The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Bomb m 1.0101

Sequence 82658675

Full FASTA alignment

Sequence name:
Query sequence:
MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLL
DCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPP
KNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDK
VSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVN
EIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA
SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIK
IEKSL

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Bomb m 1.0101ABB88514Go!355531.91.6e-152
2Plo i 1Q95PM9Go!355497.14.7e-142
3Bla g 9.0101ABC86902Go!356474.14.1e-135
4Scy p 2.0101H6VGI3Go!357454.63.0e-129
5Lit v 2.0101Q004B5Go!356454.33.5e-129
6Pro c 2.0101H6VGI2Go!357451.72.2e-128
7Pen m 2AAO15713Go!356449.01.4e-127
8Tyr p 20.0101A0A868BHP5Go!357430.64.9e-122
9Der f 20.0101AIO08850Go!356428.81.7e-121
10Der p 20.0101ACD50950Go!356422.61.2e-119
11Der f 20.0201ABU97470Go!356418.03.1e-118
12Pan h 7.0101XP_026780620Go!380226.51.4e-60
13Sal s 7.01ACH70914Go!381215.04.2e-57
14Mac r 2.0101E2JE77Go!355199.71.6e-52

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Bomb m 1.0101, Sequence: ABB88514
Sequence identity: 100.00 (355/355)
Sequence 1 MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLL
           MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLL
Sequence 2 MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLL

Sequence 1 DCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPP
           DCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPP
Sequence 2 DCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPP

Sequence 1 KNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDK
           KNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDK
Sequence 2 KNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDK

Sequence 1 VSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
           VSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
Sequence 2 VSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC

Sequence 1 RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVN
           RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVN
Sequence 2 RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVN

Sequence 1 EIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA
           EIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA
Sequence 2 EIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA

Sequence 1 SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIK
           SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIK
Sequence 2 SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIK

Sequence 1 IEKSL
           IEKSL
Sequence 2 IEKSL



Alignment 2
Sequence 1:
Sequence 2: Allergen Plo i 1, Sequence: Q95PM9
Sequence identity: 92.39 (328/355)
Sequence 1 MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLL
           MVDAATLEKLEAGFSKL--SDSKSLLKKYLTREVFD-LKNKKTSFGSTLL
Sequence 2 MVDAATLEKLEAGFSKLAASDSKSLLKKYLTREVFDALKNKKTSFGSTLL

Sequence 1 DCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPP
           D-IQSGVENL-SGVGIYAPDAE-Y-VFA-LFDPIIEDYHNGFKKTDKHPP
Sequence 2 DSIQSGVENLHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHPP

Sequence 1 KNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDK
           KNWGDV-TLGNLDPAGEFVVSTRVRCGRS-EGYPFNPCLTE-QYKEME-K
Sequence 2 KNWGDVETLGNLDPAGEFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMEEK

Sequence 1 VSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
           VS-TLS-LEGELKGTF-PLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC
Sequence 2 VSSTLSGLEGELKGTFFPLTGMSKETQQQLIDDHFLFKEGDRFLQAANAC

Sequence 1 RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVN
           RFWP-GRGIYHNENKTFLVWCNEEDHLR-ISMQMGGDL-QVYKRLV--VN
Sequence 2 RFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGVN

Sequence 1 EIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEVA
           -I-K-IPFSH--RLGFLTFCPTNLGTTVRASVHIKLPKLAADK-KLEEVA
Sequence 2 DIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEVA

Sequence 1 SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIK
           SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEY-AVKEMYDGIAELIK
Sequence 2 SKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIK

Sequence 1 IEKSL
           IEKSL
Sequence 2 IEKSL



Alignment 3
Sequence 1:
Sequence 2: Allergen Bla g 9.0101, Sequence: ABC86902
Sequence identity: 87.04 (309/355)
Sequence 1 MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKT-SFGSTL
           MVDAA-LEKLEAGF-KL--SDSKSLL-KYLT-EVFD-LK-KKT--FGSTL
Sequence 2 MVDAAVLEKLEAGFAKLAASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTL

Sequence 1 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHP
           LD-IQSG-EN-DSGVGIYAPDAE-Y-VFA-LFDPIIEDYH-GFKKTDKHP
Sequence 2 LDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHP

Sequence 1 PKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMED
           PK-WGDVDTLGNLDPAGE---STRVRCGRS--GYPFNPCLTE-QYKEMED
Sequence 2 PKDWGDVDTLGNLDPAGEYIISTRVRCGRSMQGYPFNPCLTEAQYKEMED

Sequence 1 KVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KVS-TLS-LEGELKG-FYPLTGM-KE-QQ-LIDDHFLFKEGDRFLQ-ANA
Sequence 2 KVSSTLSGLEGELKGQFYPLTGMTKEVQQKLIDDHFLFKEGDRFLQHANA

Sequence 1 CRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAV
           CRFWPTGRGIYHN--KTFLVWCNEEDHLRIISMQMGGDL-QVY-RLV-AV
Sequence 2 CRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLGQVYRRLVTAV

Sequence 1 NEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV
           N-IEK--PFSH-DRLGFLTFCPTNLGTTVRASV-IK-PKLAADKKKLEEV
Sequence 2 NDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELI
           A-KY-LQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVK-M-DGIAELI
Sequence 2 AGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELI

Sequence 1 KIEKSL
           KIE-SL
Sequence 2 KIESSL



Alignment 4
Sequence 1:
Sequence 2: Allergen Scy p 2.0101, Sequence: H6VGI3
Sequence identity: 82.82 (294/355)
Sequence 1 MVDAATLEKLEAGFSKLQG-SDSKSLLKKYLTREVFDSLKNKKTSFGSTL
           M-DAA--EKLE-GF-KL----D-KSLLKKYLT--VFD-LK-KKTS-G-TL
Sequence 2 MADAAVIEKLEEGFKKLEAATDCKSLLKKYLTKSVFDQLKGKKTSLGATL

Sequence 1 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHP
           LD-IQSGVENLDSGVG-YAPDAE-Y--FA-LFDPIIEDYH-GFK-TDKHP
Sequence 2 LDVIQSGVENLDSGVGVYAPDAEAYTLFAPLFDPIIEDYHKGFKQTDKHP

Sequence 1 PKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMED
           -K--GDV----N-DP-G-FV-STRVRCGRS-EGYPFNPCLTE-QYKEME-
Sequence 2 NKDFGDVNQFVNVDPDGKFVISTRVRCGRSMEGYPFNPCLTEAQYKEMES

Sequence 1 KVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KVS-TLS-LEGELKGT-YPLTGM-K--QQ-LIDDHFLFKEGDRFLQAANA
Sequence 2 KVSSTLSNLEGELKGTYYPLTGMTKDVQQKLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAV
           CR-WPTGRGIYHN-NKTFLVWCNEEDHLRIISMQMGGDL-QVY-RLVSAV
Sequence 2 CRYWPTGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDLGQVYRRLVSAV

Sequence 1 NEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV
           NEIEK--PFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAA---KLEEV
Sequence 2 NEIEKRVPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELI
           A-KY-LQVRGTRGEHTEAEGGVYDISNKRRMGLTE--AVKEM-DGI-ELI
Sequence 2 AGKYSLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFQAVKEMQDGILELI

Sequence 1 KIEKSL-
           KIEK---
Sequence 2 KIEKEMQ



Alignment 5
Sequence 1:
Sequence 2: Allergen Lit v 2.0101, Sequence: Q004B5
Sequence identity: 83.38 (296/355)
Sequence 1 MVDAATLEKLEAGFSKLQG-SDSKSLLKKYLTREVFDSLKNKKTSFGSTL
           M-DAA--EKLEAGF-KL----D-KSLLKKYLT-EVFD-LK-K-TS-G-TL
Sequence 2 MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATL

Sequence 1 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHP
           LD-IQSGVENLDSGVGIYAPDAE-Y--FA-LFDPIIEDYH-GFK-TDKHP
Sequence 2 LDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHP

Sequence 1 PKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMED
           -K--GDV----N-DP-G-FV-STRVRCGRSL-GYPFNPCLTESQYKEME-
Sequence 2 NKDFGDVNSFVNVDPEGKFVISTRVRCGRSLQGYPFNPCLTESQYKEMEA

Sequence 1 KVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KVS-TLSSLEGELKGT-YPLTGMSKE-QQ-LIDDHFLFKEGDRFLQAANA
Sequence 2 KVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAV
           CR-WP-GRGIYHN-NKTFLVW-NEEDHLRIISMQMGGDL-QV--RL-SAV
Sequence 2 CRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAV

Sequence 1 NEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV
           NEIEK-IPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAA---KLEEV
Sequence 2 NEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELI
           A-KY-LQVRGTRGEHTEAEGG-YDISNKRRMGLTE--AVKEM-DGI-ELI
Sequence 2 AGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELI

Sequence 1 KIEKSL
           KIEK--
Sequence 2 KIEKEM



Alignment 6
Sequence 1:
Sequence 2: Allergen Pro c 2.0101, Sequence: H6VGI2
Sequence identity: 81.97 (291/355)
Sequence 1 MVDAATLEKLEAGFSKLQG-SDSKSLLKKYLTREVFDSLKNKKTSFGSTL
           M-DAAT--KLE-GF-KL----D-KSLLKKYL----FDSLK-KKT--G-TL
Sequence 2 MADAATIAKLEEGFKKLEAATDCKSLLKKYLSKSIFDSLKAKKTGLGATL

Sequence 1 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHP
           LD-IQSGVENLDSGVGIYAPDAE-YS-FA-LFDPIIEDYH-GFK-TDKHP
Sequence 2 LDVIQSGVENLDSGVGIYAPDAEAYSLFAPLFDPIIEDYHKGFKQTDKHP

Sequence 1 PKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMED
           -K--GDV----N-DP-G-FV-STRVRCGRSLEGYPFNPCLTE-QYKEME-
Sequence 2 NKDFGDVNQFVNVDPDGKFVISTRVRCGRSLEGYPFNPCLTEAQYKEMEE

Sequence 1 KVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KVS-TLS-LEGELKGT-YPL-GM-KE-QQ-LIDDHFLFKEGDRFLQAANA
Sequence 2 KVSSTLSGLEGELKGTYYPLAGMTKEVQQKLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAV
           CR-WP-GRGIYHN-NKTFLVWCNEEDHLRIISMQMGGDL-QVY-RLVSAV
Sequence 2 CRYWPVGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDLGQVYRRLVSAV

Sequence 1 NEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV
           N-IEK--PFSHHDRLGFLTFCPTNLGTT-RASVHIKLPKLAA---KLEEV
Sequence 2 NDIEKRVPFSHHDRLGFLTFCPTNLGTTIRASVHIKLPKLAANREKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELI
           A--Y-LQVRGTRGEHTEAEGGVYDISNKRRMGLTE--AVKEM-DGI-ELI
Sequence 2 AARYSLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFQAVKEMQDGILELI

Sequence 1 KIEKSL-
           KIEK---
Sequence 2 KIEKEMA



Alignment 7
Sequence 1:
Sequence 2: Allergen Pen m 2, Sequence: AAO15713
Sequence identity: 81.97 (291/355)
Sequence 1 MVDAATLEKLEAGFSKLQG-SDSKSLLKKYLTREVFDSLKNKKTSFGSTL
           M-DAA--EKLEAGF-KL----D-KSLLKKYL---VFD-LK-KKTS-G-TL
Sequence 2 MADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATL

Sequence 1 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHP
           LD-IQSGVENLDSGVGIYAPDAE-Y--F--LFDPIIEDYH-GFK-TDKHP
Sequence 2 LDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHP

Sequence 1 PKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMED
           -K--GDV-T--N-DP-G--V-STRVRCGRS-EGYPFNPCLTE-QYKEME-
Sequence 2 NKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEA

Sequence 1 KVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KVS-TLSSLEGELKGT-YPLTGMSKE-QQ-LIDDHFLFKEGDRFLQAANA
Sequence 2 KVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAV
           CR-WP-GRGIYHN-NKTFLVW-NEEDHLRIISMQMGGDL-QV--RL-SAV
Sequence 2 CRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAV

Sequence 1 NEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV
           NEIEK-IPFSHHDRLGFLTFCPTNLGTT-RASVHIKLPKLAA---KLEEV
Sequence 2 NEIEKRIPFSHHDRLGFLTFCPTNLGTTARASVHIKLPKLAANREKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELI
           A-KY-LQVRGTRGEHTEAEGG-YDISNKRRMGLTE--AVKEM-DGI-ELI
Sequence 2 AGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELI

Sequence 1 KIEKSL
           K-EK--
Sequence 2 KMEKEM



Alignment 8
Sequence 1:
Sequence 2: Allergen Tyr p 20.0101, Sequence: A0A868BHP5
Sequence identity: 79.44 (282/355)
Sequence 1 MVDAATLEKLEAGFSKLQ--GSDSKSLLKKYLTREVFDSLKNKKTSFGST
           MVD-ATL-KLEAGF-KLQ--G----SLLKKYLT--VF--LK-KKT--G-T
Sequence 2 MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTGMGAT

Sequence 1 LLDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKH
           LLD-IQSGVENLDSGVG-YAPDAE-Y--FA-LF-P-IE-YH-GFK-TDKH
Sequence 2 LLDVIQSGVENLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKH

Sequence 1 PPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEME
           PP---GD---L-N-DP--EFV-STRVRCGRSL-GYPFNPCLTE-QYKEME
Sequence 2 PPSDFGDINQLVNVDPNNEFVISTRVRCGRSLQGYPFNPCLTEAQYKEME

Sequence 1 DKVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAAN
           -KV---L-S-EGELKGT-YPLTGM-K-TQQQLIDDHFLFKEGDRFLQAAN
Sequence 2 EKVKAQLESFEGELKGTYYPLTGMDKATQQQLIDDHFLFKEGDRFLQAAN

Sequence 1 ACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSA
           ACRFWPTGRGI-HN--KTFL-W-NEEDHLRIISMQ-GGDL--V--RLV-A
Sequence 2 ACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGDLKEVFGRLVKA

Sequence 1 VNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEE
           V--IEKKIPFS--DRLGFLTFCPTNLGTT-RASVHIKLPKLAAD-KKLEE
Sequence 2 VQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE

Sequence 1 VASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAEL
           VA-KY-LQVRGT-GEHTE--GGVYDISNKRRMGLTEY-AVKEM-DGI-EL
Sequence 2 VAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILEL

Sequence 1 IKIEKSL
           IKIEKSL
Sequence 2 IKIEKSL



Alignment 9
Sequence 1:
Sequence 2: Allergen Der f 20.0101, Sequence: AIO08850
Sequence identity: 78.03 (277/355)
Sequence 1 MVDAATLEKLEAGFSKLQGS-DSKSLLKKYLTREVFDSLKNKKTSFGSTL
           MVD-A---KLEAGF-KLQ-S----SLLKKYLTR-V-D--K--KT--G-TL
Sequence 2 MVDQAVIDKLEAGFQKLQSSAECHSLLKKYLTRNVLDACKGRKTGMGATL

Sequence 1 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHP
           -D--QSG-ENLDSGVG-YAPDAESY--F-ELFDP-IEDYH-GFK-TDKHP
Sequence 2 VDVVQSGFENLDSGVGLYAPDAESYTLFKELFDPVIEDYHKGFKPTDKHP

Sequence 1 PKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMED
           ----GDV-TL-N-DP--EFV-STRVRCGRSL-GYPFNPCLTE-QYKEME-
Sequence 2 QTDFGDVNTLCNVDPNNEFVISTRVRCGRSLQGYPFNPCLTEAQYKEMEE

Sequence 1 KVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KV-G-L-S-EGELKGT-YPL-GM-K-TQQQLIDDHFLFKEGDRFLQAANA
Sequence 2 KVKGQLNSFEGELKGTYYPLLGMDKATQQQLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAV
           CRFWP-G-GI-HN-NKTFL-W-NEEDHLRIISMQ-GGDL-QV--RL---V
Sequence 2 CRFWPVGCGIFHNDNKTFLIWVNEEDHLRIISMQKGGDLKQVFSRLINGV

Sequence 1 NEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV
           N-IEKK-PFS--DRLGFLTFCPTNLGTT-RASVHIKLPKLAAD-KKLEEV
Sequence 2 NHIEKKLPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELI
           A-KY-LQVRGT-GEHTE--GGVYDISNKRRMGLTEY-AVKEM-DGI-ELI
Sequence 2 AGKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELI

Sequence 1 KIEKSL
           KIEKS-
Sequence 2 KIEKSM



Alignment 10
Sequence 1:
Sequence 2: Allergen Der p 20.0101, Sequence: ACD50950
Sequence identity: 77.75 (276/355)
Sequence 1 MVDAATLEKLEAGFSKLQGS-DSKSLLKKYLTREVFDSLKNKKTSFGSTL
           MVD-ATL-KLEAGF-KLQ---D--SLLKKYLTR-VFD-LKNKKT--G-TL
Sequence 2 MVDPATLSKLEAGFQKLQNAQDCHSLLKKYLTRDVFDQLKNKKTDMGATL

Sequence 1 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHP
           LD-IQSGVENLDSGVGIYAPDA-SY--FA-LFDPII-DYH-GFK-TDKHP
Sequence 2 LDVIQSGVENLDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHP

Sequence 1 PKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMED
           ----G------N-DP--E-V-STRVRCGRSL-GYPFNP-LTE-QYKEME-
Sequence 2 KTDFGNIENFVNVDPKNEYVLSTRVRCGRSLNGYPFNPMLTEAQYKEMET

Sequence 1 KVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KV-G-L---EGELKGT-YPL-GM-K-TQQQLIDDHFLFKEGDRFLQAANA
Sequence 2 KVKGQLATFEGELKGTYYPLLGMDKATQQQLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAV
           CR-WP-GRGI-HN--KTFL-W-NEEDHLRIISMQ-GGDL--VY-RLV-AV
Sequence 2 CRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDLKEVYGRLVKAV

Sequence 1 NEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV
           --IE-KIPFS--DRLGFLTFCPTNLGTT-RASVHIKLPKLAAD-KKLEEV
Sequence 2 KHIEQKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELI
           A--Y-LQVRGT-GEHTE--GG-YDISNKRRMGLTEY-AVKEM-DGI-ELI
Sequence 2 AGRYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGILELI

Sequence 1 KIEKSL
           K-EKS-
Sequence 2 KMEKSM



Alignment 11
Sequence 1:
Sequence 2: Allergen Der f 20.0201, Sequence: ABU97470
Sequence identity: 76.62 (272/355)
Sequence 1 MVDAATLEKLEAGFSKLQGS-DSKSLLKKYLTREVFDSLKNKKTSFGSTL
           MVD-ATL-KLEAGF-KLQ---D--SLLKKYLTR-V-D-LK-KKT--G-TL
Sequence 2 MVDQATLSKLEAGFQKLQNAQDCHSLLKKYLTRDVLDQLKTKKTDMGATL

Sequence 1 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHP
           LD-IQSGVENLDSGVGIYAPDA-SY--FA-LFDPII-DYH-GFK-TDKHP
Sequence 2 LDVIQSGVENLDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHP

Sequence 1 PKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMED
           ----G------N-DP--E-V-STRVRCGRSL-GYPFNP-LTE-QYKEME-
Sequence 2 QTDFGNIEHFVNVDPKNEYVISTRVRCGRSLKGYPFNPMLTEAQYKEMET

Sequence 1 KVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANA
           KV-G-L---EGELKGT-YPL-GM-K-TQQ-LIDDHFLFKEGDRFLQAANA
Sequence 2 KVKGQLATFEGELKGTYYPLLGMDKATQQKLIDDHFLFKEGDRFLQAANA

Sequence 1 CRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAV
           CR-WP-GRGI-HN--KTFL-W-NEEDHLRIISMQ-GGDL--V--RLV-AV
Sequence 2 CRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDLKEVFGRLVKAV

Sequence 1 NEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV
           --IE-KIPFS--DRLG-LTFCPTNLGTT-RASVHIKLPKLAAD-KKLEEV
Sequence 2 KHIEQKIPFSRDDRLGYLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEV

Sequence 1 ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELI
           A--Y-LQVRGT-GEHTE--GG-YDISNKRRMGLTEY-AVKEM-DGI-ELI
Sequence 2 AARYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGIIELI

Sequence 1 KIEKSL
           K-EKSL
Sequence 2 KMEKSL



Alignment 12
Sequence 1:
Sequence 2: Allergen Pan h 7.0101, Sequence: XP_026780620
Sequence identity: 44.23 (157/355)
Sequence 1 ---MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGS
           -----------K----------S-------K-L-------L--K-T--G-
Sequence 2 MAKNCHNDYKMKFPMDEEYPDLSLHNNHMSKALNKDIYNKLRGKSTPSGF

Sequence 1 TLLDCIQSGVEN----LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFK
           TL-DCIQ-GV-N--------VG--A-D-E-Y-VF--LFDPII-D-H-G-K
Sequence 2 TLDDCIQTGVDNPGHPFIMTVGCVAGDEECYEVFKDLFDPIISDRHGGYK

Sequence 1 KTDKHPPK-NWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTES
           -TDKH----NW--------LDP----V-S-RVR-GRS--GY---P-----
Sequence 2 PTDKHHTDLNWENLKGGDDLDP--NYVLSSRVRTGRSIKGYTLPPHNSRG

Sequence 1 QYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLF-KEGD
           -----E------L-SL-GE-KG--YPL--M----Q-QLI-DHFLF-K---
Sequence 2 ERRAVEKLSIEALTSLDGEFKGKYYPLKDMTEKEQEQLIADHFLFDKPVS

Sequence 1 RFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQV
           --L-AA---R-WP--RGI-HN-NKTFLVW-NEEDHLR-ISMQ-GG----V
Sequence 2 PLLLAAGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQQGGNMKEV

Sequence 1 YKRLVSAVNEIEKKIPFSHH-----DRLGFLTFCPTNLGTTVRASVHIKL
           --R-------IE-------H-------LGF---CP-NLGT--R--VH-KL
Sequence 2 FRRFCVGLQRIEEIFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKL

Sequence 1 PKLAADKKKLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYD
           PKL-----K-EE------LQ-RGT-G--T---GGV-DISN--R-G--E--
Sequence 2 PKLST-HPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVE

Sequence 1 AVKEMYDGIAELIKIEKSL--------------
           -V----DG----I--EK-L--------------
Sequence 2 QVQLVVDGVKLMIEMEKKLEKGESIDDMIPAQK



Alignment 13
Sequence 1:
Sequence 2: Allergen Sal s 7.01, Sequence: ACH70914
Sequence identity: 42.25 (150/355)
Sequence 1 ------MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTS
           --------------K-E-----L----------K-LT------L--K-T-
Sequence 2 MPFGNTHNNFKLNFKVEEEYPDLTKHNNH--MAKVLTKDMYAKLRDKQTP

Sequence 1 FGSTLLDCIQSGVEN----LDSGVGIYAPDAESYSVFAELFDPIIEDYHN
           -G-TL-D-IQ-GV-N--------VG--A-D-ESY--F--L-DPII-D-H-
Sequence 2 SGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEIFKDLLDPIISDRHS

Sequence 1 GFKKTDKHPPK-NWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCL
           G-K-TDKH----N---------LDP----V-S-RVR-GRS--GY---P--
Sequence 2 GYKPTDKHKTDLNFENLKGGDDLDP--NYVLSSRVRTGRSIKGYTLPPHN

Sequence 1 TESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLF-K
           --------E------L--L-GE-KG--YPL--M----Q-QLI-DHFLF-K
Sequence 2 SRGERRAVEKLSVEALNTLDGEFKGKYYPLNKMTDAEQEQLIADHFLFDK

Sequence 1 EGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDL
           -----L--A---R-WP--RGI-HN--K-FLVW-NEEDHLR-ISM--GG--
Sequence 2 PVSPLLLGAGMARDWPDARGIWHNDAKSFLVWVNEEDHLRVISMEKGGNM

Sequence 1 QQVYKRLVSAVNEIEKKIPFSHH-----DRLGFLTFCPTNLGTTVRASVH
           --V--R-------IE-------H-------LG----CP-NLGT--R--VH
Sequence 2 KEVFRRFCVGLKRIEETFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVH

Sequence 1 IKLPKLAADKKKLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLT
           -KLPKL-----K-EE------LQ-RGT-G--T---GGV-DISN--R-G--
Sequence 2 VKLPKLST-HPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSS

Sequence 1 EYDAVKEMYDGIAELIKIEKSL--------------
           E-D-V----DG-------EK-L--------------
Sequence 2 EVDQVQMVVDGVKLMVEMEKKLEKGEAIDGMIPAQK



Alignment 14
Sequence 1:
Sequence 2: Allergen Mac r 2.0101, Sequence: E2JE77
Sequence identity: 43.38 (154/355)
Sequence 1 MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSF-GSTL
           ------------G----------SL--K--T-E----L---KT---G-TL
Sequence 2 -----------MGEPFPDIKSKHSLVAKHVTKERWEKLSGHKTATSGFTL

Sequence 1 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHP
           ---I---VE------GIYA-D--SY--F---FDPII--YH-G------H-
Sequence 2 KQAIACAVEFDNQHCGIYAGDWDSYKDFKDVFDPIIQEYH-GISPDAVHT

Sequence 1 PKNWGDVDTL-GNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEME
           ------V----GN---A---V-S-R-R-GRS--G----P--T--Q----E
Sequence 2 SDM--EVEKIKGNIN-AEVPVHSVRIRVGRSIDGFGLSPGITKEQRIGVE

Sequence 1 DKVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAAN
           ---------L-G-L-G--YPLTGM-----QQL-DDHFLF--GDR-LQ-A-
Sequence 2 NLMKSAFGKLSGDLAGNYYPLTGMDEKVRQQLVDDHFLFMSGDRNLQVAG

Sequence 1 ACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSA
           --R-WP-GRGIYHN--KTFLVW-NEED-LRIISMQMGGD---V--RL---
Sequence 2 MERDWPEGRGIYHNAEKTFLVWVNEEDQLRIISMQMGGDVRGVFERLARG

Sequence 1 VNEI------EKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPK----
           ----------E----F------GF---CPTNLGT--RASVH--LP-----
Sequence 2 IKAVGDSVKAESGKDFMLDPKYGFVHSCPTNLGTGMRASVHVDLPGWTKE

Sequence 1 -LAADKKKLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDA
           -L-A-KK--EE-------Q-RGTRGE-----G--YDISNK-R-G--E---
Sequence 2 GLDALKKRCEEL----KVQPRGTRGESGGQTGHTYDISNKHRLGYSEVEL

Sequence 1 VKEMYDGIAELIKIEKSL------
           V--M-DG---L------L------
Sequence 2 VQCMIDGVNTLYAEDVALQKKHGI


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.