The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Cup a 4.0101

Sequence 145581052

Full FASTA alignment

Sequence name:
Query sequence:
MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHN
VDKNGDGLISVEEFQTMMTSEMTDKSK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Cup a 4.0101ABP87672Go!177205.85.7e-55
2Jun o 4O64943Go!165174.11.8e-45
3Amb a 10.0101Q2KN25Go!16079.17.1e-17
4Ole e 8Q9M7R0Go!17177.13.0e-16
5Ole e 8AAF31152Go!17176.83.8e-16
6Pen m 6.0101ADV17344Go!15057.42.3e-10
7Syr v 3P58171Go!8153.81.5e-09
8Bra n 2BAA09633Go!8253.02.7e-09
9Bra n 2Q39406Go!8353.02.7e-09
10Che a 3AAL92871Go!8652.63.5e-09
11Bet v 4Q39419Go!8552.54.0e-09
12Aln g 4O81701Go!8552.54.0e-09
13Bet v 4CAA73147Go!8552.34.4e-09
14Ole e 3O81092Go!8451.38.9e-09
15Phl p 7O82040Go!7850.61.3e-08
16Cyn d 7P94092Go!8049.92.2e-08
17Cyn d 7CAA62634Go!8249.92.2e-08
18Sal k 7.0101ALE34025Go!8649.92.3e-08
19Par j 4.0101CAP05019Go!8449.14.1e-08
20Art v 5.0101AY904434Go!8246.52.3e-07
21Bra r 5.0101P69197Go!7946.03.2e-07
22Tyr p 24.0101ACL36923Go!15337.81.9e-04
23Tyr p 34.0101D2DGW3Go!15337.81.9e-04
24Pan h 1.0101XP_026772003Go!10936.82.6e-04
25Bla g 6.0201ABB89297Go!15136.93.3e-04
26Der p 39.0101QXY82447Go!15336.83.8e-04
27Der f 39.0101QBF67841Go!15336.83.8e-04
28Der f 26.0101AIO08852Go!16036.64.4e-04
29Bla g 8.0101ABD47458Go!19536.94.5e-04
30Per a 6.0101Q1M0Y3Go!15136.44.7e-04
31Bla g 6.0301ABB89298Go!15436.16.1e-04
32Lat c 1.0101Q5IRB2Go!10935.18.4e-04
33Per a 8.0101H6WP59Go!20836.08.5e-04
34Bla g 6.0101ABB89296Go!15135.49.6e-04
35Der p 26.0101QAT18638Go!12134.71.3e-03
36Hom a 6.0101P29291Go!15034.91.4e-03
37Ran e 1CAC83046Go!11033.62.4e-03
38Gal d 8.0101C1L370Go!11033.42.7e-03
39Sar sa 1.0101FM177701Go!10933.13.5e-03
40Clu h 1.0301CAQ72972Go!10932.17.0e-03
41Cro p 2.0101XP_019400389Go!11032.17.0e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Cup a 4.0101, Sequence: ABP87672
Sequence identity: 100.00 (177/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
Sequence 2 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
Sequence 2 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHN
           KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHN
Sequence 2 KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHN

Sequence 1 VDKNGDGLISVEEFQTMMTSEMTDKSK
           VDKNGDGLISVEEFQTMMTSEMTDKSK
Sequence 2 VDKNGDGLISVEEFQTMMTSEMTDKSK



Alignment 2
Sequence 1:
Sequence 2: Allergen Jun o 4, Sequence: O64943
Sequence identity: 84.75 (150/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ------------MDEVPSSDGSKSA-SG--V-EQSVHELEEVFKKFDANG
Sequence 2 ------------MDEVPSSDGSKSACSGEVVMEQSVHELEEVFKKFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           DGKISGSELADILRS-GS-V-EAEVKAMMEEAD-DGDGYVSLQEFVDLN-
Sequence 2 DGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFVDLNN

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHN
           KGA-VKDLKNAFKVFDRDCNG-IS-AELC-TL-S-GEPCTIEESKNIIHN
Sequence 2 KGASVKDLKNAFKVFDRDCNGSISAAELCHTLESVGEPCTIEESKNIIHN

Sequence 1 VDKNGDGLISVEEFQTMMTSEMTDKSK
           VDKNGDGLISVEEFQTMMTSEMTDKSK
Sequence 2 VDKNGDGLISVEEFQTMMTSEMTDKSK



Alignment 3
Sequence 1:
Sequence 2: Allergen Amb a 10.0101, Sequence: Q2KN25
Sequence identity: 35.03 (62/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           -------------------------------------E----F--FD-NG
Sequence 2 ---------------------MAPENNKHSIFPTDKEEVTKIFNRFDTNG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFV----
           DG-IS--EL--IL-S-GS-----EVK--M-E-D-DGDG--SL-EF-----
Sequence 2 DGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISLDEFILFCK

Sequence 1 DLNIKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKN
           -----G----DLK-AFK--D---NG-IS--EL-Q-L---GE----E----
Sequence 2 GIESEGDEINDLKEAFKFYDQNNNGVISANELHQILGRLGENYSVESCAD

Sequence 1 IIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           -I--VD--GDG----EEF--MM-----D---
Sequence 2 MIKSVDSDGDGFVDFEEFRKMMSRKGGDGAM



Alignment 4
Sequence 1:
Sequence 2: Allergen Ole e 8, Sequence: Q9M7R0
Sequence identity: 37.29 (66/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------S---V--Q---E---VF--FDANG
Sequence 2 ------------------MAANTDRNSKPSVYLQEPNEVQGVFNRFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           DGKISG-ELA--L---GS-----E----MEE-DTD-DG----QEF-----
Sequence 2 DGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAF-V

Sequence 1 KGAT--------VKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIE
           K--T-----------LK-AF---D-D-NG-IS--EL---L---GE-----
Sequence 2 KAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEH

Sequence 1 ESKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK-----
           -----I--VD--GDG--S-EEF--MMT------S------
Sequence 2 DCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK



Alignment 5
Sequence 1:
Sequence 2: Allergen Ole e 8, Sequence: AAF31152
Sequence identity: 37.85 (67/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------S---V--Q---E---VF--FDANG
Sequence 2 ------------------MAANTDRNSKPSVYLQEPNEVQGVFNRFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           DGKISG-ELA--L---GS-----E---MMEE-DTD-DG----QEF-----
Sequence 2 DGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAF-V

Sequence 1 KGAT--------VKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIE
           K--T-----------LK-AF---D-D-NG-IS--EL---L---GE-----
Sequence 2 KAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEH

Sequence 1 ESKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK-----
           -----I--VD--GDG--S-EEF--MMT------S------
Sequence 2 DCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK



Alignment 6
Sequence 1:
Sequence 2: Allergen Pen m 6.0101, Sequence: ADV17344
Sequence identity: 25.42 (45/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------E-----L---F--FD--G
Sequence 2 ---------------------------MDSLDEEQIETLRKAFNSFDTEG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-I-------ILR-MG----E--------E-D-DG-G-----EF--L--
Sequence 2 AGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEFAELAA

Sequence 1 KGATVKD-------LKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           K-----D-------L--AF---D-DC-G-I----L---L-------T---
Sequence 2 KFLIEEDEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLTPTD

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ---II--VD--G-G-----EF--MM---------
Sequence 2 LEGIIEEVDEDGSGTLDFDEFMEMMSG-------



Alignment 7
Sequence 1:
Sequence 2: Allergen Syr v 3, Sequence: P58171
Sequence identity: 22.60 (40/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           -----------------------------------V-ELE--FK-FDANG
Sequence 2 -------------------------------MAEEVAELERIFKRFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLN-
           DGKIS-SEL---L---GS---E-E---MM-E-DTDGDG--S--EF-D---
Sequence 2 DGKISSSELGETLKTLGSVTPE-EIQRMMAEIDTDGDGFISFEEFKDFAR

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           ------KD----F-------------------------------------
Sequence 2 ANSGLIKDVAKIF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 8
Sequence 1:
Sequence 2: Allergen Bra n 2, Sequence: BAA09633
Sequence identity: 23.73 (42/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           -------------------------------------E----FKKFDANG
Sequence 2 ------------------------------ADATEKAEHDRIFKKFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           DGKIS-SEL-D-L---GS-V-----K-MM-E-DTDGDGY-S-QEF-D---
Sequence 2 DGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQEFSDFA-

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHN
           --A-----K---K-F-----------------------------------
Sequence 2 -SANRGLMKDVAKIF-----------------------------------

Sequence 1 VDKNGDGLISVEEFQTMMTSEMTDKSK
           ---------------------------
Sequence 2 ---------------------------



Alignment 9
Sequence 1:
Sequence 2: Allergen Bra n 2, Sequence: Q39406
Sequence identity: 23.73 (42/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           -------------------------------------E----FKKFDANG
Sequence 2 -----------------------------MADATEKAEHDRIFKKFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           DGKIS-SEL-D-L---GS-V-----K-MM-E-DTDGDGY-S-QEF-D---
Sequence 2 DGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQEFSDFA-

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHN
           --A-----K---K-F-----------------------------------
Sequence 2 -SANRGLMKDVAKIF-----------------------------------

Sequence 1 VDKNGDGLISVEEFQTMMTSEMTDKSK
           ---------------------------
Sequence 2 ---------------------------



Alignment 10
Sequence 1:
Sequence 2: Allergen Che a 3, Sequence: AAL92871
Sequence identity: 22.60 (40/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ---------------------------------Q-----E--FK-FD-NG
Sequence 2 --------------------------MAAEDTPQDIADRERIFKRFDTNG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLN-
           DGKIS-SEL-D-L---GS-V---EV--MM-E-DTDGDG--S--EF-D---
Sequence 2 DGKISSSELGDALKTLGS-VTPDEVRRMMAEIDTDGDGFISFDEFTDFAR

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           -----VKD----F-------------------------------------
Sequence 2 ANRGLVKDVSKIF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 11
Sequence 1:
Sequence 2: Allergen Bet v 4, Sequence: Q39419
Sequence identity: 23.73 (42/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ---------------------------------Q---E-E--FK-FDANG
Sequence 2 ---------------------------MADDHPQDKAERERIFKRFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           DGKIS--EL---L---GS-----EVK-MM-E-DTDGDG--S-QEF-D---
Sequence 2 DGKISAAELGEALKTLGS-ITPDEVKHMMAEIDTDGDGFISFQEFTDFG-

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHN
           --A----LK---K-F-----------------------------------
Sequence 2 -RANRGLLKDVAKIF-----------------------------------

Sequence 1 VDKNGDGLISVEEFQTMMTSEMTDKSK
           ---------------------------
Sequence 2 ---------------------------



Alignment 12
Sequence 1:
Sequence 2: Allergen Aln g 4, Sequence: O81701
Sequence identity: 24.29 (43/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ---------------------------------Q---E-E--FK-FDANG
Sequence 2 ---------------------------MADDHPQDQAEHERIFKCFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLN-
           DGKIS-SEL-D-L---GS-V---EVK-MM-E-DTDGDG--S-QEF-----
Sequence 2 DGKISASELGDALKTLGS-VTPDEVKHMMAEIDTDGDGFISFQEFTNFAR

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           -----VKD----F-------------------------------------
Sequence 2 ANRGLVKDVAKIF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 13
Sequence 1:
Sequence 2: Allergen Bet v 4, Sequence: CAA73147
Sequence identity: 23.73 (42/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ---------------------------------Q---E-E--FK-FDANG
Sequence 2 ---------------------------MADDHPQDKAERERIFKRFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           DGKIS--EL---L---GS-----EVK-MM-E-DTDGDG--S-QEF-D---
Sequence 2 DGKISAAELGEALKTLGS-ITPDEVKHMMAEIDTDGDGFISFQEFTDFA-

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHN
           --A----LK---K-F-----------------------------------
Sequence 2 -RANRGLLKDVAKIF-----------------------------------

Sequence 1 VDKNGDGLISVEEFQTMMTSEMTDKSK
           ---------------------------
Sequence 2 ---------------------------



Alignment 14
Sequence 1:
Sequence 2: Allergen Ole e 3, Sequence: O81092
Sequence identity: 23.16 (41/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ---------------------------------Q-V-E-E--FK-FDANG
Sequence 2 ----------------------------MADDPQEVAEHERIFKRFDANG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEF-VDLN
           DGKIS-SEL---L---GS---E-E---MM-E-DTDGDG--S--EF-V---
Sequence 2 DGKISSSELGETLKTLGSVTPE-EIQRMMAEIDTDGDGFISFEEFTVFAR

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           -----VKD----F-------------------------------------
Sequence 2 ANRGLVKDVAKIF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 15
Sequence 1:
Sequence 2: Allergen Phl p 7, Sequence: O82040
Sequence identity: 20.90 (37/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ---------------------------------------E--FK-FD-NG
Sequence 2 ----------------------------------MADDMERIFKRFDTNG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-N
           DGKIS-SEL-D-LR--GS-----EV--MM-E-DTDGDG-----EF----N
Sequence 2 DGKISLSELTDALRTLGSTSAD-EVQRMMAEIDTDGDGFIDFNEFISFCN

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           ------KD----F-------------------------------------
Sequence 2 ANPGLMKDVAKVF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 16
Sequence 1:
Sequence 2: Allergen Cyn d 7, Sequence: P94092
Sequence identity: 20.34 (36/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ---------------------------------------E--FK-FD-NG
Sequence 2 --------------------------------MADTGDMEHIFKRFDTNG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-N
           DGKIS--EL-D-LR--GS-----EV--MM-E-DTDGDG-----EF----N
Sequence 2 DGKISLAELTDALRTLGSTSAD-EVQRMMAEIDTDGDGFIDFDEFISFCN

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           ------KD----F-------------------------------------
Sequence 2 ANPGLMKDVAKVF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 17
Sequence 1:
Sequence 2: Allergen Cyn d 7, Sequence: CAA62634
Sequence identity: 20.34 (36/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ---------------------------------------E--FK-FD-NG
Sequence 2 ------------------------------KTMADTGDMEHIFKRFDTNG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-N
           DGKIS--EL-D-LR--GS-----EV--MM-E-DTDGDG-----EF----N
Sequence 2 DGKISLAELTDALRTLGSTSAD-EVQRMMAEIDTDGDGFIDFDEFISFCN

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           ------KD----F-------------------------------------
Sequence 2 ANPGLMKDVAKVF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 18
Sequence 1:
Sequence 2: Allergen Sal k 7.0101, Sequence: ALE34025
Sequence identity: 20.90 (37/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ---------------------------------Q-----E--FK-FD-NG
Sequence 2 --------------------------MAAEDTPQDLADRERIFKRFDTNG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLN-
           DGKIS-SEL-D-L---GS-V---E---MM-E-DTDGDG--S--EF-----
Sequence 2 DGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDGDGFISFEEFTEFAR

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           ------KD----F-------------------------------------
Sequence 2 ANRGLIKDVAKIF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 19
Sequence 1:
Sequence 2: Allergen Par j 4.0101, Sequence: CAP05019
Sequence identity: 21.47 (38/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           -------------------------------------E-E--FK-FD-NG
Sequence 2 ----------------------------MADKQIDRAEQERIFKRFDSNG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-N
           DGKIS-SEL---L---GS-V---EV--MM-E-DTDGDG--SL-EF-----
Sequence 2 DGKISSSELGEALKALGS-VTADEVHRMMAEIDTDGDGAISLEEFSSFAD

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           ------KD----F-------------------------------------
Sequence 2 ANRGLIKDIAKIF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 20
Sequence 1:
Sequence 2: Allergen Art v 5.0101, Sequence: AY904434
Sequence identity: 20.34 (36/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           -------------------------------------E----F--FD-NG
Sequence 2 ------------------------------MADEDKAECDRIFGAFDKNG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-N
           DGKIS--EL---L---GS-V---EV--MM-E-DTDGDGY-S--EF----N
Sequence 2 DGKISAAELGESLTKLGS-VSPEEVQTMMDELDTDGDGYISYDEFAEFFN

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           ------KD----F-------------------------------------
Sequence 2 ANRGLMKDVGKIF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 21
Sequence 1:
Sequence 2: Allergen Bra r 5.0101, Sequence: P69197
Sequence identity: 19.77 (35/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           -------------------------------------E-E--FKKFD--G
Sequence 2 ---------------------------------MADAEHERIFKKFDTDG

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-N
           DGKIS--EL---L---GS-V----V--MM---DTDGDG--S-QEF-----
Sequence 2 DGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTEFAS

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH
           ------KD----F-------------------------------------
Sequence 2 ANPGLMKDVAKVF-------------------------------------

Sequence 1 NVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----------------------------
Sequence 2 ----------------------------



Alignment 22
Sequence 1:
Sequence 2: Allergen Tyr p 24.0101, Sequence: ACL36923
Sequence identity: 23.73 (42/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------S--------V--L---F--FD---
Sequence 2 -------------------------MSVEELSKEQVQMLRKAFDMFDRDK

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-I-------ILR--G----E--------E-D-DG-G-----EF--L--
Sequence 2 KGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGELEFDEFLTLTA

Sequence 1 K-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           ---------A----L--AF---D---NG-I----L---L-------T--E
Sequence 2 RFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDE

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----I---D--G-G-----EF--MMT--------
Sequence 2 LDEMIAEIDTDGSGTVDFDEFMEMMTGD------



Alignment 23
Sequence 1:
Sequence 2: Allergen Tyr p 34.0101, Sequence: D2DGW3
Sequence identity: 23.73 (42/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------S--------V--L---F--FD---
Sequence 2 -------------------------MSVEELSKEQVQMLRKAFDMFDRDK

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-I-------ILR--G----E--------E-D-DG-G-----EF--L--
Sequence 2 KGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGELEFDEFLTLTA

Sequence 1 K-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           ---------A----L--AF---D---NG-I----L---L-------T--E
Sequence 2 RFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDE

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----I---D--G-G-----EF--MMT--------
Sequence 2 LDEMIAEIDTDGSGTVDFDEFMEMMTGD------



Alignment 24
Sequence 1:
Sequence 2: Allergen Pan h 1.0101, Sequence: XP_026772003
Sequence identity: 16.95 (30/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           ----------------------A---A-------DG--------F-----
Sequence 2 -------------MAFAGVLNDADIAAALDACKADGS-FDHKAFFTKVGL

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAEL---CQTLKSMGEPCTIEESKNI
           -G----D-K-AF---D-D--G-I---EL----Q--KS-----T--E-K--
Sequence 2 TGKSADDVKKAFSIIDQDKSGFIEEDELKLFLQNFKSDARALTDNETKIF

Sequence 1 IHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----D--GDG-I-V-EF-------------
Sequence 2 LKAGDTDGDGKIGVDEFASLVKA-------



Alignment 25
Sequence 1:
Sequence 2: Allergen Bla g 6.0201, Sequence: ABB89297
Sequence identity: 25.42 (45/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------EQ-V--L---F--FD---
Sequence 2 --------------------------MDEIPAEQVVL-LKKAFDAFDREK

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-IS------IL---G---D---------E-D-DG-G-----EF--L--
Sequence 2 KGCISTEMVGTILEMLGTRLDQDMLDEIIAEVDADGSGELEFEEFCTLAS

Sequence 1 KGATVKD-------LKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           ------D-------L--AF---D---NG-I--A-L---LK------T-E-
Sequence 2 RFLVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKITAED

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----I---D--G-G-----EF---MT-E------
Sequence 2 LDMMIEEIDSDGSGTVDFDEFMEVMTGE------



Alignment 26
Sequence 1:
Sequence 2: Allergen Der p 39.0101, Sequence: QXY82447
Sequence identity: 23.73 (42/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------S--------V--L---F--FD---
Sequence 2 -------------------------MSVEELTKEQVQMLRKAFDMFDREK

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-I-------ILR--G----E--------E-D-DG-G-----EF--L--
Sequence 2 KGHIHTNMVSTILRTLGQTFEEKDLQTLITEIDADGSGELEFDEFLTLTA

Sequence 1 K-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           ---------A----L--AF---D---NG-I----L---L-------T--E
Sequence 2 RFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDE

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----I---D--G-G-----EF--MMT--------
Sequence 2 LDEMIAEIDTDGSGTVDFDEFMEMMTGD------



Alignment 27
Sequence 1:
Sequence 2: Allergen Der f 39.0101, Sequence: QBF67841
Sequence identity: 23.73 (42/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------S--------V--L---F--FD---
Sequence 2 -------------------------MSVEELTKEQVQMLRKAFDMFDREK

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-I-------ILR--G----E--------E-D-DG-G-----EF--L--
Sequence 2 KGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGELEFDEFLTLTA

Sequence 1 K-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           ---------A----L--AF---D---NG-I----L---L-------T--E
Sequence 2 RFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDE

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----I---D--G-G-----EF--MMT--------
Sequence 2 LDEMIAEIDTDGSGTVDFDEFMEMMTGD------



Alignment 28
Sequence 1:
Sequence 2: Allergen Der f 26.0101, Sequence: AIO08852
Sequence identity: 23.16 (41/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           -----------------------------------V------F---D--G
Sequence 2 ---------------------------MADLRPPEVEKARLHFDIYDFDG

Sequence 1 DGKISGSELADILRSMG-SEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-
           --K-----L-D-LRS-----------K---E-----G-------EF----
Sequence 2 QSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKK--GQKFMTFEEFLPIY

Sequence 1 -NIK-----GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIE
           ---K-----GA---DL----KV-D---NGT---AEL---L-S-GE--T--
Sequence 2 SQVKKDKDCGA-FEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA

Sequence 1 ESKNIIHNVDKNGD--GLISVEEFQTMMTSEMTDKSK---
           E---II-------D--G----E-F----------------
Sequence 2 EVEEIIKTCGGGCDDEGFMKYETFIKNVMAGPFPEEAGKS



Alignment 29
Sequence 1:
Sequence 2: Allergen Bla g 8.0101, Sequence: ABD47458
Sequence identity: 23.73 (42/177)
Sequence 1 --------MRGSHHHHHHGSMDEVPSSDGSKSAS-SGKRVL----EQSVH
           -------------------------SS-GS--A---G--V--------V-
Sequence 2 KAKEEAPAAEAAPAPAPAAAEPARQSSRGSRKAQRKGSNVFSMFSQKQVA

Sequence 1 ELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGD
           E--E-F---DA--DG-IS---L-------G------E---M--EA-----
Sequence 2 EFKEAFQLMDADKDGIISKNDLRATFDQLGRLAVDKELDEMVNEAP----

Sequence 1 GYVSLQEFVDL---NIKGATVKD--LKNAFKVFDRDCNGTISPAELCQTL
           G---------L------G----D-----AFK-F--D--G-I----L---L
Sequence 2 GPINFTQLLTLFAGRMSGGSDDDEVVIAAFKTFEDD--GKIDSERLRHAL

Sequence 1 KSMGEPCTIEESKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK-----
           ---G------E------N------G-I---------T-------------
Sequence 2 MTWGDKFSADEVDDAYDNFEIDDKGFINTAKLIQLLTASPEEEEGGEGEA

Sequence 1 -
           -
Sequence 2 A



Alignment 30
Sequence 1:
Sequence 2: Allergen Per a 6.0101, Sequence: Q1M0Y3
Sequence identity: 24.86 (44/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------L---F--FD---
Sequence 2 ---------------------------MDELPDEQIQLLKKAFDAFDREK

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-IS------IL---G---D---------E-D-DG-G----QEFV-L--
Sequence 2 NGFISTDMVGTILEMLGHPLDDDMLEEIIAEVDADGSGELEFQEFVTLAA

Sequence 1 K-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           ---------A----LK-AF---D---NG-I----L---LK------T-E-
Sequence 2 RFLVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNED

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----I---D--G-G-----EF---MT-E------
Sequence 2 LDAMIEEIDSDGSGTVDFDEFMEVMTGE------



Alignment 31
Sequence 1:
Sequence 2: Allergen Bla g 6.0301, Sequence: ABB89298
Sequence identity: 25.42 (45/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           ------------------------A-------------L---F--FD---
Sequence 2 -----------------------MADEQLQLPPEQISVLRKAFDAFDREK

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-IS------ILR-MG-------------E-D-D--G-----EFV-L--
Sequence 2 SGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGRLEFDEFVTLAA

Sequence 1 K-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           K--------A--K-L--AF---D---NG-I----L---L----E--T--E
Sequence 2 KFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDE

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----I---D--G-G-----EF--MMT--------
Sequence 2 LDMMIEEIDADGSGTVDFDEFMEMMTG-------



Alignment 32
Sequence 1:
Sequence 2: Allergen Lat c 1.0101, Sequence: Q5IRB2
Sequence identity: 16.95 (30/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           ---------------------EA---A---------D-------FV----
Sequence 2 -------------MAFAGILNEADITAALAACQA-ADSFKHKDFFVKVGL

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAEL---CQTLKSMGEPCTIEESKNI
           -G----D-K-AF-V-D-D--G-I---EL----Q---------T--E-K--
Sequence 2 AGKSDDDVKKAFAVIDQDKSGFIEEDELKLFLQNFSASARALTDAETKEF

Sequence 1 IHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----D--GDG-I-V-EF-------------
Sequence 2 LKAGDSDGDGKIGVDEFAALVKV-------



Alignment 33
Sequence 1:
Sequence 2: Allergen Per a 8.0101, Sequence: H6WP59
Sequence identity: 23.73 (42/177)
Sequence 1 ---------------------MRGSHHHHHHGSMDEVPSSDGSKSAS-SG
           --------------------------------------SS-GS--A---G
Sequence 2 MADKEKKKKKKAKEEAPAAAAEAAPAAAPAPAAEPNRQSSRGSRKAKRAG

Sequence 1 KRVL----EQSVHELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAE
           --V--------V-E--E-F---D---DG-IS---L-------G------E
Sequence 2 SNVFSMFSQKQVAEFKEAFQLMDQDKDGIISKNDLRATFDQLGRLAVDKE

Sequence 1 VKAMMEEADTDGDGYVSLQEFVDL---NIKGATVKD--LKNAFKVFDRDC
           ---M--EA-----G---------L------G----D-----AFK-FD---
Sequence 2 LDEMVNEAP----GPINFTQLLTLFAGRMSGGSDDDEVVIAAFKSFDDE-

Sequence 1 NGTISPAELCQTLKSMGEPCTIEESKNIIHNVDKNGDGLISVEEFQTMMT
           -G-I----L---L---G-----EE------N------G-I---------T
Sequence 2 -GKIDSEKLRHALMTWGDKFSGEEVDDAYDNFEIDDKGFINTAKLIQLLT

Sequence 1 SEMTDKSK------
           --------------
Sequence 2 ASPEEEEGGEGEAA



Alignment 34
Sequence 1:
Sequence 2: Allergen Bla g 6.0101, Sequence: ABB89296
Sequence identity: 23.73 (42/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------L---F--FD---
Sequence 2 ---------------------------MDELPPEQIQLLKKAFDAFDREK

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-IS------IL---G---D---------E-D-DG-G-----EFV-L--
Sequence 2 KGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGSGELEFEEFVSLAS

Sequence 1 K-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           ---------A----L--AF---D---NG-I----L---LK------T-E-
Sequence 2 RFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKITAED

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----I---D--G-G-----EF---MT-E------
Sequence 2 LDMMIEEIDSDGSGTVDFDEFMEVMTGE------



Alignment 35
Sequence 1:
Sequence 2: Allergen Der p 26.0101, Sequence: QAT18638
Sequence identity: 20.90 (37/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           -----------------------------------V------F---D--G
Sequence 2 ---------------------------MADLRPPEVEKARLHFDIYDFEG

Sequence 1 DGKISGSELADILRSMG-SEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-
           -GK-----L-D-LRS-------E---K---E-----G--Y----EF----
Sequence 2 QGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKK--GQKYMTFEEFLPIY

Sequence 1 -NIK-----GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIE
           ---K-----GA---DL----KV-D---NGT---AEL---L-S-GE---I-
Sequence 2 SQVKKDKDCGA-YEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENWMIR

Sequence 1 ESKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           -----------------------------------
Sequence 2 K----------------------------------



Alignment 36
Sequence 1:
Sequence 2: Allergen Hom a 6.0101, Sequence: P29291
Sequence identity: 25.99 (46/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------L---F--FD---
Sequence 2 ---------------------------MDSLDAEQLSALQKAFDSFDTDS

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -G-I-------ILR-MG----E--------E-D-DG-G-----EFV-L--
Sequence 2 KGFITPETVGVILRMMGVKISEKNLQEVISETDEDGSGELEFEEFVELAA

Sequence 1 KGATVKD-------LKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE
           K-----D-------L--AF-V-DR--NG-I----L---L-------T-E-
Sequence 2 KFLIEEDEEALKAELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEED

Sequence 1 SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ---II--VD--G-G-----EF--MM---------
Sequence 2 LDSIIEEVDEDGSGTLDFNEFMQMMNG-------



Alignment 37
Sequence 1:
Sequence 2: Allergen Ran e 1, Sequence: CAC83046
Sequence identity: 15.82 (28/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-N
           ---------------M------A---------------------F--L--
Sequence 2 ---------------MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCG

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSM---GEPCTIEESKN
           -K----------F-V-D-D--G-I---ELC--LK-----G------E---
Sequence 2 LKSKSKEIMQKVFHVLDQDQSGFIEKEELCLILKGFTPEGRSLSDKETTA

Sequence 1 IIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           -----DK-GDG-I-V-EF-T-----------
Sequence 2 LLAAGDKDGDGKIGVDEFVTLVSES------



Alignment 38
Sequence 1:
Sequence 2: Allergen Gal d 8.0101, Sequence: C1L370
Sequence identity: 15.25 (27/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-N
           ---------------M----------------------------F-----
Sequence 2 ---------------MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVG

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSM---GEPCTIEESKN
           -K-----D-K--F---D-D--G-I---EL---LK-----G------E-K-
Sequence 2 LKKKSPEDVKKVFHILDKDRSGFIEEEELKFVLKGFTPDGRDLSDKETKA

Sequence 1 IIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           -----DK-GDG-I---EF-TM----------
Sequence 2 LLAAGDKDGDGKIGADEFATMVAES------



Alignment 39
Sequence 1:
Sequence 2: Allergen Sar sa 1.0101, Sequence: FM177701
Sequence identity: 16.95 (30/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           -------------------V-EA---A--E-A----D-------F-----
Sequence 2 -------------MALAGLVKEADITAALE-ACKAADSFDHKAFFHKVGM

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAEL---CQTLKSMGEPCTIEESKNI
           -G-----LK-AF---D-D--G-I---EL----Q---------T--E-K--
Sequence 2 SGKSADELKKAFAIIDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKF

Sequence 1 IHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----D--GDG-I---EF-------------
Sequence 2 LKAGDNVGDGKIGIDEFNHLVKH-------



Alignment 40
Sequence 1:
Sequence 2: Allergen Clu h 1.0301, Sequence: CAQ72972
Sequence identity: 15.82 (28/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLNI
           ---------------------EA---A----A----D-------F-----
Sequence 2 -------------MAFAAFLKEADITAALG-ACKGADSFDHKAFFAKVGL

Sequence 1 KGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSM---GEPCTIEESKNI
           KG-----LK-AF---D-D--G-I---EL---L----------T--E-K--
Sequence 2 KGKSGDELKKAFEIIDQDKSGFIEEEELKLFLQNFCKGARALTDGETKKF

Sequence 1 IHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           ----D---DG-I---EF-------------
Sequence 2 LKAGDSDNDGKIGIDEFAALINH-------



Alignment 41
Sequence 1:
Sequence 2: Allergen Cro p 2.0101, Sequence: XP_019400389
Sequence identity: 14.12 (25/177)
Sequence 1 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL-N
           ---------------M----------------------------F-----
Sequence 2 ---------------MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVG

Sequence 1 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSM---GEPCTIEESKN
           -K-----D-K--F---D-D--G-I---EL---LK------------E-K-
Sequence 2 LKKKSQDDVKKVFHILDKDRSGFIEEDELKSVLKGFTPDARDLSDKETKE

Sequence 1 IIHNVDKNGDGLISVEEFQTMMTSEMTDKSK
           -----DK-GDG-I-V-EF-------------
Sequence 2 LLAAGDKDGDGKIGVDEFTSLVAES------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.