The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Poly s 5.0101

Sequence Q7Z156

Full FASTA alignment

Sequence name:
Query sequence:
NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
QPIYTKK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Poly s 5.0101Q7Z156Go!207314.81.2e-87
2Poly p 5.0101C0HJV9Go!206308.69.0e-86
3Poly p 5.0102P86686Go!207295.67.3e-82
4Pol g 5P83377Go!206254.12.3e-69
5Pol d 5P81656Go!206253.43.6e-69
6Pol f 5P35780Go!205251.71.2e-68
7Pol e 5.0101P35759Go!205249.84.5e-68
8Pol a 5Q05109Go!209249.65.3e-68
9Pol e 5.0101AAT95009Go!226246.45.3e-67
10Dol m 5.02P10737Go!215208.51.3e-55
11Dol m 5.02AAA28302Go!212206.84.1e-55
12Dol a 5Q05108Go!203205.01.3e-54
13Vesp c 5P35781Go!202200.33.6e-53
14Ves m 5P35760Go!204199.46.6e-53
15Ves v 5Q05110Go!227198.81.1e-52
16Dol m 5.0101P10736Go!227198.81.1e-52
17Vesp v 5.0101P0DMB9Go!202197.72.2e-52
18Ves f 5P35783Go!204197.22.9e-52
19Ves p 5P35785Go!204196.64.6e-52
20Ves s 5P35786Go!205196.26.3e-52
21Vesp m 5P81657Go!202195.31.1e-51
22Vesp c 5P35782Go!202195.11.3e-51
23Ves g 5P35784Go!204195.11.3e-51
24Ves vi 5P35787Go!206193.15.1e-51
25Sol r 3P35779Go!211152.31.0e-38
26Sol i 3P35778Go!234151.02.7e-38
27Pac c 3.0101C0ITL3Go!199148.11.7e-37
28Sco m 5.0101QEA69430Go!21084.62.4e-18
29Cte f 2AAF65314Go!26470.26.5e-14
30Sol s 3.0101ABC58726Go!9062.16.1e-12
31Sol g 3.0101AAY32926Go!7057.21.4e-10
32Glo m 5AAF82096Go!25954.24.2e-09
33Tab y 5.0101ADM18345Go!25652.31.6e-08
34Art gm 2.0101AVD29825Go!16351.22.2e-08
35Art an 2.0101AVD29822Go!16351.22.2e-08
36Art si 2.0101AVD29827Go!16351.02.5e-08
37Art ar 2.0101A0A2L1DGQ3Go!16351.02.5e-08
38Art la 2.0101AVD29826Go!16351.02.5e-08
39Cyn d 24.0101AAU15051Go!15350.72.8e-08
40Art ca 2.0101AVD29824Go!16349.95.3e-08
41Pol m 5.01017065471Go!3743.31.2e-06
42Pru p 9.0101XP_007199020Go!16138.21.7e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Poly s 5.0101, Sequence: Q7Z156
Sequence identity: 100.00 (207/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
Sequence 2 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
Sequence 2 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
           KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
Sequence 2 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG

Sequence 1 QPIYTKK
           QPIYTKK
Sequence 2 QPIYTKK



Alignment 2
Sequence 1:
Sequence 2: Allergen Poly p 5.0101, Sequence: C0HJV9
Sequence identity: 98.55 (204/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           NKYCNIKCSKVAHTVCQYGESTKPSSK-CNKVSITSVGVTEEEKKLIVDE
Sequence 2 NKYCNIKCSKVAHTVCQYGESTKPSSK-CNKVSITSVGVTEEEKKLIVDE

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWA-QCQFF
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFF

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
Sequence 2 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
           KENF-KVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
Sequence 2 KENFSKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG

Sequence 1 QPIYTKK
           QPIYTKK
Sequence 2 QPIYTKK



Alignment 3
Sequence 1:
Sequence 2: Allergen Poly p 5.0102, Sequence: P86686
Sequence identity: 93.72 (194/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           NKYCNIKCSKVAHTVCQ-GESTKPSSKNC-KVSITSVGVTEEEKKLIVDE
Sequence 2 NKYCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDE

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWA-QCQFF
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFF

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           VHDKCRNTAQYQVGQNIAYSASTAAYPG-V-LIVLWENEVKDFNY--GIT
Sequence 2 VHDKCRNTAQYQVGQNIAYSASTAAYPGVVKLIVLWENEVKDFNYNTGIT

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
           KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGN--G
Sequence 2 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNVLG

Sequence 1 QPIYTKK
           --IY--K
Sequence 2 AQIYEIK



Alignment 4
Sequence 1:
Sequence 2: Allergen Pol g 5, Sequence: P83377
Sequence identity: 77.78 (161/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           N-YC-IKCS---HTVCQYGESTKPS-KNC----I-SVG-TEEEKKLIV-E
Sequence 2 NDYCKIKCSSGVHTVCQYGESTKPS-KNCAGKVIKSVGPTEEEKKLIVEE

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HNRFRQKVAQGLETRGNPGPQPAAS-MNNLVWNDE-A-IAQVWA-QCQ--
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQIL

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           VHDKCRNT--YQVGQNIAY--S----P----LI-LWENEVKDFNY--GIT
Sequence 2 VHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGIT

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
           --NF-KVGHYTQ-VW--TKEVGCGS-KY-EK-MK-HYL-CNYGPAGNY-G
Sequence 2 NKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMKIHYLICNYGPAGNYLG

Sequence 1 QPIYTKK
           QPIYTKK
Sequence 2 QPIYTKK



Alignment 5
Sequence 1:
Sequence 2: Allergen Pol d 5, Sequence: P81656
Sequence identity: 77.29 (160/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           N-YC-IKCS---HTVCQYGESTKPS-KNC----I-SVG-TEEEKKLIV-E
Sequence 2 NDYCKIKCSSGVHTVCQYGESTKPS-KNCAGKLIKSVGPTEEEKKLIVEE

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HNRFRQKVA-GLETRGNPGPQPAAS-MNNLVWNDELA-IAQVWA-QCQ--
Sequence 2 HNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQIL

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           VHDKCRNT--YQVGQNIAY--S----P----LI-LWENEVKDFNY--GIT
Sequence 2 VHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGIT

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
           --NF-KVGHYTQ-VW--TKEVGCGS-KY-EK-M--HYL-CNYGPAGNY-G
Sequence 2 NKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLG

Sequence 1 QPIYTKK
           QPIYTKK
Sequence 2 QPIYTKK



Alignment 6
Sequence 1:
Sequence 2: Allergen Pol f 5, Sequence: P35780
Sequence identity: 77.78 (161/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           --YC-IKCS---HTVCQYGESTKPS-KNC----I-SVG-TEEEKKLIV-E
Sequence 2 VDYCKIKCSSGIHTVCQYGESTKPS-KNCADKVIKSVGPTEEEKKLIVNE

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELA-IAQVWA-QCQ--
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQIL

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           VHDKCRNTA-YQVGQNIAY-A-----P--VSLI-LWENEVKDFNY--GIT
Sequence 2 VHDKCRNTAKYQVGQNIAY-AGGSKLPDVVSLIKLWENEVKDFNYNKGIT

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
           K-NF-KVGHYTQ--WAKTKE-GCGS-KY----M--HYL-CNYGPAGNY-G
Sequence 2 KQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLG

Sequence 1 QPIYTKK
           Q--YTKK
Sequence 2 QLPYTKK



Alignment 7
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: P35759
Sequence identity: 77.78 (161/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           --YC-IKC----HTVCQYGESTKPS-KNC----I-SVG-TEEEKKLIV-E
Sequence 2 VDYCKIKCPSGIHTVCQYGESTKPS-KNCAGKVIKSVGPTEEEKKLIVSE

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HNRFRQKVAQGLETRGNPGPQPAASDMN-LVWNDELA-IAQVWA-QCQF-
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFL

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           VHDKCRNTA-Y-VGQNIAY-A-----P--VSLI-LWENEVKDFNY--GIT
Sequence 2 VHDKCRNTAKYPVGQNIAY-AGGSKLPDVVSLIKLWENEVKDFNYNTGIT

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
           K-NFAK-GHYTQ-VW-KTKE-GCGS-KYIE--M--HYL-CNYGPAGNY-G
Sequence 2 KQNFAKIGHYTQMVWGKTKEIGCGSLKYIENKMQNHYLICNYGPAGNYLG

Sequence 1 QPIYTKK
           Q--YTKK
Sequence 2 QLPYTKK



Alignment 8
Sequence 1:
Sequence 2: Allergen Pol a 5, Sequence: Q05109
Sequence identity: 77.29 (160/207)
Sequence 1 ----NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKL
           ------YC-IKC----HTVCQYGESTKPS-KNC----I-SVG-TEEEKKL
Sequence 2 SSQGVDYCKIKCPSGIHTVCQYGESTKPS-KNCAGKVIKSVGPTEEEKKL

Sequence 1 IVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQ
           IV-EHNRFRQKVAQGLETRGNPGPQPAASDMN-LVWNDELA-IAQVWA-Q
Sequence 2 IVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQ

Sequence 1 CQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYS
           CQF-VHDKCRNTA-Y-VGQNIAY-A-----P--VSLI-LWENEVKDFNY-
Sequence 2 CQFLVHDKCRNTAKYPVGQNIAY-AGGSNLPDVVSLIKLWENEVKDFNYN

Sequence 1 QGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAG
           -GITK-NFAK-GHYTQ-VW-KTKE-GCGS-KY-E--M--HYL-CNYGPAG
Sequence 2 TGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENNMQNHYLICNYGPAG

Sequence 1 NYMGQPIYTKK
           NY-GQ--YTKK
Sequence 2 NYLGQLPYTKK



Alignment 9
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: AAT95009
Sequence identity: 76.33 (158/207)
Sequence 1 ---------------------NKYCNIKCSKVAHTVCQYGESTKPSSKNC
           -----------------------YC-I-C----HTVCQYGESTKPS-KNC
Sequence 2 MEIGGLVYLVIVVAIIHSSQGVDYCKIRCPSGIHTVCQYGESTKPS-KNC

Sequence 1 NKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASDMNN
           ----I-SVG-TEEEKKLIV-EHNRFRQKVAQGLETRGNPGPQPAASDMN-
Sequence 2 AGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMND

Sequence 1 LVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGI
           LVWNDELA-IAQVWA-QCQF-VHDKCRNTA-Y-VGQNIAY-A-----P--
Sequence 2 LVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY-AGGSKLPDV

Sequence 1 VSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYI
           VSLI-LWENEVKDFNY--GITK-NFAK-GHYTQ-VW-KTKE-GCGS-KY-
Sequence 2 VSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM

Sequence 1 EKGMKSHYLVCNYGPAGNYMGQPIYTKK
           E--M--HYL-CNYGPAGNY-GQ---TKK
Sequence 2 ENKMQNHYLICNYGPAGNYLGQLPNTKK



Alignment 10
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: P10737
Sequence identity: 63.29 (131/207)
Sequence 1 ----------NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVT
           ----------N-YC-IKCS---HT-C--G-S-KP---NC--------GV-
Sequence 2 PIINLSFGEANNYCKIKCSRGIHTLCKFGTSMKP---NCGSKLVKVHGVS

Sequence 1 EEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIA
           --EK--IV--HN-FRQKVA-GLETRGNPGPQP-A--MN-LVWNDELA-IA
Sequence 2 NDEKNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIA

Sequence 1 QVWANQCQFFVHDKCRNTAQYQVGQNIAYSASTA-AYPGIVSLIVLWENE
           Q-WANQC-F--HD-CRNT--YQVGQN-A----T---Y-----LI--WENE
Sequence 2 QTWANQCSFG-HDQCRNTEKYQVGQNVAIASTTGNSYATMSKLIEMWENE

Sequence 1 VKDFNYSQG-ITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYL
           VKDFN---G-----NF-KVGHYTQ-VW-KTKE-GCGS-KYIE-----HYL
Sequence 2 VKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYL

Sequence 1 VCNYGPAGNYMGQPIYTKK
           VCNYGPAGNYM-QPIY--K
Sequence 2 VCNYGPAGNYMDQPIYERK



Alignment 11
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: AAA28302
Sequence identity: 62.80 (130/207)
Sequence 1 ----------NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVT
           ----------N-YC-IKCS---HT-C--G-S-KP---NC--------GV-
Sequence 2 PIINLSFGEANNYCKIKCSRGIHTLCKFGTSMKP---NCGSKLVKVHGVS

Sequence 1 EEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIA
           --EK--IV--HN-FRQKVA-GLETRGNPGPQP-A--MN-LVWNDELA-IA
Sequence 2 NDEKNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIA

Sequence 1 QVWANQCQFFVHDKCRNTAQYQVGQNIAYSASTA-AYPGIVSLIVLWENE
           Q-WANQC-F--HD-CRNT--YQVGQN-A----T---Y-----LI--WENE
Sequence 2 QTWANQCSFG-HDQCRNTEKYQVGQNVAIASTTGNSYATMSKLIEMWENE

Sequence 1 VKDFNYSQG-ITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYL
           VKDFN---G-----NF-KVGHYTQ-VW-KTKE-GCGS-KYIE-----HYL
Sequence 2 VKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYL

Sequence 1 VCNYGPAGNYMGQPIYTKK
           VCNYGPAGNYM-QPIY---
Sequence 2 VCNYGPAGNYMDQPIY---



Alignment 12
Sequence 1:
Sequence 2: Allergen Dol a 5, Sequence: Q05108
Sequence identity: 62.80 (130/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           N-YC-I-C-K--HT-C-YG-S-KP---NC------S-GVT--EK--IV--
Sequence 2 NNYCKI-CPKGTHTLCKYGTSMKP---NCGGKIVKSYGVTNDEKNEIVKR

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HN-FRQKVAQGLETRGNPGPQP-A--MN-LVWNDELA-IAQ-WANQC-F-
Sequence 2 HNEFRQKVAQGLETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFG

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTA-AYPGIVSLIVLWENEVKDFNYSQGI
           -HD-CRNTA-Y-VGQN-A----T---Y-----LI--WE-EVKD-N-----
Sequence 2 -HDQCRNTAKYPVGQNVAIASTTGNSYQTMSYLIKMWEDEVKDYNPHKDL

Sequence 1 TKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYM
           ---NF-KVGHYTQ-VW-KTKE-GCGS-KYIE-----HYLVCNYGPAGNYM
Sequence 2 MHNNFSKVGHYTQMVWGKTKEIGCGSVKYIENKWHTHYLVCNYGPAGNYM

Sequence 1 GQPIYTKK
           -QP-Y--K
Sequence 2 NQPVYERK



Alignment 13
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35781
Sequence identity: 62.32 (129/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           N-YC-IKC----HT-C-YG-STKP---NC-K------G-T--E---I---
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKP---NCGKNVVKASGLTKQENLEILKQ

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HN-FRQKVA-GLETRGNPGPQP-A--MN-LVWNDELA-IAQVWANQC---
Sequence 2 HNEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVS-LIVLWENEVKDFNYSQGI
           -HD-CRN-A-Y-VGQNIA----TA---G-VS-----WE-EVKD--Y--G-
Sequence 2 -HDNCRNSAKYSVGQNIAEGSTTADNFGSVSNMVKMWEDEVKDYQY--GS

Sequence 1 TKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYM
           -K----KVGHYTQ-VWAKTKE-GCGSIKYIE-G---HYLVCNYGPAGN--
Sequence 2 PKNKLNKVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNVG

Sequence 1 GQPIYTKK
           --PIY--K
Sequence 2 NEPIYERK



Alignment 14
Sequence 1:
Sequence 2: Allergen Ves m 5, Sequence: P35760
Sequence identity: 60.87 (126/207)
Sequence 1 NKYCNIKCSKVA-HTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVD
           N-YC-IKC-K---HT-C-YG-S-KP---NC------S-G-T--EK--I--
Sequence 2 NNYCKIKCLKGGVHTACKYG-SLKP---NCGNKKVVSYGLTKQEKQDILK

Sequence 1 EHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQF
           EHN-FRQK-A-GLETRGNPGPQP-A--M-NLVW-DELAYIAQVWANQCQ-
Sequence 2 EHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQY

Sequence 1 FVHDKCRNTAQYQVGQNIAYSASTAA-YPGIVSLIVLWENEVKDFNYSQG
           --HD-CR--A-YQVGQN-A---STAA-Y---V-L---WE-EVKD-N----
Sequence 2 G-HDTCRDVAKYQVGQNVALTGSTAAVYNDPVKLVKMWEDEVKDYNPKKK

Sequence 1 ITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNY
           ----NF-K-GHYTQ-VWA-TKEVGCGSIKYI------HYLVCNYGP-GN-
Sequence 2 FSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENWHKHYLVCNYGPSGNF

Sequence 1 MGQPIYTKK
           -----Y--K
Sequence 2 QNEELYQTK



Alignment 15
Sequence 1:
Sequence 2: Allergen Ves v 5, Sequence: Q05110
Sequence identity: 60.87 (126/207)
Sequence 1 -----------------------NKYCNIKCSKVA-HTVCQYGESTKPSS
           -----------------------N-YC-IKC-K---HT-C-YG-S-KP--
Sequence 2 MEISGLVYLIIIVTIIDLPYGKANNYCKIKCLKGGVHTACKYG-SLKP--

Sequence 1 KNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASD
           -NC------S-G-T--EK--I--EHN-FRQK-A-GLETRGNPGPQP-A--
Sequence 2 -NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKN

Sequence 1 MNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSASTAA-
           M-NLVWNDELAY-AQVWANQCQ---HD-CR--A-YQVGQN-A---STAA-
Sequence 2 MKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYQVGQNVALTGSTAAK

Sequence 1 YPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGS
           Y---V-L---WE-EVKD-N---------F-K-GHYTQ-VWA-TKEVGCGS
Sequence 2 YDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGS

Sequence 1 IKYIEKGMKSHYLVCNYGPAGNYMGQPIYTKK
           IKYI------HYLVCNYGP-GN-M----Y--K
Sequence 2 IKYIQEKWHKHYLVCNYGPSGNFMNEELYQTK



Alignment 16
Sequence 1:
Sequence 2: Allergen Dol m 5.0101, Sequence: P10736
Sequence identity: 61.35 (127/207)
Sequence 1 -----------------------NKYCNIKCSKVAHTVCQYGESTKPSSK
           -----------------------N-YC-IKC-K--HT-C--G-S-KP---
Sequence 2 MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKP---

Sequence 1 NCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASDM
           NC--------G-T--EK--I---HN-FRQ-VA-GLETRG-PGPQP-A--M
Sequence 2 NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNM

Sequence 1 NNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSASTAA-Y
           N-LVWNDELA-IAQ-WANQC-F--HD-CRNTA-YQVGQNIA-S--TA---
Sequence 2 NVLVWNDELAKIAQTWANQCDF-NHDDCRNTAKYQVGQNIAISSTTATQF

Sequence 1 PGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSI
           -----LI--WE-EV--FNY--G----NF-KVGHYTQ-VW-KTKE-GCGSI
Sequence 2 DRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSI

Sequence 1 KYIEKGMKSHYLVCNYGPAGNYMGQPIYTKK
           KYIE-----HYLVCNYGP-GN---QPIY--K
Sequence 2 KYIEDNWYTHYLVCNYGPGGNDFNQPIYERK



Alignment 17
Sequence 1:
Sequence 2: Allergen Vesp v 5.0101, Sequence: P0DMB9
Sequence identity: 60.39 (125/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           N-YC-IKC----HT-C-YG-STKP---NC--------G-T--EK--I---
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKP---NCGRSVVKASGLTKAEKLEILKQ

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HN-FRQKVA-GLETRGNPGPQP-A--MN-LVWNDELA-IAQVWA-QC---
Sequence 2 HNEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYG

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAA-YPGIVSLIVLWENEVKDFNYSQGI
           -HD-CRNTA-Y-VGQNIA----TAA-----------W--EVKD--Y--G-
Sequence 2 -HDNCRNTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQY--GS

Sequence 1 TKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYM
           -K-----VGHYTQ-VWAKTKE-GCG-IKYIE-G---HYLVCNYGPAGN--
Sequence 2 SKNKLNDVGHYTQMVWAKTKEIGCGNIKYIENGWHHHYLVCNYGPAGNIG

Sequence 1 GQPIYTKK
           --PIY-KK
Sequence 2 NEPIYEKK



Alignment 18
Sequence 1:
Sequence 2: Allergen Ves f 5, Sequence: P35783
Sequence identity: 60.39 (125/207)
Sequence 1 NKYCNIKCSKVA-HTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVD
           N-YC-IKC-K---HT-C-YG-S-KP---NC------S-G-T--EK--I--
Sequence 2 NNYCKIKCLKGGVHTACKYG-SLKP---NCGNKVVVSYGLTKQEKQDILK

Sequence 1 EHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQF
           EHN-FRQK-A-GLETRGNPGPQP-A--M-NLVWNDELAY-AQVWANQCQ-
Sequence 2 EHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQY

Sequence 1 FVHDKCRNTAQYQVGQNIAYSASTAA-YPGIVSLIVLWENEVKDFNYSQG
           --HD-CR--A-YQVGQN-A---STAA-Y---V-L---WE-EVKD-N----
Sequence 2 G-HDTCRDIAKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKK

Sequence 1 ITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNY
           ----NF-K-GHYTQ-VWA-TKEVGCGSIK-I------HYLVCNYGP-GN-
Sequence 2 FSGNNFLKTGHYTQMVWANTKEVGCGSIKFIQEKWHKHYLVCNYGPSGNF

Sequence 1 MGQPIYTKK
           -----Y--K
Sequence 2 QNEELYQTK



Alignment 19
Sequence 1:
Sequence 2: Allergen Ves p 5, Sequence: P35785
Sequence identity: 59.90 (124/207)
Sequence 1 NKYCNIKCSKVA-HTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVD
           N-YC-IKC-K---HT-C-YG-S-KP---NC------S-G-T-EEK--I--
Sequence 2 NNYCKIKCLKGGVHTACKYG-SLKP---NCGNKIVVSYGLTKEEKQDILK

Sequence 1 EHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQF
           EHN-FRQK-A-GLETRGNPGPQP-A--M-NLVWNDELAY-AQVWANQCQ-
Sequence 2 EHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQY

Sequence 1 FVHDKCRNTAQYQVGQNIAYSASTA-AYPGIVSLIVLWENEVKDFNYSQG
           --HD-CR--A-Y-VGQN-A---STA--Y---V-L---WE-EVKD-N----
Sequence 2 G-HDTCRDVAKYPVGQNVALTGSTADKYDNPVKLVKMWEDEVKDYNPKKK

Sequence 1 ITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNY
           ----NF-K-GHYTQ-VWA-TKE-GCGSIKYI------HYLVCNYGP-GN-
Sequence 2 FSENNFNKIGHYTQMVWANTKEIGCGSIKYIQNEWHKHYLVCNYGPSGNF

Sequence 1 MGQPIYTKK
           -----Y--K
Sequence 2 GNEELYQTK



Alignment 20
Sequence 1:
Sequence 2: Allergen Ves s 5, Sequence: P35786
Sequence identity: 59.90 (124/207)
Sequence 1 NKYCNIKCSKVA-HTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVD
           --YC-IKC-K---HT-C-YG-STKP---NC------S-GVT--EK--I--
Sequence 2 VDYCKIKCLKGGVHTACKYGTSTKP---NCGNMVVKSYGVTQAEKQEILK

Sequence 1 EHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQF
           -HN-FR-KVA-GLETRGNPGPQP-A--MNNLVWN-ELA-IAQ-WA-QC--
Sequence 2 IHNDFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKY

Sequence 1 FVHDKCRNTAQYQVGQNIAYSASTAA-YPGIVSLIVLWENEVKDFNYSQG
           --HD-C--T--Y-VGQNIA-S-STAA-Y-----L---WENEVKDFN----
Sequence 2 G-HDTCKDTTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTIS

Sequence 1 ITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNY
           -----F-K-GHYTQ-VWAKTKE-GCGSIKY-------HYLVCNYGPAGN-
Sequence 2 WEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNF

Sequence 1 MGQPIYTKK
           --Q--Y--K
Sequence 2 GNQEVYERK



Alignment 21
Sequence 1:
Sequence 2: Allergen Vesp m 5, Sequence: P81657
Sequence identity: 60.39 (125/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           N-YC-IKC----HT-C--G-STKP---NC-K------G-T--EK--I---
Sequence 2 NNYCKIKCRSGIHTLCKFGISTKP---NCGKNVVKASGLTKAEKLEILKQ

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HN-FRQKVA-GLETRG-PGPQP-A--MN-LVWNDELA-IAQVWA-QC---
Sequence 2 HNEFRQKVARGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYG

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAA-YPGIVSLIVLWENEVKDFNYSQGI
           -HD-CRNTA-Y-VGQNIA---STAA-----------W--EVK---Y--G-
Sequence 2 -HDVCRNTAKYSVGQNIAENGSTAASFASVSNMVQMWADEVKNYQY--GS

Sequence 1 TKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYM
           TK-----VGHYTQ-VWAKTKE-GCGSIKYIE-G---HYLVCNYGPAGN--
Sequence 2 TKNKLIEVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNIG

Sequence 1 GQPIYTKK
           --PIY--K
Sequence 2 NEPIYERK



Alignment 22
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35782
Sequence identity: 59.42 (123/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           N-YC-IKC----HT-C-YG-STKP---NC-K------G-T--E---I---
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKP---NCGKNVVKASGLTKQENLEILKQ

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HN-FRQKVA-GLETRGNPGPQP-A--MN-LVWNDELA-IAQVWANQC---
Sequence 2 HNEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTA-AYPGIVSLIVLWENEVKDFNYSQGI
           -HD-CRN-A-Y-VGQNIA-----A------------WE-EVKD--Y--G-
Sequence 2 -HDNCRNSAKYSVGQNIAEGSTSADNFVNVSNMVKMWEDEVKDYQY--GS

Sequence 1 TKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYM
           -K----KVGHYTQ-VWAKTKE-GCGS--YIE-G---HYLVCNYGPAGN--
Sequence 2 PKNKLNKVGHYTQMVWAKTKEIGCGSEDYIEDGWHRHYLVCNYGPAGNVG

Sequence 1 GQPIYTKK
           --PIY--K
Sequence 2 NEPIYERK



Alignment 23
Sequence 1:
Sequence 2: Allergen Ves g 5, Sequence: P35784
Sequence identity: 59.90 (124/207)
Sequence 1 NKYCNIKCSKVA-HTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVD
           N-YC-IKC-K---HT-C-Y-ES-KP---NC--------G-T--EK--I--
Sequence 2 NNYCKIKCLKGGVHTACKY-ESLKP---NCANKKVVAYGLTKQEKQDILK

Sequence 1 EHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQF
           EHN-FRQK-A-GLETRGNPGPQP-A--M-NLVW-DELAYIAQVWANQCQ-
Sequence 2 EHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQY

Sequence 1 FVHDKCRNTAQYQVGQNIAYSASTAA-YPGIVSLIVLWENEVKDFNYSQG
           --HD-CR--A-Y-VGQN-A---STAA-Y---V-L---WE-EVKD-N----
Sequence 2 G-HDTCRDVAKYPVGQNVALTGSTAAKYDNPVKLVKMWEDEVKDYNPKKK

Sequence 1 ITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNY
           ----NF-K-GHYTQ-VWA-TKEVGCGSIKYI------HYLVCNYGP-GN-
Sequence 2 FSENNFLKIGHYTQMVWANTKEVGCGSIKYIQDKWHKHYLVCNYGPSGNF

Sequence 1 MGQPIYTKK
           -----Y--K
Sequence 2 GNEELYQTK



Alignment 24
Sequence 1:
Sequence 2: Allergen Ves vi 5, Sequence: P35787
Sequence identity: 60.39 (125/207)
Sequence 1 -NKYCNIKCSKVA-HTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIV
           ---YC-IKC-K---HT-C-YG-STKP---NC-K------G-TE-EK--I-
Sequence 2 KVNYCKIKCLKGGVHTACKYGTSTKP---NCGKMVVKAYGLTEAEKQEIL

Sequence 1 DEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQ
           --HN-FRQKVA-GLETRGNPGPQP-A--MNNLVWNDELA-IAQVWA-QC-
Sequence 2 KVHNDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCN

Sequence 1 FFVHDKCRNTAQYQVGQNIAYSASTAAY---PGIVSLIVLWENEVKDFNY
           ---HD-C--T--Y-VGQNIA----TAA----PG---L---WENEVKDFN-
Sequence 2 YG-HDTCKDTEKYPVGQNIAKRSTTAALFDSPG--KLVKMWENEVKDFNP

Sequence 1 SQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPA
           -----K-N--K-GHYTQ-VWAKTKE-GCGS-KY-------HYLVCNYGP-
Sequence 2 NIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGPS

Sequence 1 GNYMGQPIYTKK
           GN------Y-KK
Sequence 2 GNFRNEKLYEKK



Alignment 25
Sequence 1:
Sequence 2: Allergen Sol r 3, Sequence: P35779
Sequence identity: 52.17 (108/207)
Sequence 1 NKYCNIK-CSK--VAHTVCQYGESTKPS-SKNCNKVSITSVGVTEEEKKL
           --YCN---C------HT-CQY---T-P-----C---S---VG-T--EK--
Sequence 2 TNYCNLQSCKRNNAIHTMCQY---TSPTPGPMCLEYS--NVGFTDAEKDA

Sequence 1 IVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQ
           IV--HN--RQ-VA-G-E-RG--GPQP-A--M-NL-W--ELA-IAQ-WANQ
Sequence 2 IVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQ

Sequence 1 CQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVS-LIVLWENEVKDFN-
           C-F--HD-CRN-----VGQNIA---S--------S--I-LW-NEVKDF--
Sequence 2 CTFE-HDACRNVERFAVGQNIAATSSSGKNKSTLSDMILLWYNEVKDFDN

Sequence 1 --YSQGITKEN-FAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCN
           ---S------N----VGHYTQ-VWAKTK--GCG-I---E-----HYLVCN
Sequence 2 RWISSFPSDGNILMHVGHYTQIVWAKTKKIGCGRIMFKEDNWNKHYLVCN

Sequence 1 YGPAGNYMGQPIYTKK-
           YGPAGN--G--IY--K-
Sequence 2 YGPAGNVLGAQIYEIKK



Alignment 26
Sequence 1:
Sequence 2: Allergen Sol i 3, Sequence: P35778
Sequence identity: 52.17 (108/207)
Sequence 1 ----------------------NKYCNIK-CSK--VAHTVCQYGESTKPS
           ------------------------YCN---C------HT-CQY---T-P-
Sequence 2 MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQY---TSPT

Sequence 1 -SKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAA
           ----C---S---VG-T--EK--IV--HN--RQ-VA-G-E-RG--GPQP-A
Sequence 2 PGPMCLEYS--NVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPA

Sequence 1 SDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSASTA
           --M-NL-W--ELA-IAQ-WANQC-F--HD-CRN-----VGQNIA---S--
Sequence 2 VKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVGQNIAATSSSG

Sequence 1 AYPGIVS-LIVLWENEVKDFN---YSQGITKEN-FAKVGHYTQVVWAKTK
           ---------I-LW-NEVKDF-----S------N---KVGHYTQ-VWAKT-
Sequence 2 KNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTT

Sequence 1 EVGCGSIKYIEK-GMKSHYLVCNYGPAGNYMGQPIYTKK-
           --GCG-I---E------HYLVCNYGPAGN--G-PIY--K-
Sequence 2 KIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK



Alignment 27
Sequence 1:
Sequence 2: Allergen Pac c 3.0101, Sequence: C0ITL3
Sequence identity: 49.28 (102/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           ------------HT-CQY--S--PS--NC---S------T---K--I---
Sequence 2 ------TEGGAVHTMCQY-TSPQPSP-NCGTYS--NAHITAADKETILKV

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HN--RQKV--G-ETRGNPGPQPAAS-M--L-W--ELA-IAQ-W-NQC---
Sequence 2 HNDERQKVKAGQETRGNPGPQPAASNMPDLTWDNELAAIAQRWVNQCKIG

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYP-GIVSLIVLWENEVKDFN----Y
           -HD-CRN---YQVGQNIA-S-STA--P-----L---W-NEV---N-----
Sequence 2 -HDGCRNVERYQVGQNIAMSGSTAKGPCNMNNLVQMWINEVNALNAADVS

Sequence 1 SQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPA
           S-------F-K-GHYTQ-VW-KT--VGCG-I----------YL-CNYGPA
Sequence 2 SMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCYLACNYGPA

Sequence 1 GNYMGQPIYTKK
           GN--G-PIY---
Sequence 2 GNMFGAPIYQ--



Alignment 28
Sequence 1:
Sequence 2: Allergen Sco m 5.0101, Sequence: QEA69430
Sequence identity: 33.82 (70/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           -------------T-----------------------G-----KK-I-D-
Sequence 2 --------MTIFLTSTLFVLLVFQILGKGMGCDMKVRGLDANMKKMILDL

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQF-
           HN--RQ-VA-G----G----QP-A--M--L-W-D--A--AQ--A--C-F-
Sequence 2 HNKKRQTVANGQQS-G----QPSAANMKELHWDDQIAANAQRSAETCVFQ

Sequence 1 FVHDKCRNTAQYQ-VGQNIAYSASTAAYPGIVSLIV-LWENEVKDFNYSQ
           ------R-T--Y---G-NI-Y--S---YP------V--W--EVKD-----
Sequence 2 HTAKNLRKTSKYSYLGENI-YMGS---YPDPIPRSVNAWYDEVKDV--TP

Sequence 1 GITKENFAK----VGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYG
           ---K--F-------GHYTQ-VWA-T---GCG------K-----Y--C-YG
Sequence 2 AVVK-SFRSGGPMIGHYTQMVWANTEALGCGLVTASDKNT---YIFCQYG

Sequence 1 PAGNYMGQPIYTKK-------------------
           P-GNY-G-PIY----------------------
Sequence 2 PSGNYPGEPIYKQGSPASDCKKGKSSKYPGLCN



Alignment 29
Sequence 1:
Sequence 2: Allergen Cte f 2, Sequence: AAF65314
Sequence identity: 32.85 (68/207)
Sequence 1 -------------------------------NKYCNIKCSKVAHTVCQYG
           ---------------------------------YCN--C-------C---
Sequence 2 MNSLLSSIIIVVFSVWLSVIFAVNVKPKPNQDDYCNLNCTNGPNVGC---

Sequence 1 ESTKPS-SKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLETRGNP
           --TKP-----C-------V--TE--KK-----HNR-R--VA-G-------
Sequence 2 --TKPDVPRDCQNFKL--VNITERMKKAFLNAHNRKRRLVAAGKGLLKDG

Sequence 1 GPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIA
           ---P-A--M-NL-WN--LA--A-----QC----HD-C--T-----GQN--
Sequence 2 VHTPIAAKMPNLTWNIALAKLAEYNVKQCEM-KHD-CAKTRHGHTGQNLF

Sequence 1 YSASTAA---YPGIVSLIVL-WENEVKDFNYSQGITK-----ENFAKVGH
           ----T--------I----V--W--E-KD------I-K------N----GH
Sequence 2 FYGTTLSPIKNSTIAKMAVDGWYAESKDTRL-EDIKKLTTIYPNGKPIGH

Sequence 1 YTQVVWAKTKEVGCGSIKYIEKGMKSHY----LVCNYGPAGNYMGQPIYT
           YTQ--W--T--VGC----Y---------------CNY---GN------Y-
Sequence 2 YTQLIWGNTTKVGCAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQ

Sequence 1 KK-----------------------
           -K-----------------------
Sequence 2 IKDAKNPKSKNQTKNNKKPKQKMPK



Alignment 30
Sequence 1:
Sequence 2: Allergen Sol s 3.0101, Sequence: ABC58726
Sequence identity: 21.26 (44/207)
Sequence 1 NKYCNIK-CSK--VAHTVCQYGESTKPS-SKNCNKVSITSVGVTEEEKKL
           --YCN---C------HT-CQY---T-P-----C---S---VG-T--EK--
Sequence 2 TNYCNLQSCKRNNAIHTMCQY---TSPTPGPMCLEYS--NVGFTDAEKDA

Sequence 1 IVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQ
           IV--HN--RQ-VA-G-E-RG---PQP-A--M-NL-W--ELA-IAQ-----
Sequence 2 IVNKHNELRQRVASGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ-----

Sequence 1 CQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NYMGQPIYTKK
           -----------
Sequence 2 -----------



Alignment 31
Sequence 1:
Sequence 2: Allergen Sol g 3.0101, Sequence: AAY32926
Sequence identity: 15.94 (33/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           ---------------------------------------------S----
Sequence 2 ---------------------------------------DNRWISSFPSD

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEK-GMKSHYLVCNYGPAGNYM
           -----K-GHYTQ-VWAKT---GCG-I---E------HYLVCNYGPAGN--
Sequence 2 PNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVL

Sequence 1 GQPIYTKK-
           G--IY--K-
Sequence 2 GAKIYEIKK



Alignment 32
Sequence 1:
Sequence 2: Allergen Glo m 5, Sequence: AAF82096
Sequence identity: 30.43 (63/207)
Sequence 1 -------------------NKYCNIKCSKVAHTVCQYGESTKPSSKNCNK
           ---------------------YC---C----H--C--------------K
Sequence 2 MNFVLATLSLLILGSAAVGGDYCGL-CDN--HDACVMQNVFQSGCPSGAK

Sequence 1 VSITSVGVTEEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLV
           --------------L--D-HN--R--VA-G-E----------A--M----
Sequence 2 M----IDLNKYQSALL-DAHNKKRNHVAGGGESK-----LKRACQMATMK

Sequence 1 WNDELAYIAQVWANQCQFFVHDKCRNTAQYQ-VGQNIAYSASTAAYPG--
           W--ELA--A-----QCQ---HD-CRNT------GQN-A--------P---
Sequence 2 WDSELAKLAEYNVKQCQM-NHDRCRNTVKFKYAGQNLAELGRSGGPPPDY

Sequence 1 ---IVSLIVLWENEVKDFNYSQGITKE---NF--AKVGHYTQVVWAKTKE
           ---I------W--EVKD-N--QG-------N------GH-T--V------
Sequence 2 RKLIEKAVDKWYEEVKDCN--QGYIDSYPMNYRGPAIGHFTVMVAERNTH

Sequence 1 VGCGSIKYIEK-GMKSHYLVCNYGPAGNYMGQPIYTKK------------
           VGC----Y----G-------CNY----N-M--PIY---------------
Sequence 2 VGCAASEYTKSNGFQYFLMACNYATT-NMMEFPIYKSCGSSAQDCKSGKN

Sequence 1 --------------------------
           --------------------------
Sequence 2 SKYPNLCSPNEKYEVNKWIKNGVEYH



Alignment 33
Sequence 1:
Sequence 2: Allergen Tab y 5.0101, Sequence: ADM18345
Sequence identity: 26.09 (54/207)
Sequence 1 -----------------------NKYCNI-KCSKVAHTVCQYGESTKPSS
           -------------------------YC---------H--C---------S
Sequence 2 MAPIIVPCLLLVVLVLQCSVINSLDYCSLCRGGRGEHVGC----GSPGFS

Sequence 1 KNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASD
           --C-----T----T-E-KK-I-D--N--R--VA-G----G-----P-AS-
Sequence 2 SDCGQKARTR-KFTKEHKKVILDKINDVRDHVAKG--SWG----LPVASR

Sequence 1 MNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSASTAAY
           M---VW--ELA--A------C------KCR-T------------------
Sequence 2 MKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFEFYADKM

Sequence 1 PGIVSLI--VLWENEVKDFNYSQGITKENFAKVGHYTQV------VWAKT
           P---SLI------------N----I--E-----G----V-----------
Sequence 2 PSTMSLISTAIKRGHTQKHNITRDII-EKYQPAGPKGNVKELALAISDRV

Sequence 1 KEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMGQPIYTKK-----------
           --VGCG-------G-----L-CN------Y---P-Y--------------
Sequence 2 TAVGCGLTTWKLGGKARALLTCNFSSENDY-NRPVYKTGNSPGEKCIKKD

Sequence 1 --------------------
           --------------------
Sequence 2 ETFKNLCSAQEPINPNEHNF



Alignment 34
Sequence 1:
Sequence 2: Allergen Art gm 2.0101, Sequence: AVD29825
Sequence identity: 26.09 (54/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           -----------------------------------------------V--
Sequence 2 --------------------------------------MGHLRNISLVLA

Sequence 1 HNRFRQKVAQGLETRGNPGPQPA----ASD-------MNNLVWNDELAYI
           ------------ET-G-PG--P-----A---------M--L-W-DELA--
Sequence 2 ISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKV

Sequence 1 AQVWAN----QCQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVL
           AQ-WA------C-----D-C--------G-N-A--A-------------L
Sequence 2 AQAWAETRTPDCSLVHSDRC--------GENMAQGAINGSMA-----VQL

Sequence 1 WENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKS
           W--E--D--Y------------GHYTQ-VWA-T--VGCG-----------
Sequence 2 WLDERLDYDYNEN---KCIKMCGHYTQIVWANTERVGCG--RALCSNGWA

Sequence 1 HYLVCNYGPAGNYMGQPIYTKK
           ---VCNY-P-GN--GQ--Y---
Sequence 2 YITVCNYDPPGNVVGQKPY---



Alignment 35
Sequence 1:
Sequence 2: Allergen Art an 2.0101, Sequence: AVD29822
Sequence identity: 26.09 (54/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           -----------------------------------------------V--
Sequence 2 --------------------------------------MGHLRNISLVLA

Sequence 1 HNRFRQKVAQGLETRGNPGPQPA----ASD-------MNNLVWNDELAYI
           ------------ET-G-PG--P-----A---------M--L-W-DELA--
Sequence 2 ILFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKV

Sequence 1 AQVWAN----QCQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVL
           AQ-WA------C-----D-C--------G-N-A--A-------------L
Sequence 2 AQAWAETRTPDCSLVHSDRC--------GENMAQGAINGSMA-----VQL

Sequence 1 WENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKS
           W--E--D--Y------------GHYTQ-VWA-T--VGCG-----------
Sequence 2 WLDERLDYDYNEN---KCIKMCGHYTQIVWANTERVGCG--RALCSNGWA

Sequence 1 HYLVCNYGPAGNYMGQPIYTKK
           ---VCNY-P-GN--GQ--Y---
Sequence 2 YITVCNYDPPGNVVGQKPY---



Alignment 36
Sequence 1:
Sequence 2: Allergen Art si 2.0101, Sequence: AVD29827
Sequence identity: 25.60 (53/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           -----------------------------------------------V--
Sequence 2 --------------------------------------MGHLRNISLVLA

Sequence 1 HNRFRQKVAQGLETRGNPGPQPA----ASD-------MNNLVWNDELAYI
           ------------ET-G-PG--P-----A---------M--L-W-DELA--
Sequence 2 ISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKV

Sequence 1 AQVWAN----QCQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVL
           AQ-WA------C-----D-C--------G-N-A--A-------------L
Sequence 2 AQAWAEARTADCSLVHSDRC--------GENMAQGAINGSMA-----VQL

Sequence 1 WENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKS
           W--E--D--Y------------GHYTQ-VWA----VGCG-----------
Sequence 2 WLDERLDYDYNEN---KCIKMCGHYTQIVWANSERVGCG--RALCSNGWA

Sequence 1 HYLVCNYGPAGNYMGQPIYTKK
           ---VCNY-P-GN--GQ--Y---
Sequence 2 YIIVCNYDPPGNVVGQKPY---



Alignment 37
Sequence 1:
Sequence 2: Allergen Art ar 2.0101, Sequence: A0A2L1DGQ3
Sequence identity: 25.60 (53/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           -----------------------------------------------V--
Sequence 2 --------------------------------------MGHLRNISLVLA

Sequence 1 HNRFRQKVAQGLETRGNPGPQPA----ASD-------MNNLVWNDELAYI
           ------------ET-G-PG--P-----A---------M--L-W-DELA--
Sequence 2 ISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKV

Sequence 1 AQVWAN----QCQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVL
           AQ-WA------C-----D-C--------G-N-A--A-------------L
Sequence 2 AQAWAETRTPDCSLIHSDRC--------GENMAQGAINGSMA-----VQL

Sequence 1 WENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKS
           W--E--D--Y------------GHYTQ-VWA----VGCG-----------
Sequence 2 WLDERLDYDYNEN---KCIKMCGHYTQIVWANSERVGCG--RALCSNGWA

Sequence 1 HYLVCNYGPAGNYMGQPIYTKK
           ---VCNY-P-GN--GQ--Y---
Sequence 2 YIIVCNYDPPGNVVGQKPY---



Alignment 38
Sequence 1:
Sequence 2: Allergen Art la 2.0101, Sequence: AVD29826
Sequence identity: 25.60 (53/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           -----------------------------------------------V--
Sequence 2 --------------------------------------MGHLRNISLVLA

Sequence 1 HNRFRQKVAQGLETRGNPGPQPA----ASD-------MNNLVWNDELAYI
           ------------ET-G-PG--P-----A---------M--L-W-DELA--
Sequence 2 ISFAILHSSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKV

Sequence 1 AQVWAN----QCQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVL
           AQ-WA------C-----D-C--------G-N-A--A-------------L
Sequence 2 AQAWAETRTPDCSLIHSDRC--------GENMAQGAINGSMA-----VQL

Sequence 1 WENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKS
           W--E--D--Y------------GHYTQ-VWA----VGCG-----------
Sequence 2 WLDERLDYDYNEN---KCIKMCGHYTQIVWANSERVGCG--RALCSNGWA

Sequence 1 HYLVCNYGPAGNYMGQPIYTKK
           ---VCNY-P-GN--GQ--Y---
Sequence 2 YIIVCNYDPPGNVVGQKPY---



Alignment 39
Sequence 1:
Sequence 2: Allergen Cyn d 24.0101, Sequence: AAU15051
Sequence identity: 23.19 (48/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           -------------------------------------G--------I--E
Sequence 2 --------------------------STQLPSDEPLNGLNDKAIQDILNE

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HN-FR-K----------P-P---------L-WN--LA---Q--A------
Sequence 2 HNMFRAK-------EHVP-P---------LTWNTTLAKFSQDYAESK---

Sequence 1 VHDKCRNT-AQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGI
           ----C---------G-N-------------V-----W--E-K---Y----
Sequence 2 LKKDCKMVHSDSPYGENLMFGSGAISWKTTVDT---WSDEKKSYHYGSN-

Sequence 1 TKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYM
           T-------GHYT-VVW--T--VGCG------K--K-----C-Y-P-GNY-
Sequence 2 TCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDK--KDTMIMCSYWPPGNYE

Sequence 1 GQPIYTKK
           -Q--Y---
Sequence 2 NQKPY---



Alignment 40
Sequence 1:
Sequence 2: Allergen Art ca 2.0101, Sequence: AVD29824
Sequence identity: 23.19 (48/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           ---------------------------------I--V-------------
Sequence 2 ---------------------------MGHLRNILLVLAISFAILHLSHA

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWAN----Q
           H-------------------------M--L-W-DELA--AQ-WA------
Sequence 2 HGTYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPD

Sequence 1 CQFFVHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYS
           C-----D-C--------G-N-A--A-------------LW--E--D--Y-
Sequence 2 CSLIHSDRC--------GENMAQGAINGSMA-----VQLWLDERLDYDYN

Sequence 1 QGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAG
           -----------GHYTQ-VWA----VGCG--------------VCNY-P-G
Sequence 2 EN---KCIKMCGHYTQIVWANSERVGCG--RALCSNGWAYIIVCNYDPPG

Sequence 1 NYMGQPIYTKK
           N--GQ--Y---
Sequence 2 NVVGQKPY---



Alignment 41
Sequence 1:
Sequence 2: Allergen Pol m 5.0101, Sequence: 7065471
Sequence identity: 12.56 (26/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           --YC-IKCS---HTVCQYGESTKPS-KNC----I-SVG------------
Sequence 2 VDYCKIKCSSGIHTVCQYGESTKPS-KNCADKVIKSVG------------

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPIYTKK
           -------
Sequence 2 -------



Alignment 42
Sequence 1:
Sequence 2: Allergen Pru p 9.0101, Sequence: XP_007199020
Sequence identity: 26.57 (55/207)
Sequence 1 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE
           -----------------------------------S-----EE----V-E
Sequence 2 --------------MAFNTKLLLAICCVALVFTLVSANISKEEIDGFVEE

Sequence 1 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF
           HN--R--V----------G--P-------L-WN--LA--AQ--A------
Sequence 2 HNKARKEV----------GNKP-------LKWNTTLAQYAQEYADK---R

Sequence 1 VHDKCRNTAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT
           V-D----------G-N-A---S-----G-------W--E-K-F-Y-----
Sequence 2 VGDCAMEHSMGRWGENLA---SGDGMSGAAATKY-WVTE-KEF-YDEKSN

Sequence 1 KENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG
           K------GHY--VVW-KT-EVGCG-I-----G----Y-VC-Y-P----M-
Sequence 2 KCVKDECGHYLAVVWGKTTEVGCG-ISKCNNGQ--NYVVCSYDP----MY

Sequence 1 QPIYTKK-
           QP------
Sequence 2 QPEDERPY


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.