDAS
           YDA-V-TL-EALR-IAG-LEVHAVKPA-EEV-A--IPAG-LQV-DK-DA-
Sequence 2 YDAYVATLSEALRIIAGTLEVHAVKPAGEEVKA--IPAGELQVIDKVDAA

Sequence 1 FKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVK
           FK-AATAANAAPANDKFTVFE-AFN-A-K-STGGAY-SYKFIP-LEAAVK
Sequence 2 FKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVK

Sequence 1 QAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAA---------
           Q-YA-TVA-AP-VKY-VFE-AL-KAITAMSQAQK-A-PAAA---------
Sequence 2 QSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTATATGAV

Sequence 1 --ATGAATVAAGAATTAAGGYKV------------
           --ATGA---A-GAAT-AAGGYK-------------
Sequence 2 GAATGAVGAATGAATAAAGGYKTGAATPTAGGYKV



Alignment 22
Sequence 1:
Sequence 2: Allergen Phl p 5, Sequence: AAK25823
Sequence identity: 66.25 (159/240)
Sequence 1 --------------------------QKLLEDVNASFKAAVAAAAKVPPA
           -----------------------------------S-KA-----A-VPPA
Sequence 2 PISVTAPPPQLPRPPATPPPPPPPQLGASPYKLGPSPKARSERPAIVPPA

Sequence 1 DKYKTFLRAF-----TVLDRGSTEQSK--AEETKMPELSSKLVDAYMAAF
           DKY-TF---F----------G-----K--AE------L-SKL--AY--A-
Sequence 2 DKYRTFVATFGAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAY

Sequence 1 KASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAG
           K---G-T-EAKYDA-V-TL-EALR-IAG-LEVHAVKPA-EEV----IPAG
Sequence 2 KTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAG

Sequence 1 DLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESY
           -LQV--K-DA-FK-AATAANAAPANDKFTVFE-AFN-A-K--TGGAYESY
Sequence 2 ELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNNAIKAGTGGAYESY

Sequence 1 KFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPA
           KFIP-LEAAVKQAYA-TVA-APEVKY-VFE-AL-KAITAMS-AQK-A-PA
Sequence 2 KFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA

Sequence 1 AAATGAATVAAGA---ATTAA-GGYKV
           AAAT--AT-A-GA---ATTAA-GGYKV
Sequence 2 AAATATATSAVGAPTGATTAAAGGYKV



Alignment 23
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40237
Sequence identity: 63.33 (152/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP

Sequence 1 ------------------QKLLEDVNASFKAAVAAAAKVPPADKYKTFLR
           ------------------QKL-E--NA-FKAAVAAAA-VPPADKYKTF--
Sequence 2 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE

Sequence 1 AF-TVLDRGSTE---QSKAEETKMPELSSKLVDAYMAAFKASTGGTQEAK
           -F-T-------E------A---K---L-SKL--A---A--A--G-T-EAK
Sequence 2 TFGTATNKAFVEGLASGYADQSKN-QLTSKLDAALKLAYEAAQGATPEAK

Sequence 1 YDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKIDAS
           YDA-V-TLTEALRVIAG-LEVHAVKPA-EEV----IPA---Q--DK-DA-
Sequence 2 YDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAA

Sequence 1 FKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVK
           ---AATAANAAPANDKFTVFE--FN-A-K-S-G-AY-SYKFIP-L-AAVK
Sequence 2 YRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVK

Sequence 1 QAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAA
           QAYA---A-APEVKY-V-E-AL-KA-TAMS-A-K-A-PAAAAT---T-AA
Sequence 2 QAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAA

Sequence 1 GAAT-TAAGGYKV---------------------------
           --AT-T-A--Y-----------------------------
Sequence 2 ATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV



Alignment 24
Sequence 1:
Sequence 2: Allergen Sec c 5.0101, Sequence: CBG76811
Sequence identity: 62.08 (149/240)
Sequence 1 ------------------------------------------QKLLEDVN
           ------------------------------------------QKL-E--N
Sequence 2 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN

Sequence 1 ASFKAAVAAAAKVPPADKYKTFLRAFT---------VLDRGSTEQSKAEE
           --FKAAV-AAA-V-PADKYKTF---F----------VL------Q--A--
Sequence 2 NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS

Sequence 1 TKMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEV
           --M--LS--L---Y--A-----G-T-E-KYD--V--LTE-LRVI-GA-EV
Sequence 2 DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV

Sequence 1 HAVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFE
           HAVKPA-EEV-----PA--L-VVD-IDA----AATAANAAP-NDKF-VFE
Sequence 2 HAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFE

Sequence 1 TAFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAA
           --FNKA-KE-TGGAY-SY-F-P-LE-AVKQAYA-TVA-APEVKYAVF-AA
Sequence 2 SSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAA

Sequence 1 LTKAITAMSQAQKVAQPAAAA--TGAATVAAGAAT-TAAGGYKV
           L-KAI-AM--A-K-A-PAAAA--T--AT---GAA---AAGGYK-
Sequence 2 LSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA



Alignment 25
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56164
Sequence identity: 64.58 (155/240)
Sequence 1 ----------------------------------------------QKLL
           --------------------------------------------------
Sequence 2 MAVQKYTMALFLAVALVAGPAAPTPPTPRTPPLLPPPRARDKATLTSRSV

Sequence 1 EDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEETKMPE
           ED-NA-------A---VPPADK-KTF--A--VL---------A--TK-P-
Sequence 2 EDINAASRRPWWAS--VPPADKFKTF--ADHVLCVPNADVTSAA-TKAPQ

Sequence 1 LSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKP
           L--KL--AY--A--A--G-T-EAKYDAF---LTEALRVIAGA-EVHAVKP
Sequence 2 LKAKLDAAYRVAYEAAEGSTPEAKYDAFIAALTEALRVIAGAFEVHAVKP

Sequence 1 ATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNK
           ATEEV-A---P-G-LQ-VDKIDA-FKIAATAAN-APANDKFTVFE-AFNK
Sequence 2 ATEEVVAD--PVGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNK

Sequence 1 ALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAI
           A-KEST-GAYE-YKFIPSLEAAVKQAY--TVA-APEVKYAVFEA-LTKAI
Sequence 2 AIKESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAI

Sequence 1 TAMSQAQKVAQPAAAATGAATV---AAGAATTAAGGYKV-----------
           TAMS-AQKVA-P-------------A-GAAT-AA----------------
Sequence 2 TAMSEAQKVAKPPLSPQPPQVLPLAAGGAATVAAASDVRVCRSHGTLQDA

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 CLLRCRGGCQPVVWRGGSHRARGGYKV



Alignment 26
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56167
Sequence identity: 57.50 (138/240)
Sequence 1 QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEET
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVH
           --------------------------AKYDAF---LTEALRVIAGA-EVH
Sequence 2 --------------------------AKYDAFIAALTEALRVIAGAFEVH

Sequence 1 AVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFET
           AVKPATEEVPAAKIPAG-LQ-VDKIDA-FKIAATAAN-APANDKFTVFE-
Sequence 2 AVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVFEG

Sequence 1 AFNKALKESTGGAYESYKFIPSLEAA-VKQAYASTVAAAPEVKYAVFEAA
           AFNKA-KE--GGAYE-YKFIPSLEA---KQAY--TVA-APEVKYAVFEA-
Sequence 2 AFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAG

Sequence 1 LTKAITAMSQAQKVAQPA----AAATGAATVAAGAAT------TAAGGYK
           LTKAITAMS-AQKVA-P-----AAA-GAAT-A-GAAT------T-AGGYK
Sequence 2 LTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYK

Sequence 1 V
           V
Sequence 2 V



Alignment 27
Sequence 1:
Sequence 2: Allergen Hor v 5.0101, Sequence: U57845
Sequence identity: 55.42 (133/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MANSGREHSAVPRRRNLVALVPRHGCYAEFSLYVCVGNINAPFPVFNRTT

Sequence 1 -------------------------QKLLEDVNASFKAAVAAAAKVPPAD
           --------------------------------------------K-----
Sequence 2 FIANAGIEAELEPHFLLLLFTFSSSSSFFTLLKTMIHFTDRSDNKNKAMM

Sequence 1 KYKTFLRAFT-VLDRGSTEQSKAEETKMPELSSKLVDAYMAAFKASTGGT
           ----F--AF--VL----T-Q-------M--LSS-L---Y--A-----G-T
Sequence 2 RGREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGAT

Sequence 1 QEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDK
           -EAKYDA-V-TLTE-LRVI-G-LEVH-VKPA-EEV-----PAG-L---D-
Sequence 2 PEAKYDAYVATLTESLRVISGTLEVHSVKPAAEEVKG--VPAGELKAIDQ

Sequence 1 IDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLE
           -DA-F--AATAA-AAPANDKFTVFE-----------GGAYESYKFIP-LE
Sequence 2 VDAAFRTAATAADAAPANDKFTVFESLQQGPSRKPRGGAYESYKFIPALE

Sequence 1 AAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAA
           AAVKQAYA-TVAAAPEVK--VF--AL-KAI-AM-QA-KVA-PAAAAT--A
Sequence 2 AAVKQAYAATVAAAPEVKFTVFQTALSKAINAMTQAGKVAKPAAAATATA

Sequence 1 TVAAGAATTAAGGYKV
           TVAAGAA-TA-G-YKV
Sequence 2 TVAAGAAATA-GNYKV



Alignment 28
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40240
Sequence identity: 50.42 (121/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWR

Sequence 1 -------QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTE
           ---------------------------------------------R-S--
Sequence 2 EGDDRRAEAAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSP

Sequence 1 QSKAEETKMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVI
           -S-A---K-P-L--KL--AY--A-KA--------------------LRVI
Sequence 2 TSAA---KAPGLIPKLDTAYDVAYKAAEAHPR-GQVRRLRHCPHRSLRVI

Sequence 1 AGALEVHAVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPAND
           AGALEVHAVKPATEEV-AAKIP-G-LQ-VDKIDA-FKIAATAANAAP-ND
Sequence 2 AGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTND

Sequence 1 KFTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKY
           KFTVFE-AFNKAL-E-TGGA-------P---------------AAPEVKY
Sequence 2 KFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKY

Sequence 1 AVFEAALTKAITAMSQAQKVAQPAAAA-TGAATVAAGAATTAAGGYKV--
           AVFEAALTKAITAM-QAQK---PAAAA-T-AATVA--AAT-AA-------
Sequence 2 AVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLL

Sequence 1 ------------
           ------------
Sequence 2 VVQSLISLLIYY



Alignment 29
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56165
Sequence identity: 42.50 (102/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP

Sequence 1 ------QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQ
           ---------------------AA---------------------------
Sequence 2 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRAD

Sequence 1 SKAEETKMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIA
           -----------SSK---A-M-------G-------DA-V--------VI-
Sequence 2 RLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHVIE

Sequence 1 GALEVHAVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDK
           -A-EV-------EEV----IPAG---V--K--A-F--AATAA--APANDK
Sequence 2 SAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAPANDK

Sequence 1 FTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYA
           FTVF---FNKA-KE-TGGAY--YKFIP-LEAAVKQAYA---A-APEVKYA
Sequence 2 FTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYA

Sequence 1 VFEAALTKAITAMSQAQKVAQPAAAATGAAT-VAAGAATTAAGGYKV---
           VFE-AL-KAI-AMS-AQK-A-PAAA---A-T---A--AT-AA--------
Sequence 2 VFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGT

Sequence 1 ------------
           ------------
Sequence 2 ATPAAVAGGYKV



Alignment 30
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56166
Sequence identity: 64.17 (154/240)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVQKYTVALFLAMALVAGPAASYAADAGTPPTPATPAVPGAAAGKATTH

Sequence 1 -QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEE
           -QKL-ED-NA-FK---A-A---PPADKYKTF--AF----------SKA--
Sequence 2 EQKLIEDINAAFKWWPASA---PPADKYKTFETAF----------SKAN-

Sequence 1 TKMPELSSKLVDA-YMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALE
           ------S-K--DA-Y--------G-T-EAKYD-FVT-LTEALR--AG-LE
Sequence 2 --IAGASTKGLDAAYSVVYNTAAGATPEAKYDSFVTALTEALRIMAGTLE

Sequence 1 VHAVKPATEE-VPAAKIPAGDLQVVDKIDASFKIAAT---------AANA
           VHAVKPATEE-VP-AKI--------------FKIAAT---------AAN-
Sequence 2 VHAVKPATEEEVPSAKILRANSRSSTR-SSRFKIAATVATPLSHSTAANS

Sequence 1 APANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAA
           APANDKFTVFE-AFNKA-KE--GG--E-YKFIPSLEAAVKQAY--TVA-A
Sequence 2 APANDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARA

Sequence 1 PEVKYAVFEAALTKAITAMSQAQKVAQPAA-----------AATGAATVA
           PEVKYAVFEA-LTKAITAMS-AQKVA-P-------------AA-GAATVA
Sequence 2 PEVKYAVFEAGLTKAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVA

Sequence 1 AGAATTAAGGYKV
           A--A----GGYKV
Sequence 2 A--ASDSRGGYKV



Alignment 31
Sequence 1:
Sequence 2: Allergen Phl p 6.0101, Sequence: P43215
Sequence identity: 24.58 (59/240)
Sequence 1 -----------------------------QKLLEDVNASFKAAVAAAAKV
           -----------------------------QKL-EDVNASF-AA-A--A-V
Sequence 2 MVAMFLAVAVVLGLATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANV

Sequence 1 PPADKYKTFLRAFTVLDRGSTEQSKAEE-TKMPELSSKLVDAYMAAFKAS
           PPADKYKTF--AFTV----S-----A----K-P-L--KL---Y-AA--A-
Sequence 2 PPADKYKTFEAAFTV----SSKRNLADAVSKAPQLVPKLDEVYNAAYNAA

Sequence 1 TGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQ
           -----E-KY-AFV----EALR-IAG--EVHAVKP----------------
Sequence 2 DHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA--------------

Sequence 1 VVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TGAATVAAGAATTAAGGYKV
           --------------------
Sequence 2 --------------------



Alignment 32
Sequence 1:
Sequence 2: Allergen Phl p 6.0102, Sequence: CAA76556
Sequence identity: 23.75 (57/240)
Sequence 1 -----------------------------------QKLLEDVNASFKAAV
           -----------------------------------QKL-ED-NASF-AA-
Sequence 2 MAAHKFMVAMFLAVAVVLGLATSPTAEGGKATTEEQKLIEDINASFRAAM

Sequence 1 AAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEE-TKMPELSSKLVDAYM
           A--A-VPPADKYKTF--AFTV----S-----A----K-P-L--KL---Y-
Sequence 2 ATTANVPPADKYKTFEAAFTV----SSKRNLADAVSKAPQLVPKLDEVYN

Sequence 1 AAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKI
           AA--A------E-KY-AFV----EAL--IAG--EVHAVKP----------
Sequence 2 AAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPEVHAVKPGA--------

Sequence 1 PAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPAAAATGAATVAAGAATTAAGGYKV
           --------------------------
Sequence 2 --------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.