The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Mor n 3.0101

Sequence P85894

Full FASTA alignment

Sequence name:
Query sequence:
ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Mor n 3.0101P85894Go!91132.81.4e-33
2Can s 3.0101W0U0V5Go!91109.11.9e-26
3Fra a 3.0201Q4PLU0Go!117108.92.9e-26
4Fra a 3.0202Q4PLT6Go!117108.34.4e-26
5Fra a 3.0101Q8VX12Go!117104.27.3e-25
6Fra a 3.0102Q4PLT9Go!117103.41.3e-24
7Rub i 3.0101Q0Z8V0Go!117103.41.3e-24
8Pru av 3Q9M5X8Go!117102.62.2e-24
9Mal d 3Q9M5X7Go!115101.83.9e-24
10Pru p 3CAB96876Go!91100.76.8e-24
11Pru d 3P82534Go!91100.76.8e-24
12Pru ar 3P81651Go!9198.62.8e-23
13Pru p 3P81402Go!9198.62.8e-23
14Pun g 1.0301A0A059ST23Go!12098.05.7e-23
15Cor a 8AAK28533Go!11597.48.4e-23
16Pha v 3.0201ADC80503Go!11897.01.1e-22
17Hev b 12AAL25839Go!11696.81.3e-22
18Pyr c 3Q9M5X6Go!11595.72.6e-22
19Pun g 1.0101A0A059STC4Go!12095.82.7e-22
20Pru du 3.0101ACN11576Go!12394.28.2e-22
21Pha v 3.0101ADC80502Go!11593.71.0e-21
22Ara h 9.0201ABX75045Go!9293.41.1e-21
23Ara h 9.0101ABX56711Go!11693.51.2e-21
24Pun g 1.0201A0A059SSZ0Go!12093.51.2e-21
25Lup an 3.0101XP_019446786Go!11693.11.6e-21
26Art si 3.0102ANC85027Go!11692.52.4e-21
27Art v 3.0202ACE07187Go!11692.52.4e-21
28Art ar 3.0102ANC85020Go!11692.52.4e-21
29Pla or 3.0101ABY21307Go!11892.32.8e-21
30Pla a 3.0101CAL07989Go!11891.55.0e-21
31Zea m 14.0101P19656-1Go!12091.35.8e-21
32Zea m 14.0102P19656-2Go!12890.61.1e-20
33Art si 3.0101ANC85026Go!11689.32.3e-20
34Art gm 3.0102ANC85023Go!11787.96.2e-20
35Art gm 3.0101ANC85022Go!11787.58.2e-20
36Art v 3.0201EU564845Go!11487.11.1e-19
37Art la 3.0102ANC85025Go!11587.11.1e-19
38Art la 3.0101ANC85024Go!11687.11.1e-19
39Art ar 3.0101ANC85019Go!11687.11.1e-19
40Art v 3.0301EU564847Go!11787.11.1e-19
41Lyc e 3AAB42069Go!11486.41.6e-19
42Sola l 3.0101P93224Go!11486.41.6e-19
43Art ca 3.0102QIN55516Go!11786.31.9e-19
44Tri tu 14.0101CAH69206Go!11585.23.8e-19
45Len c 3.0101A0AT29Go!11885.33.8e-19
46Ara h 17.0101A0A510A9S3Go!9384.93.8e-19
47Pis s 3.0101A0A161AT60Go!12085.33.9e-19
48Art an 3.0102ANC85018Go!11784.65.8e-19
49Art ca 3.0101ANC85021Go!11784.46.7e-19
50Art an 3.0101ANC85017Go!11784.46.7e-19
51Api g 2ACV04796Go!11884.08.9e-19
52Sin a 3.0101ABU95411Go!9278.82.5e-17
53Hor v 1AAA32970Go!11778.63.9e-17
54Hor v 1CAA42832Go!13478.16.4e-17
55Sola l 7.0101NP_001316123Go!11571.55.2e-15
56Tri a 14.010119846220Go!9069.91.2e-14
57Hel a 3.0101P82007Go!11666.91.3e-13
58Par j 2O04403Go!13351.85.2e-09
59Par j 2P55958Go!13350.01.8e-08
60Amb a 6O04004Go!11849.13.0e-08
61Par j 1Q40905Go!13849.23.3e-08
62Par j 1P43217Go!13949.03.8e-08
63Par j 1O04404Go!17648.95.0e-08
64Par j 1.0103CAI94601Go!13948.26.6e-08
65Par j 1.0101CAA54587Go!13344.39.2e-07
66Art v 3.0101P0C088Go!3740.73.1e-06
67Vit v 1P80274Go!3735.61.0e-04
68Cas s 810998016Go!3633.44.7e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 100.00 (91/91)
Sequence 1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
           ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
Sequence 2 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC

Sequence 1 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
Sequence 2 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK



Alignment 2
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 75.82 (69/91)
Sequence 1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
           ITCGQV-SSLAPC--YL--GG-VP--CCN---SL--AAKT-ADRQAAC-C
Sequence 2 ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKC

Sequence 1 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           LKSA--SIKG-N-NLA-GLPGKCGVS-PYKISPSTDC-SVK
Sequence 2 LKSAASSIKGVNFNLASGLPGKCGVSIPYKISPSTDCSSVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 75.82 (69/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           --------------------------ITCGQV-SS--PC-NY---GG-VP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CCNG-RSLN-AAKTTADRQA-CNCLK-A---IKGLN--LAAGLPGKCG
Sequence 2 AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCG

Sequence 1 VSVPYKISPSTDCKSVK
           VSVPYKIS-ST-C--VK
Sequence 2 VSVPYKISTSTNCAAVK



Alignment 4
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 74.73 (68/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           --------------------------ITCGQV-SS--PC-NY---GG-VP
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CCNG-RSLN-AAKTTADRQ--CNCLK-A---IKGLN-NLAAGLPGKCG
Sequence 2 AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCG

Sequence 1 VSVPYKISPSTDCKSVK
           V-VPYKIS-ST-C--VK
Sequence 2 VNVPYKISTSTNCAAVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 71.43 (65/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           --------------------------ITCGQV-S---PC--Y---GG-VP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CC-G-R-LN--AKTTADRQAACNCLK-A---IKGLN-NLAAGLPGKCG
Sequence 2 AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VSVPYKISPSTDCKSVK
           VSVPYKIS--T-C--VK
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 70.33 (64/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           --------------------------ITCGQV-S---PC--Y---GG-VP
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CC-G-R-LN--AKTTADRQA-CNCLK-A---IKGLN-NLAAGLPGKCG
Sequence 2 APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCG

Sequence 1 VSVPYKISPSTDCKSVK
           VSVPYKIS--T-C--VK
Sequence 2 VSVPYKISTTTNCAAVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 72.53 (66/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           --------------------------ITCGQV----APC-NY---GG-VP
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CCNGVR-LN--AKTTADRQ--CNCLK-A--SI-GLN--LAAGLPGKCG
Sequence 2 AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCG

Sequence 1 VSVPYKISPSTDCKSVK
           VSVPYKIS-ST-C--VK
Sequence 2 VSVPYKISTSTNCATVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 70.33 (64/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ---------------------------TCGQVSS-LAPCI-Y-R-GG-VP
Sequence 2 MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           --CCNG-R--NN-AKTTADRQ-ACNCLK----S--G-N-N-AA-LPGKCG
Sequence 2 PACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCG

Sequence 1 VSVPYKISPSTDCKSVK
           V-VPYKISPST-C--VK
Sequence 2 VNVPYKISPSTNCATVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 70.33 (64/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN
           ------------------------ITCGQV-SSLAPCI-Y-R-GG-VP--
Sequence 2 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA

Sequence 1 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS
           CCNG-R--N--A-TTADRQ-ACNCLK----SI-G-N-N-AAGLPGKCGV-
Sequence 2 CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVN

Sequence 1 VPYKISPSTDCKSVK
           VPYKIS-ST-C--VK
Sequence 2 VPYKISTSTNCATVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 70.33 (64/91)
Sequence 1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
           ITCGQVSSSLAPCI-Y-R-GG-VP--CCNG-R--NN-A-TT-DRQAACNC
Sequence 2 ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNC

Sequence 1 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           LK----S--G-N-N-AA-LPGKCGVS-PYKIS-ST-C--VK
Sequence 2 LKQLSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 70.33 (64/91)
Sequence 1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
           ITCGQVSS-LAPCINY---GG-VP--CCNG-R--NN-A-TTADR-AACNC
Sequence 2 ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNC

Sequence 1 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           LK----SI-G-N-N-AA-LPGKCGV-VPYKIS-ST-C--VK
Sequence 2 LKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 68.13 (62/91)
Sequence 1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
           ITCGQVSSSLAPCI-Y-R-GG-VP--CCNG-R--NN-A-TT-DR--ACNC
Sequence 2 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNC

Sequence 1 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           LK----SI-G-N-N-AA-LPGKCGV--PYKIS-ST-C--VK
Sequence 2 LKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 68.13 (62/91)
Sequence 1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
           ITCGQVSS-LAPCI-Y-R-GG-VP--CCNG-R--NN-A-TT-DRQAACNC
Sequence 2 ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNC

Sequence 1 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           LK----S--G-N-N-AA-LPGKCGV--PYKIS-ST-C--VK
Sequence 2 LKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 71.43 (65/91)
Sequence 1 ---------------------------ITCGQVSSSLAPCINYLRAGGV-
           ---------------------------ITCGQVSSSLA-CI-Y-R--G--
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 -VPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPG
           -VP--CCNG-RSLN-AAKTT-DRQAAC-CLKS---SI-G-N--L-AG-PG
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG

Sequence 1 KCGVSVPYKISPSTDCKSVK
           KCGVS-PYKI-PST-C--VK
Sequence 2 KCGVSIPYKIAPSTNCDNVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 62.64 (57/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN
           -------------------------TC-Q----L-PC--YL--GGV-P--
Sequence 2 MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS

Sequence 1 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS
           CC-GVR--N-A--TT-DRQ-ACNCLK-----I-GLN-NLAAGLPGKCGV-
Sequence 2 CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVN

Sequence 1 VPYKISPSTDCKSVK
           -PYKISPST-C--VK
Sequence 2 IPYKISPSTNCNNVK



Alignment 16
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 69.23 (63/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           --------------------------I-CGQV-SSLA-CI--L--GG-VP
Sequence 2 MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CC-GVRSLN-AAKTT-DRQA-CNCLKSA---I-G-N-N-A--LPGKCG
Sequence 2 ASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCG

Sequence 1 VSVPYKISPSTDCKSVK-
           VS-PYKIS-ST-C---K-
Sequence 2 VSIPYKISTSTNCATIKF



Alignment 17
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 68.13 (62/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVP-A
           ------------------------ITCGQV-S-L-PC--YL---G--P-A
Sequence 2 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA

Sequence 1 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV
           -CCNGVR--NNAAKTTADR--AC-CLKSA--S-KGLN----AGLPGKCGV
Sequence 2 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV

Sequence 1 SVPYKISPSTDCKSVK
           --PYKIS-ST-C--VK
Sequence 2 NIPYKISLSTNCATVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 64.84 (59/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN
           ------------------------ITC-QVS--LAPCINY-R-GG-VP--
Sequence 2 MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVPPA

Sequence 1 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS
           CCNG----N--AKTT-DRQAACNCLK----S--G-N---A--LPGKCGV-
Sequence 2 CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVN

Sequence 1 VPYKISPSTDCKSVK
           VPYKIS-ST-C--VK
Sequence 2 VPYKISTSTNCATVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 65.93 (60/91)
Sequence 1 ----------------------------ITCGQVSSSLAPCINYLR-AGG
           -----------------------------TCGQV-SSLAPCI-Y-R-AGG
Sequence 2 MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGG

Sequence 1 VVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPG
           -VP--CC-G---L---A-TT-DRQA-C-CLKSA--SI-G-N--L-A-LP-
Sequence 2 AVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLPA

Sequence 1 KCGVSVPYKISPSTDCKSVK
           KCGV--PYKISPSTDC--VK
Sequence 2 KCGVNIPYKISPSTDCARVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 64.84 (59/91)
Sequence 1 ------------------------------ITCGQVSSSLAPCINYLRAG
           --------------------------------CGQV---L-PCINY---G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLN--LAAG
           G-----CC-GVRSL---A-TTADRQ--CNCLK-A-N-I---N-N--LAAG
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 LPGKCGVSVPYKISPSTDCKSVK
           LPGKCGV--PYKISPSTDCK--K
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK



Alignment 21
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 59.34 (54/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN
           -------------------------TCGQV-S-L-PC---L--GG-VPA-
Sequence 2 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG

Sequence 1 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS
           CCNGVR---N-A--TADR---CNCLK-A-----GLN-N-A--LPGKCGV-
Sequence 2 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN

Sequence 1 VPYKISPSTDCKSVK
           -PYKIS-ST-C-S--
Sequence 2 IPYKISTSTNCASIN



Alignment 22
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 64.84 (59/91)
Sequence 1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
           --CGQV-S-LAPCI--L--GGV----CC-GVR-L--AAKTTADRQAACNC
Sequence 2 LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNC

Sequence 1 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK-
           LK-A--S--GLN---AA-LPG-CGVS-PYKIS-ST-C---K-
Sequence 2 LKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF



Alignment 23
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 63.74 (58/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN
           ------------------------I-CGQV-S-LAPCI--L--GG--P--
Sequence 2 MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPA

Sequence 1 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS
           CC-GVR-L--A--TTADRQAACNCLK-A--S--GLN---AA-LPG-CGVS
Sequence 2 CCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVS

Sequence 1 VPYKISPSTDCKSVK-
           -PYKIS-ST-C---K-
Sequence 2 IPYKISTSTNCATIKF



Alignment 24
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 68.13 (62/91)
Sequence 1 ----------------------------ITCGQVSSSLAPCINYLRAGGV
           -----------------------------TCGQV-SSL-PCI-Y-R----
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 VP-ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPG
           -P-A-CC-GVRSLNNAAKTT-DRQ-ACNCLK----SI-G-N------LPG
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGVSVPYKISPSTDCKSVK
           KCGVS-PYKISPSTDC--VK
Sequence 2 KCGVSIPYKISPSTDCSRVK



Alignment 25
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 62.64 (57/91)
Sequence 1 -------------------------ITCGQVSSSLAPCINYLRAGGVVPA
           -------------------------ITCGQV---LA-C-NYLR-GG-VPA
Sequence 2 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA

Sequence 1 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV
           -CCNG-----N-AKTT-DR--ACNCLK-A-----GLN---A--LPGKCGV
Sequence 2 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV

Sequence 1 SVPYKISPSTDCKSVK
           --PYKIS-ST-C-S-K
Sequence 2 NIPYKISTSTNCASIK



Alignment 26
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 61.54 (56/91)
Sequence 1 -------------------------ITCGQVSSSLAPCINYLRAGGVVPA
           --------------------------TC--VS----PC-NYL--GG-VPA
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV
           -CC-GV--LN-AAKTT-DRQ-ACNCLK--F-S-K-L----AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 SVPYKISPSTDCKSVK
           --PYKIS--TDC--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 61.54 (56/91)
Sequence 1 -------------------------ITCGQVSSSLAPCINYLRAGGVVPA
           --------------------------TC--VS----PC-NYL--GG-VPA
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV
           -CC-GV--LN-AAKTT-DRQ-ACNCLK--F-S-K-L----AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 SVPYKISPSTDCKSVK
           --PYKIS--TDC--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 28
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 61.54 (56/91)
Sequence 1 -------------------------ITCGQVSSSLAPCINYLRAGGVVPA
           --------------------------TC--VS----PC-NYL--GG-VPA
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV
           -CC-GV--LN-AAKTT-DRQ-ACNCLK--F-S-K-L----AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGV

Sequence 1 SVPYKISPSTDCKSVK
           --PYKIS--TDC--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 63.74 (58/91)
Sequence 1 ---------------------------ITCGQVSSSLAPCINYLRAGGVV
           ---------------------------ITCG-V---L-PC--YLR-GG-V
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 PANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC
           ---CCNGV--LNN-AKTT-DRQAAC-CLK-A--SI-G--L--AA-L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVSVPYKISPSTDCKSVK
           GV--PYKISP--DC--VK
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 62.64 (57/91)
Sequence 1 ---------------------------ITCGQVSSSLAPCINYLRAGGVV
           ---------------------------ITCG-V---L-PC---LR-GG-V
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 PANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC
           ---CCNGV--LNN-AKTT-DRQAAC-CLK-A--SI-G--L--AA-L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVSVPYKISPSTDCKSVK
           GV--PYKISP--DC--VK
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 64.84 (59/91)
Sequence 1 ----------------------------ITCGQVSSSLAPCINYLRAGGV
           ----------------------------I-CGQV-S--APCI-Y-R--G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VP-ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPG
           -P-A-CC-GVRSLNNAA-TTADR-AACNCLK-A-----GLN---AA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVSVPYKISPSTDCKSVK
           KCGVS-PY-IS-STDC--V-
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 32
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 63.74 (58/91)
Sequence 1 ----------------------------ITCGQVSSSLAPCINYLRAGGV
           ----------------------------I-CGQV-S--APCI-Y-R--G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VP-ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPG
           -P-A-CC-GVRSLNNAA-TTADR-AACNCLK-A-----GLN---AA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVSVPYKISPSTDCKSVK--------
           KCGVS-PY-IS-STDC------------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 33
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 58.24 (53/91)
Sequence 1 -------------------------ITCGQVSSSLAPCINYLRAGGVVPA
           --------------------------TC--VS----PC-NYL--GG-VPA
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPA

Sequence 1 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV
           NCC-GV--LN-AAKTT-DRQ-AC-CLK--F---K-L----A--LP-KCGV
Sequence 2 NCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGV

Sequence 1 SVPYKISPSTDCKSVK
           --PYK-S--TDC--VK
Sequence 2 TIPYKLSMETDCNKVK



Alignment 34
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 58.24 (53/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ---------------------------TC--VS----PC---L--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CC-GV--LN-AAKTT-DRQ-ACNCLK--F-S-K-L----A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCG

Sequence 1 VSVPYKISPSTDCKSVK
           V--PYKIS--TDC--VK
Sequence 2 VNIPYKISLETDCNKVK



Alignment 35
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 58.24 (53/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ---------------------------TC--VS----PC---L--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CC-GV--LN-AAKTT-DRQ-ACNCLK--F-S-K------AA-LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCG

Sequence 1 VSVPYKISPSTDCKSVK
           V--PYKIS--TDC--VK
Sequence 2 VNIPYKISLETDCNKVK



Alignment 36
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 57.14 (52/91)
Sequence 1 -----------------------ITCGQVSSSLAPCINYLRAGGVVPANC
           -------------------------C--VS-----C--YL--GG-VPA-C
Sequence 2 MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADC

Sequence 1 CNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSV
           C-GV--LN-AAKTT-DRQ-ACNCLK--F-S-K------AA-LP-KCGV--
Sequence 2 CTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNI

Sequence 1 PYKISPSTDCKSVK
           PYKIS--TDC--VK
Sequence 2 PYKISLETDCNKVK



Alignment 37
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 56.04 (51/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN
           -------------------------TC--VS----PC--YL--GG-VPA-
Sequence 2 MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPAD

Sequence 1 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS
           CC-GV--LN-A-KTT-DRQ-ACNCLK--F-S-K-L----A--LP-KCG--
Sequence 2 CCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLN

Sequence 1 VPYKISPSTDCKSVK
           -PYK-S--TDC--VK
Sequence 2 LPYKLSLETDCNKVK



Alignment 38
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 57.14 (52/91)
Sequence 1 -------------------------ITCGQVSSSLAPCINYLRAGGVVPA
           ---------------------------C--VS-----C--YL--GG-VPA
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV
           -CC-GV--LN-AAKTT-DRQ-ACNCLK--F-S-K------AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGV

Sequence 1 SVPYKISPSTDCKSVK
           --PYKIS--TDC--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 39
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 57.14 (52/91)
Sequence 1 -------------------------ITCGQVSSSLAPCINYLRAGGVVPA
           ---------------------------C--VS-----C--YL--GG-VPA
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV
           -CC-GV--LN-AAKTT-DRQ-ACNCLK--F-S-K------AA-LP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGV

Sequence 1 SVPYKISPSTDCKSVK
           --PYKIS--TDC--VK
Sequence 2 NIPYKISLETDCNKVK



Alignment 40
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 56.04 (51/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ---------------------------TC--VS----PC--YL--GG-VP
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CC-GV--LN-A-KTT-DRQ-ACNCLK--F-S-K-L----A--LP-KCG
Sequence 2 ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCG

Sequence 1 VSVPYKISPSTDCKSVK
           ---PYK-S--TDC--VK
Sequence 2 LNLPYKLSLETDCNKVK



Alignment 41
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 59.34 (54/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN
           --------------------------CG-V-S-LAPC--YL---G-----
Sequence 2 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GG

Sequence 1 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS
           CC-GV--L--AAKT--DR--AC-CLKSA-NSIKG-----AAGLPG-CGV-
Sequence 2 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN

Sequence 1 VPYKISPSTDCKSVK
           -PYKISPSTDC--V-
Sequence 2 IPYKISPSTDCSTVQ



Alignment 42
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 59.34 (54/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN
           --------------------------CG-V-S-LAPC--YL---G-----
Sequence 2 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GG

Sequence 1 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS
           CC-GV--L--AAKT--DR--AC-CLKSA-NSIKG-----AAGLPG-CGV-
Sequence 2 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVN

Sequence 1 VPYKISPSTDCKSVK
           -PYKISPSTDC--V-
Sequence 2 IPYKISPSTDCSTVQ



Alignment 43
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 57.14 (52/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ---------------------------TC--VS----PC---L--GG-VP
Sequence 2 MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CC-GV--LN-AAKT--DRQ-ACNCLK--F-S-K-L----A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCG

Sequence 1 VSVPYKISPSTDCKSVK
           V--PYKIS--TDC--VK
Sequence 2 VNIPYKISLETDCNTVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 59.34 (54/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ----------------------------CGQVSS-L-PCI-Y-R--G--P
Sequence 2 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP

Sequence 1 -ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC
           -A-CC-GVRSL---A--TAD-QAAC-C-KSA-----GLN---AAG-P-KC
Sequence 2 SAACCSGVRSLASSARSTADKQAACKCIKSA---AAGLNAGKAAGIPTKC

Sequence 1 GVSVPYKISPSTDCKSVK
           GVSVPY-IS-S-DC----
Sequence 2 GVSVPYAISSSVDCSKIR



Alignment 45
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 62.64 (57/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAG-GVV
           --------------------------I-CG-V-S-L-PC--YL--G-G--
Sequence 2 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS

Sequence 1 PANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC
           P--CC-GV--L--AA-TT-DRQAACNCLKSA--SI--LN-N-AA-LPGKC
Sequence 2 P-QCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC

Sequence 1 GVSVPYKISPSTDCKSVK-
           GV--PYKIS--T-C--VK-
Sequence 2 GVNIPYKISTTTNCNTVKF



Alignment 46
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 58.24 (53/91)
Sequence 1 -ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACN
           -I-C--V--S-APC--YL--GG-V---CC-G----N--AKTT-DRQA-CN
Sequence 2 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN

Sequence 1 CLKSAFNSIKG-LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           CLKSA--S-----N-N-AA-LPGKCGVS-PYKIS-S--C-S-K
Sequence 2 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK



Alignment 47
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 61.54 (56/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVV-
           ----------------------------CG-VS---APC--YL-A-----
Sequence 2 MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNAS

Sequence 1 -PANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGK
           -P--CC-GV--L--AA-TT-DRQAACNCLKSA--SI--LN-N-AA-LPGK
Sequence 2 PPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGK

Sequence 1 CGVSVPYKISPSTDCKSVK-
           CGVS-PYKIS-ST-C--V--
Sequence 2 CGVSIPYKISTSTNCNTVRF



Alignment 48
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 56.04 (51/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ---------------------------TC--V-----PC---L--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVP

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           --CC-GV--LN-AAKTT-DRQAACNCLK--F-S--------AA-LP-KCG
Sequence 2 VDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCG

Sequence 1 VSVPYKISPSTDCKSVK
           V--PYKIS--TDC--VK
Sequence 2 VNIPYKISLETDCNKVK



Alignment 49
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 57.14 (52/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ---------------------------TC--VS----PC---L--GG-V-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CC-GV--LN-AAKTT-DRQAACNCLK--F-S-K------A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 VSVPYKISPSTDCKSVK
           V--PYKIS--TDC--VK
Sequence 2 VNIPYKISLETDCNKVK



Alignment 50
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 57.14 (52/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ---------------------------TC--VS----PC---L--GG-V-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           A-CC-GV--LN-AAKTT-DRQAACNCLK--F-S-K------A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 VSVPYKISPSTDCKSVK
           V--PYKIS--TDC--VK
Sequence 2 VNIPYKISLETDCNKVK



Alignment 51
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 53.85 (49/91)
Sequence 1 ---------------------------ITCGQVSSSLAPCINYLRAGGVV
           ----------------------------TCGQV---L--C--YL--GG--
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP

Sequence 1 PANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC
           ---CC-GV--LN--AKT-ADR--AC-CLK----S-KG-N---A--LPGKC
Sequence 2 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC

Sequence 1 GVSVPYKISPSTDCKSVK
           G---PY-ISPSTDC--V-
Sequence 2 GIRIPYPISPSTDCSRVN



Alignment 52
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 54.95 (50/91)
Sequence 1 -ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACN
           ---CG-V-S-LA-CI-YL------P--CC-GV--LNN-A-TT-DRQ-AC-
Sequence 2 ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACR

Sequence 1 CLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           CL--A-NS---LN---AA-LP--CGV--PYKIS-ST-C-SV-
Sequence 2 CLVGAANSFPSLNAARAAALPKACGVNIPYKISKSTNCNSVR



Alignment 53
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 49.45 (45/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ----------------------------CGQV-S---PC--Y---G----
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           --CCNGVR-L-N-A----DRQ--CNCLK-----I--LNLN-AA--P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VSVPYKISPSTDCKSVK
           V-VPY-ISP--DC----
Sequence 2 VNVPYTISPDIDCSRIY



Alignment 54
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 49.45 (45/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           ----------------------------CGQV-S---PC--Y---G----
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           --CCNGVR-L-N-A----DRQ--CNCLK-----I--LNLN-AA--P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VSVPYKISPSTDCKSVK-----------------
           V-VPY-ISP--DC---------------------
Sequence 2 VNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 55
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 45.05 (41/91)
Sequence 1 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN
           ------------------------ITCGQV---LAPC---L--GG---A-
Sequence 2 MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAA

Sequence 1 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS
           CC-GVR-LN-------DR--ACNC-K-A-N----L----A--LP-KCG-S
Sequence 2 CCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGIS

Sequence 1 VPYKISPSTDCKSVK
           ----IS----C----
Sequence 2 LTVPISRTVNCDTIS



Alignment 56
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 45.05 (41/91)
Sequence 1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNC
           I-CG-V-S---PC--Y---G------CC-GV--L-N-A----DRQ-ACNC
Sequence 2 IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNC

Sequence 1 LKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           LK-----I--LN---A---P-KCGV--PY-IS---DC--V-
Sequence 2 LKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-



Alignment 57
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 41.76 (38/91)
Sequence 1 --------------------------ITCGQVSSSLAPCINYLRAGGVVP
           --------------------------ITC--V---L-PC--YLR-GG---
Sequence 2 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT

Sequence 1 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG
           --CC-G---L--A--T-ADR--AC-C-K-A----K------A--LPGKCG
Sequence 2 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG

Sequence 1 VSVPYKISPSTDCKSVK
           -S----I-P---C----
Sequence 2 ISTSIPINPNVNCNTIP



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 30.77 (28/91)
Sequence 1 --------------------------------ITCGQVSSSLAPCINYLR
           ----------------------------------CG-V-----PC-----
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 AGGVVPA-NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAA
           -----P---CC-G---L----KTT-----AC-C---A---I-G----L-A
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 GLPGKCGVSVPYK-ISPSTDCKSVK--------
           --P-KCG-------I----DC------------
Sequence 2 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 30.77 (28/91)
Sequence 1 --------------------------------ITCGQVSSSLAPCINYLR
           ----------------------------------CG-V-----PC-----
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 AGGVVPAN-CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAA
           -----P---CC-G---L----KTT-----AC-C---A---I-G----L-A
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 GLPGKCGV--SVPYKISPSTDCKSVK--------
           --P-KC------P--I----DC------------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 39.56 (36/91)
Sequence 1 ---------------------------ITCGQVSSSLAPCINYLRAGGVV
           ----------------------------TC--V---LAPC---L---G--
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLT--GQE

Sequence 1 PAN-CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGK
           P---CC-GV--LNN--KT-ADR-A-CNC-K----SI----------L--K
Sequence 2 PSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AYDPKRMPLLSTK

Sequence 1 CGVSVPYK-ISPSTDCKSVK-
           CGV-----------DC-----
Sequence 2 CGVKPDFPAVDKNLDCSKLPV



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 31.87 (29/91)
Sequence 1 -------------------------------------ITCGQVSSSLAPC
           --------------------------------------TCG-V---L-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 INYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLN
           ----------P---CC-G---L----KT---R--AC-C---A--------
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 LNLAAGLPGKCGVSVPYKISP---STDCKSVK-------
           --L----P--CG--V--K--P-----DCK----------
Sequence 2 GKLVSEVPKHCGI-VDSKLPPIDVNMDCKTLGVLHYKGN



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 31.87 (29/91)
Sequence 1 -ITCGQVSSSLAPCINYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAAC
           --TCG-----L-PC----------P---CC-G---L----KT---R--AC
Sequence 2 QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHAC

Sequence 1 NCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISP---STDCKSVK----
           -C---A----------L----P--CG--V--K--P-----DCK-V-----
Sequence 2 ECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTVGVVPR

Sequence 1 ----------------------------------------
           ----------------------------------------
Sequence 2 QPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 31.87 (29/91)
Sequence 1 --------------------------------------ITCGQVSSSLAP
           ---------------------------------------TCG-V---L-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CINYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGL
           C----------P---CC-G---L----KT---R--AC-C---A-------
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NLNLAAGLPGKCGVSVPYKISP---STDCKSVK-----------------
           ---L----P--CG--V--K--P-----DCK--------------------
Sequence 2 DGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 30.77 (28/91)
Sequence 1 -ITCGQVSSSLAPCINYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAAC
           --TCG-----L-PC----------P---CC-G---L----KT---R--AC
Sequence 2 QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHAC

Sequence 1 NCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISP---STDCKSVK----
           -C---A----------L----P--CG--V--K--P-----DCK-------
Sequence 2 ECIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTLGVVPR

Sequence 1 ----------------------------------------
           ----------------------------------------
Sequence 2 QPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 28.57 (26/91)
Sequence 1 ITCGQVSSSLAPCINYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAACN
           ---------L-PC----------P---CC-G---L----KT---R--AC-
Sequence 2 -----MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACE

Sequence 1 CLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISP---STDCKSVK-----
           C---A----------L----P--CG--V--K--P-----DCK-V------
Sequence 2 CIQTAMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTVGVVPRQ

Sequence 1 ---------------------------------------
           ---------------------------------------
Sequence 2 PQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 20.88 (19/91)
Sequence 1 -ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACN
           --TC--VS----PC--YL--GG-VPA-CC-GV--LN--------------
Sequence 2 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------

Sequence 1 CLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           ------------------------------------------
Sequence 2 ------------------------------------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 20.88 (19/91)
Sequence 1 -ITCGQVSSSLAPCINYLRAGGVVPA-NCCNGVRSLNNAAKTTADRQAAC
           --TCGQV-S-L-PCI-YL---G-VPA--CC----S---------------
Sequence 2 TVTCGQVASALSPCIDYLQKDGAVPAGSCCXKXLSSA-------------

Sequence 1 NCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           -------------------------------------------
Sequence 2 -------------------------------------------



Alignment 68
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 19.78 (18/91)
Sequence 1 -ITCGQVSSSLAPCINYLRAGGVV--PANCCNGVRSLNNAAKTTADRQAA
           -ITC-QVS-SL-PC--YL---G----P--CC-GV----------------
Sequence 2 SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVKL--------------

Sequence 1 CNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK
           --------------------------------------------
Sequence 2 --------------------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.