The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Len c 3.0101

Sequence A0AT29

Full FASTA alignment

Sequence name:
Query sequence:
MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
VNIPYKISTTTNCNTVKF

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Len c 3.0101A0AT29Go!118146.32.1e-37
2Pis s 3.0101A0A161AT60Go!120120.81.0e-29
3Pha v 3.0201ADC80503Go!11896.42.1e-22
4Ara h 9.0101ABX56711Go!11692.63.0e-21
5Lup an 3.0101XP_019446786Go!11690.01.8e-20
6Pla or 3.0101ABY21307Go!11888.84.1e-20
7Pla a 3.0101CAL07989Go!11888.16.7e-20
8Sola l 3.0101P93224Go!11487.97.5e-20
9Lyc e 3AAB42069Go!11487.97.5e-20
10Hev b 12AAL25839Go!11687.31.2e-19
11Fra a 3.0102Q4PLT9Go!11786.81.7e-19
12Pru av 3Q9M5X8Go!11786.62.0e-19
13Fra a 3.0101Q8VX12Go!11786.42.2e-19
14Ara h 9.0201ABX75045Go!9284.56.4e-19
15Pha v 3.0101ADC80502Go!11584.39.2e-19
16Fra a 3.0202Q4PLT6Go!11784.39.3e-19
17Cor a 8AAK28533Go!11583.81.3e-18
18Rub i 3.0101Q0Z8V0Go!11783.71.5e-18
19Mal d 3Q9M5X7Go!11583.12.1e-18
20Pyr c 3Q9M5X6Go!11582.82.7e-18
21Fra a 3.0201Q4PLU0Go!11782.82.7e-18
22Pru du 3.0101ACN11576Go!12382.53.5e-18
23Pun g 1.0301A0A059ST23Go!12082.14.4e-18
24Art gm 3.0102ANC85023Go!11781.85.6e-18
25Art an 3.0102ANC85018Go!11781.85.6e-18
26Pun g 1.0201A0A059SSZ0Go!12081.85.6e-18
27Art ca 3.0102QIN55516Go!11781.47.1e-18
28Zea m 14.0101P19656-1Go!12081.47.1e-18
29Art gm 3.0101ANC85022Go!11780.91.0e-17
30Zea m 14.0102P19656-2Go!12880.81.1e-17
31Pru ar 3P81651Go!9179.71.8e-17
32Art ca 3.0101ANC85021Go!11780.01.8e-17
33Art an 3.0101ANC85017Go!11780.01.8e-17
34Pun g 1.0101A0A059STC4Go!12079.72.3e-17
35Hor v 1AAA32970Go!11779.33.0e-17
36Pru p 3CAB96876Go!9178.63.7e-17
37Pru d 3P82534Go!9178.63.7e-17
38Hor v 1CAA42832Go!13479.04.3e-17
39Pru p 3P81402Go!9178.34.7e-17
40Art la 3.0102ANC85025Go!11577.88.7e-17
41Art v 3.0301EU564847Go!11777.41.1e-16
42Art v 3.0202ACE07187Go!11677.11.4e-16
43Art ar 3.0102ANC85020Go!11677.11.4e-16
44Art si 3.0102ANC85027Go!11677.11.4e-16
45Art v 3.0201EU564845Go!11475.54.1e-16
46Art ar 3.0101ANC85019Go!11675.54.1e-16
47Art la 3.0101ANC85024Go!11675.54.1e-16
48Api g 2ACV04796Go!11875.54.1e-16
49Art si 3.0101ANC85026Go!11675.05.9e-16
50Mor n 3.0101P85894Go!9174.09.4e-16
51Ara h 17.0101A0A510A9S3Go!9372.62.5e-15
52Tri tu 14.0101CAH69206Go!11572.14.5e-15
53Can s 3.0101W0U0V5Go!9171.45.7e-15
54Tri a 14.010119846220Go!9071.07.2e-15
55Sin a 3.0101ABU95411Go!9268.83.4e-14
56Sola l 7.0101NP_001316123Go!11566.71.8e-13
57Hel a 3.0101P82007Go!11666.22.6e-13
58Par j 2P55958Go!13346.23.2e-07
59Par j 2O04403Go!13345.74.6e-07
60Par j 1Q40905Go!13844.79.4e-07
61Par j 1P43217Go!13943.32.5e-06
62Par j 1.0103CAI94601Go!13942.64.0e-06
63Par j 1O04404Go!17642.17.3e-06
64Amb a 6O04004Go!11840.71.3e-05
65Par j 1.0101CAA54587Go!13339.63.0e-05

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 100.00 (118/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
Sequence 2 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
Sequence 2 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG

Sequence 1 VNIPYKISTTTNCNTVKF
           VNIPYKISTTTNCNTVKF
Sequence 2 VNIPYKISTTTNCNTVKF



Alignment 2
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 80.51 (95/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTG--GPG
           MAR-MKLACV-LVICMVVIAPMAE-A-SCG-V--D--PC-TYL-------
Sequence 2 MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNAS

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P-P-CC-GVKKLLAAA-TTPDRQAACNCLKSAAGSI-KLNTNNAAALPGK
Sequence 2 PPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGV-IPYKIST-TNCNTV-F
Sequence 2 CGVSIPYKISTSTNCNTVRF



Alignment 3
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 64.41 (76/118)
Sequence 1 MARGMKLACVVLVICMVVI-APMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -------ACVV-V-C-VV--AP-A--AISCG-VTS-L--C---LT-GGP-
Sequence 2 -MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GV--L-AAA-TTPDRQA-CNCLKSAAG-I---N-NNA--LPGK
Sequence 2 PA-SCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGV-IPYKIST-TNC-T-KF
Sequence 2 CGVSIPYKISTSTNCATIKF



Alignment 4
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 61.86 (73/118)
Sequence 1 MARGMKLACVVLVICMVVI-APMAEGAISCGAVTSDLSPCLTYLTGGPGP
           -----K-A-V-LV-CM----APM---AISCG-V-S-L-PC---LT-G--P
Sequence 2 -MASLKFAFVMLV-CMAMVGAPMVN-AISCGQVNSALAPCIPFLTKGGAP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           -P-CC-GV--LL-A--TT-DRQAACNCLK-AAGS---LN--NAAALPG-C
Sequence 2 PPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GV-IPYKIST-TNC-T-KF
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 5
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 61.02 (72/118)
Sequence 1 MARGMKLACVVLVICMVVI-APMAEGAISCGAVTSDLSPCLTYL-TGGPG
           MA---KLAC-VL-ICMVV--AP----AI-CG-VT--L--CL-YL--GG--
Sequence 2 MAGIVKLACAVL-ICMVVVSAPLTK-AITCGQVTANLAQCLNYLRSGGAV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P-P-CC-G-K--L--A-TTPDR--ACNCLK-AA-----LN--NA--LPGK
Sequence 2 PAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIST-TNC---K-
Sequence 2 CGVNIPYKISTSTNCASIK-



Alignment 6
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 57.63 (68/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG
           ----R--KLAC--L--CMV--AP-AE-AI-CG-V---L-PCLTYL--G--
Sequence 2 MAFSRVAKLACLLLA-CMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGA

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           --P-CC-GVK-L---A-TTPDRQAAC-CLK-A--SI------NAA-L-GK
Sequence 2 VAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVN-PYKIS-T--C--VK-
Sequence 2 CGVNLPYKISPTIDCSKVK-



Alignment 7
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 56.78 (67/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG
           ----R--KLAC--L--CMV--AP-AE-AI-CG-V---L-PCLT-L--G--
Sequence 2 MAFSRVAKLACLLLA-CMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           --P-CC-GVK-L---A-TTPDRQAAC-CLK-A--SI------NAA-L-GK
Sequence 2 VAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVN-PYKIS-T--C--VK-
Sequence 2 CGVNLPYKISPTIDCSKVK-



Alignment 8
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 61.02 (72/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           M----K-AC-V-V-CMVV-AP-AE---SCG-VTS-L-PCL-YL-G--GP-
Sequence 2 MEMFGKIACFV-VFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPL

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           --CCGGVK-LL-AA-T--DR--AC-CLKSAA-SI----T--AA-LPG-CG
Sequence 2 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG

Sequence 1 VNIPYKISTTTNCNTVKF
           VNIPYKIS--T-C-TV--
Sequence 2 VNIPYKISPSTDCSTVQ-



Alignment 9
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 61.02 (72/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           M----K-AC-V-V-CMVV-AP-AE---SCG-VTS-L-PCL-YL-G--GP-
Sequence 2 MEMFGKIACFV-VFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPL

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           --CCGGVK-LL-AA-T--DR--AC-CLKSAA-SI----T--AA-LPG-CG
Sequence 2 GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCG

Sequence 1 VNIPYKISTTTNCNTVKF
           VNIPYKIS--T-C-TV--
Sequence 2 VNIPYKISPSTDCSTVQ-



Alignment 10
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 56.78 (67/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGP
           -----------LV-CM-V-APM---AI-CG-V-S-L-PCL-YL-T-GP-P
Sequence 2 --MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           ---CC-GV-----AA-TT-DR--AC-CLKSAAGS---LN----A-LPGKC
Sequence 2 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GVNIPYKIS--TNC-TVK-
Sequence 2 GVNIPYKISLSTNCATVK-



Alignment 11
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 58.47 (69/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGP
           ------MKL--V-L--C-VV--P-A--AI-CG-V-S--SPC-TY---GG-
Sequence 2 MASSTAMKLSLVAL-LCIVVALPIAQ-AITCGQVASNISPCVTYVKSGGA

Sequence 1 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG
           -P-P-CC-G---L---A-TT-DRQA-CNCLK-AAG-I--LN-N-AA-LPG
Sequence 2 VPAP-CCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPG

Sequence 1 KCGVNIPYKISTTTNCNTVKF
           KCGV--PYKISTTTNC--VK-
Sequence 2 KCGVSVPYKISTTTNCAAVK-



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 54.24 (64/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG
           -------KLA-VV---CMVV--P-A--A--CG-V-S-L-PC--Y--GG--
Sequence 2 MACSAMTKLALVV-ALCMVVSVPIAQ-ALTCGQVSSNLAPCIAYVRGGGA

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           --P-CC-G-------A-TT-DRQ-ACNCLK----S----N-NNAAALPGK
Sequence 2 VPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVN-PYKIS--TNC-TVK-
Sequence 2 CGVNVPYKISPSTNCATVK-



Alignment 13
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 59.32 (70/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGP
           ------MKL--V-L--C-VV--P-A--AI-CG-V-S--SPCLTY---GG-
Sequence 2 MASSTAMKLSLVAL-LCIVVALPIAQ-AITCGQVASNISPCLTYVKSGGA

Sequence 1 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG
           -P---CC-G---L---A-TT-DRQAACNCLK-AAG-I--LN-N-AA-LPG
Sequence 2 VPAA-CCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPG

Sequence 1 KCGVNIPYKISTTTNCNTVKF
           KCGV--PYKISTTTNC--VK-
Sequence 2 KCGVSVPYKISTTTNCAAVK-



Alignment 14
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 53.39 (63/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           ---------------------------SCG-V-S-L-PC-T-LT-G--PS
Sequence 2 --------------------------LSCGQVNSALAPCITFLTKGGVPS

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           --CC-GV--LL-AA-TT-DRQAACNCLK-AAGS---LN--NAAALPG-CG
Sequence 2 GPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCG

Sequence 1 VNIPYKISTTTNCNTVKF
           V-IPYKIST-TNC-T-KF
Sequence 2 VSIPYKISTSTNCATIKF



Alignment 15
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 50.85 (60/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           -----K-ACVV-V-CMVV----------CG-V-S-L-PC-T-L--G----
Sequence 2 -MASVKFACVV-VLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           --CC-GV------A--T-DR---CNCLK-AAG----LN-NNA-ALPGKCG
Sequence 2 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG

Sequence 1 VNIPYKISTTTNCNTVKF
           VNIPYKIST-TNC-----
Sequence 2 VNIPYKISTSTNCASIN-



Alignment 16
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 55.93 (66/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGP
           ------MKL--V-L--C-VV--P-A--AI-CG-V-S--SPC--Y---GG-
Sequence 2 MAISTAMKLSLVAL-LCIVVALPIAQ-AITCGQVASSISPCVNYVKSGGA

Sequence 1 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG
           -P---CC-G---L--AA-TT-DRQ--CNCLK-A-G-I--LN-N-AA-LPG
Sequence 2 VPAA-CCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPG

Sequence 1 KCGVNIPYKISTTTNCNTVKF
           KCGVN-PYKIST-TNC--VK-
Sequence 2 KCGVNVPYKISTSTNCAAVK-



Alignment 17
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 52.54 (62/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           -----KL-C-VL--CM-V-AP-A-----C------L-PC--YL--G----
Sequence 2 -MGSLKLVCAVL-LCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLP

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           P-CC-GV-----A--TT-DRQ-ACNCLK--A--I--LN-N-AA-LPGKCG
Sequence 2 PSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCG

Sequence 1 VNIPYKISTTTNCNTVKF
           VNIPYKIS--TNCN-VK-
Sequence 2 VNIPYKISPSTNCNNVK-



Alignment 18
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 55.08 (65/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG
           ------MKLA-V-L--C-VV--P-A--AI-CG-VT----PC--Y---G--
Sequence 2 MACSAVMKLALVAL-LCIVVAVPVAQ-AITCGQVTQNVAPCFNYVKNGGA

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           ----CC-GV--L---A-TT-DRQ--CNCLK-AAGSI--LN---AA-LPGK
Sequence 2 VPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGV--PYKIST-TNC-TVK-
Sequence 2 CGVSVPYKISTSTNCATVK-



Alignment 19
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 55.08 (65/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG
           -------KLA-VV---CM-V----A---I-CG-VTS-L-PC--Y---G--
Sequence 2 MASSAVTKLALVV-ALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGA

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           --P-CC-G-------A-TT-DRQ-ACNCLK--AGSI---N-NNAA-LPGK
Sequence 2 VPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVN-PYKIST-TNC-TVK-
Sequence 2 CGVNVPYKISTSTNCATVK-



Alignment 20
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 52.54 (62/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG
           -------KLA-VV---CM-V----A---I-C--V---L-PC--Y---G--
Sequence 2 MASSAVIKLALVV-ALCMAVSVAHA---ITCSQVSANLAPCINYVRSGGA

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           --P-CC-G-K-----A-TTPDRQAACNCLK--AGS----N--NA--LPGK
Sequence 2 VPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVN-PYKIST-TNC-TVK-
Sequence 2 CGVNVPYKISTSTNCATVK-



Alignment 21
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 55.08 (65/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGP
           ------MKL--V-L--C-VV--P-A--AI-CG-V-S--SPC--Y---GG-
Sequence 2 MASSTAMKLSLVAL-LCIVVALPIAQ-AITCGQVASSISPCVNYVKSGGA

Sequence 1 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG
           -P---CC-G---L--AA-TT-DRQA-CNCLK-A-G-I--LN---AA-LPG
Sequence 2 VPAA-CCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPG

Sequence 1 KCGVNIPYKISTTTNCNTVKF
           KCGV--PYKIST-TNC--VK-
Sequence 2 KCGVSVPYKISTSTNCAAVK-



Alignment 22
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 51.69 (61/118)
Sequence 1 ---MARGMKLACVVLVIC-MVVIAPMAEGAISCGAVTSDLSPCLTYLTGG
           --------KL-C-V-V-C-M-V--P-A--A-SCG-V---L-PC--Y---G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 PGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNN--AAA
           ----P-CC-GV--L---A-TT-DRQ--CNCLK-A---I---N-N---AA-
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 LPGKCGVNIPYKISTTTNCNTVKF
           LPGKCGVNIPYKIS--T-C-T-K-
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK-



Alignment 23
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 54.24 (64/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTG-GP
           --------LA--VLV-CM-V----AE--I-CG-V-S-L--C--Y--G-G-
Sequence 2 MASSGFLRLAGFVLV-CMAVASTVAEAGITCGQVSSSLAGCIQYARGNGA

Sequence 1 GPSPQ-CCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALP
           GP-PQ-CC-G---L--AA-TTPDRQAAC-CLKS-A-SI---N----A--P
Sequence 2 GPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAP

Sequence 1 GKCGVNIPYKISTTTNCNTVKF
           GKCGV-IPYKI---TNC--VK-
Sequence 2 GKCGVSIPYKIAPSTNCDNVK-



Alignment 24
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 54.24 (64/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--CV--V-CMVV----AE-A--C--V----SPCL--L--GG--
Sequence 2 MAMKMMKVFCV-MVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--AA-TTPDRQ-ACNCLK----S---L---NA--LP-K
Sequence 2 PA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIS--T-CN-VK-
Sequence 2 CGVNIPYKISLETDCNKVK-



Alignment 25
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 55.08 (65/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGP
           -----MK--CV--V-CMVV----AE-A--C--VT---SPC---L--G-G-
Sequence 2 MAMKMMKVFCV-MVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKG-GE

Sequence 1 SP-QCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           -P--CC-GVK-L--AA-TTPDRQAACNCLK----S-------NAA-LP-K
Sequence 2 VPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIS--T-CN-VK-
Sequence 2 CGVNIPYKISLETDCNKVK-



Alignment 26
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 53.39 (63/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGG-P
           ----R--------L--CMVV-A---E-A--CG-VTS-L-PC--Y--G---
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG
           -PS--CC-GV--L--AA-TTPDRQ-ACNCLK--A-SIT--N-----ALPG
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGVNIPYKISTTTNCNTVKF
           KCGV-IPYKIS--T-C--VK-
Sequence 2 KCGVSIPYKISPSTDCSRVK-



Alignment 27
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 52.54 (62/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--CV----CMVV----AE-A--C--V-----PCL--L--GG--
Sequence 2 MAMKMMKVFCV-MIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--AA-T-PDRQ-ACNCLK----S---L---NA--LP-K
Sequence 2 PA-DCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIS--T-CNTVK-
Sequence 2 CGVNIPYKISLETDCNTVK-



Alignment 28
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 53.39 (63/118)
Sequence 1 MARGMKLACVVLVICMVVI--APMAEGAISCGAVTSDLSPCLTYLTG-GP
           MAR---LA-V-------V---A---E-AISCG-V-S---PC--Y--G-G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG
           GPS--CC-GV--L--AA-TT-DR-AACNCLK-AA-----LN--NAA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISTTTNCNTVKF
           KCGV-IPY-IST-T-C--V--
Sequence 2 KCGVSIPYTISTSTDCSRVN-



Alignment 29
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 53.39 (63/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--CV--V-CMVV----AE-A--C--V----SPC---L--GG--
Sequence 2 MAMKMMKVFCV-MVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--AA-TTPDRQ-ACNCLK----S-------NAA-LP-K
Sequence 2 PA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIS--T-CN-VK-
Sequence 2 CGVNIPYKISLETDCNKVK-



Alignment 30
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 52.54 (62/118)
Sequence 1 MARGMKLACVVLVICMVVI--APMAEGAISCGAVTSDLSPCLTYLTG-GP
           MAR---LA-V-------V---A---E-AISCG-V-S---PC--Y--G-G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG
           GPS--CC-GV--L--AA-TT-DR-AACNCLK-AA-----LN--NAA--P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISTTTNCNTVKF-------
           KCGV-IPY-IST-T-C------------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 31
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 47.46 (56/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           --------------------------I-CG-V-S-L-PC--Y--GG----
Sequence 2 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           P-CC-G-------A-TTPDR--ACNCLK---GSI---N-NNAAALPGKCG
Sequence 2 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG

Sequence 1 VNIPYKISTTTNCNTVKF
           VNIPYKIS--TNC-TVK-
Sequence 2 VNIPYKISASTNCATVK-



Alignment 32
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 51.69 (61/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGP
           -----MK--CV--V-CMVV----AE-A--C--V-----PC---L--G---
Sequence 2 MAMKMMKVFCV-MVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEV

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           S--CC-GVK-L--AA-TTPDRQAACNCLK----S-------NA--LP-KC
Sequence 2 SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GVNIPYKIS--T-CN-VK-
Sequence 2 GVNIPYKISLETDCNKVK-



Alignment 33
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 51.69 (61/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGP
           -----MK--CV--V-CMVV----AE-A--C--V-----PC---L--G---
Sequence 2 MAMKMMKVFCV-MVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEV

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           S--CC-GVK-L--AA-TTPDRQAACNCLK----S-------NA--LP-KC
Sequence 2 SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GVNIPYKIS--T-CN-VK-
Sequence 2 GVNIPYKISLETDCNKVK-



Alignment 34
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 53.39 (63/118)
Sequence 1 --MARGMKLACVVLVICMVVIAPMA-EGAISCGAVTSDLSPCLTYL--TG
           -------KLAC-V-----V--AP-A-E-A--CG-V-S-L-PC--Y----G
Sequence 2 MTGSGLFKLACAVFAVALVA-APIATEAAVTCGQVASSLAPCIPYARSAG

Sequence 1 GPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAAL
           G--P-P-CC-G-K-L---A-TTPDRQA-C-CLKSA--SI---N----A-L
Sequence 2 GAVP-PACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASL

Sequence 1 PGKCGVNIPYKISTTTNCNTVKF
           P-KCGVNIPYKIS--T-C--VK-
Sequence 2 PAKCGVNIPYKISPSTDCARVK-



Alignment 35
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 47.46 (56/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           MAR---L--------M---AP-A--A--CG-V-S---PCLTY--GGPGPS
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           --CC-GV--L---A----DRQ--CNCLK--A--I--LN-NNAA--P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNIPYKISTTTNCNTVKF
           VN-PY-IS----C-----
Sequence 2 VNVPYTISPDIDCSRIY-



Alignment 36
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 46.61 (55/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           --------------------------I-CG-V-S-L-PC--Y--GG----
Sequence 2 --------------------------ITCGQVSSSLAPCIPYVRGGGAVP

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           P-CC-G-------A-TTPDRQAACNCLK----S----N-NNAAALPGKCG
Sequence 2 PACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCG

Sequence 1 VNIPYKISTTTNCNTVKF
           V-IPYKIS--TNC-TVK-
Sequence 2 VSIPYKISASTNCATVK-



Alignment 37
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 46.61 (55/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           --------------------------I-CG-V-S-L-PC--Y--GG----
Sequence 2 --------------------------ITCGQVSSNLAPCINYVKGGGAVP

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           P-CC-G-------A-TT-DR-AACNCLK---GSI---N-NNAAALPGKCG
Sequence 2 PACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCG

Sequence 1 VNIPYKISTTTNCNTVKF
           VN-PYKIS--TNC-TVK-
Sequence 2 VNVPYKISASTNCATVK-



Alignment 38
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 47.46 (56/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           MAR---L--------M---AP-A--A--CG-V-S---PCLTY--GGPGPS
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           --CC-GV--L---A----DRQ--CNCLK--A--I--LN-NNAA--P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNIPYKISTTTNCNTVKF----------------
           VN-PY-IS----C---------------------
Sequence 2 VNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 39
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 46.61 (55/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           --------------------------I-CG-V-S-L-PC--Y--GG----
Sequence 2 --------------------------ITCGQVSSALAPCIPYVRGGGAVP

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           P-CC-G-------A-TTPDRQAACNCLK----S----N-NNAAALPGKCG
Sequence 2 PACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCG

Sequence 1 VNIPYKISTTTNCNTVKF
           V-IPYKIS--TNC-TVK-
Sequence 2 VHIPYKISASTNCATVK-



Alignment 40
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 50.85 (60/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGP
           ----MK--CV--V-CMVV----AE-A--C--V----SPCL-YL--GG--P
Sequence 2 -MKMMKVFCV-MVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           ---CC-GVK-L--A--TTPDRQ-ACNCLK----S---L----A--LP-KC
Sequence 2 A-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GVNIPYKISTTTNCNTVKF
           G-N-PYK-S--T-CN-VK-
Sequence 2 GLNLPYKLSLETDCNKVK-



Alignment 41
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 50.00 (59/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--C---V-CMVV----AE-A--C--V----SPCL-YL--GG--
Sequence 2 MAIKMMKVFCI-MVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--A--TTPDRQ-ACNCLK----S---L----A--LP-K
Sequence 2 PA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CG-N-PYK-S--T-CN-VK-
Sequence 2 CGLNLPYKLSLETDCNKVK-



Alignment 42
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 52.54 (62/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--C---V-CMV-----AE-A--C--V-----PCL-YL--GG--
Sequence 2 MAMKMMKFFCA-MVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--AA-TTPDRQ-ACNCLK----S---L----AA-LP-K
Sequence 2 PA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIS--T-CN-VK-
Sequence 2 CGVNIPYKISLETDCNKVK-



Alignment 43
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 52.54 (62/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--C---V-CMV-----AE-A--C--V-----PCL-YL--GG--
Sequence 2 MAMKMMKFFCA-MVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--AA-TTPDRQ-ACNCLK----S---L----AA-LP-K
Sequence 2 PA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIS--T-CN-VK-
Sequence 2 CGVNIPYKISLETDCNKVK-



Alignment 44
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 52.54 (62/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--C---V-CMV-----AE-A--C--V-----PCL-YL--GG--
Sequence 2 MAMKMMKFFCA-MVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--AA-TTPDRQ-ACNCLK----S---L----AA-LP-K
Sequence 2 PA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIS--T-CN-VK-
Sequence 2 CGVNIPYKISLETDCNKVK-



Alignment 45
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 52.54 (62/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGP
           ----MK--C---V-CMVV----AE-A--C--V----S-CL-YL--GG--P
Sequence 2 -MKMMKFFCA-MVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGEVP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           ---CC-GVK-L--AA-TTPDRQ-ACNCLK----S--------AA-LP-KC
Sequence 2 A-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GVNIPYKIS--T-CN-VK-
Sequence 2 GVNIPYKISLETDCNKVK-



Alignment 46
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 52.54 (62/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--C---V-CMVV----AE-A--C--V----S-CL-YL--GG--
Sequence 2 MAMKMMKFFCA-MVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--AA-TTPDRQ-ACNCLK----S--------AA-LP-K
Sequence 2 PA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIS--T-CN-VK-
Sequence 2 CGVNIPYKISLETDCNKVK-



Alignment 47
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 52.54 (62/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--C---V-CMVV----AE-A--C--V----S-CL-YL--GG--
Sequence 2 MAMKMMKFFCA-MVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--AA-TTPDRQ-ACNCLK----S--------AA-LP-K
Sequence 2 PA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGVNIPYKIS--T-CN-VK-
Sequence 2 CGVNIPYKISLETDCNKVK-



Alignment 48
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 49.15 (58/118)
Sequence 1 MARGMKLACVVLVICMVVIA--PMAEGAISCGAVTSDLSPCLTYLTGGPG
           -----K-A--V-V--MVV----P-------CG-VT--L--CL-YL-GG--
Sequence 2 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           PSP-CCGGVK-L---A-T--DR--AC-CLK--AGS----N---A-ALPGK
Sequence 2 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CG--IPY-IS--T-C--V--
Sequence 2 CGIRIPYPISPSTDCSRVN-



Alignment 49
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 50.85 (60/118)
Sequence 1 -MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPG
           -----MK--CV--V-CMVV----AE-A--C--V----SPCL-YL--GG--
Sequence 2 MAMKMMKVFCV-MVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGEV

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GVK-L--AA-TTPDRQ-AC-CLK--------L----A--LP-K
Sequence 2 PA-NCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CGV-IPYK-S--T-CN-VK-
Sequence 2 CGVTIPYKLSMETDCNKVK-



Alignment 50
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 48.31 (57/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGP
           --------------------------I-CG-V-S-L-PC--YL--GG--P
Sequence 2 --------------------------ITCGQVSSSLAPCINYLRAGGVVP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           ---CC-GV--L--AA-TT-DRQAACNCLKSA--SI--LN-N-AA-LPGKC
Sequence 2 A-NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GV--PYKIS--T-C--VK-
Sequence 2 GVSVPYKISPSTDCKSVK-



Alignment 51
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 44.07 (52/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           -------------------------AI-C--VT----PC--YL--G---S
Sequence 2 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSI-TKLNTNNAAALPGKC
           --CC-G-------A-TT-DRQA-CNCLKSAA-S-----N-NNAA-LPGKC
Sequence 2 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GV-IPYKIST--NC---K-
Sequence 2 GVSIPYKISTSINCSSIK-



Alignment 52
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 43.22 (51/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTG-GPGP
           MAR------V-------------E-A-SCG-V-S-LSPC--Y--G-G--P
Sequence 2 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           S--CC-GV--L---A--T-D-QAAC-C-KSAA-----LN---AA--P-KC
Sequence 2 SAACCSGVRSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPTKC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GV--PY-IS----C-----
Sequence 2 GVSVPYAISSSVDCSKIR-



Alignment 53
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 46.61 (55/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGP
           --------------------------I-CG-V-S-L-PCL-YL--GG--P
Sequence 2 --------------------------ITCGQVASSLAPCLSYLKVGGAVP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           ---CC---K-L--AA-T--DRQAAC-CLKSAA-SI---N-N-A--LPGKC
Sequence 2 DG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPGKC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GV-IPYKIS--T-C--VK-
Sequence 2 GVSIPYKISPSTDCSSVK-



Alignment 54
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 42.37 (50/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           --------------------------I-CG-V-S---PCL-Y--GGPGPS
Sequence 2 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS

Sequence 1 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCG
           -QCC-GVK-L---A----DRQ-ACNCLK--A--I--LN--NA---P-KCG
Sequence 2 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG

Sequence 1 VNIPYKISTTTNCNTVKF
           VN-PY-IS----C--V--
Sequence 2 VNLPYTISLNIDCSRV--



Alignment 55
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 45.76 (54/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS
           -------------------------A-SCG-V-S-L--C--YLT----P-
Sequence 2 -------------------------ALSCGTVNSNLAACIGYLTQN-APL

Sequence 1 PQ-CCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           P--CC-GV--L---A-TTPDRQ-AC-CL--AA-S---LN---AAALP--C
Sequence 2 PKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKAC

Sequence 1 GVNIPYKISTTTNCNTVKF
           GVNIPYKIS--TNCN-V--
Sequence 2 GVNIPYKISKSTNCNSVR-



Alignment 56
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 41.53 (49/118)
Sequence 1 MARGMK-LACVVLVICMVV-IAPMAEGAISCGAVTSDLSPCLTYLTGGPG
           ----MK--A--VLV---V---A--A-GAI-CG-V---L-PC---LT-G--
Sequence 2 ----MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGE

Sequence 1 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK
           P---CC-GV--L--------DR--ACNC-K-AA-----L----A--LP-K
Sequence 2 PGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSK

Sequence 1 CGVNIPYKISTTTNCNTVKF
           CG------IS-T-NC-T---
Sequence 2 CGISLTVPISRTVNCDTIS-



Alignment 57
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 40.68 (48/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMA---EGAISCGAVTSDLSPCLTYLTGGP
           ----------V----M-V-A--------AI-C--VT--L-PCL-YL--G-
Sequence 2 ---MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGG

Sequence 1 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG
           -P-P-CC-G-KKLL-A--T--DR--AC-C-K-AA----K-----A--LPG
Sequence 2 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQL-KVRPDMASSLPG

Sequence 1 KCGVNIPYKISTTTNCNTVKF
           KCG------I----NCNT---
Sequence 2 KCGISTSIPINPNVNCNTIP-



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 29.66 (35/118)
Sequence 1 -------MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL
           --------------A-----------AP-A-G---CG-V--D--PCL---
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAP-APGEEACGKVVQDIMPCLHFV

Sequence 1 TGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNA
           -G----PS--CC-G-KKL-----TT-----AC-C---A---I--------
Sequence 2 KGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELV

Sequence 1 AALPGKCGVN--IPYKISTTTNCNTVKF-------
           A--P-KC------P--I-----C------------
Sequence 2 AEVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 29.66 (35/118)
Sequence 1 -------MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL
           --------------A-----------AP-A-G---CG-V-----PCL---
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAP-APGEGPCGKVVHHIMPCLKFV

Sequence 1 TGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNA
           -G----PS--CC-G-KKL-----TT-----AC-C---A---I--------
Sequence 2 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV

Sequence 1 AALPGKCGVN--IPYKISTTTNCNTVKF-------
           A--P-KCG-----P--I-----C------------
Sequence 2 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 27.97 (33/118)
Sequence 1 -----------MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPC
           --------------------V------V--AP-------CG-V---L-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 LTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLN
           L----G----PS--CC-G-K-L-----T-P-R--AC-C---A--------
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 TNNAAALPGKCGV---NIPYKISTTTNCNTVKF------
           -------P--CG------P--I-----C-T---------
Sequence 2 GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 24.58 (29/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG-P
           ----------------------------CG-----L-PCL----G----P
Sequence 2 -------------------------QETCGTMVRALMPCLPFVQGKEKEP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           S--CC-G-K-L-----T-P-R--AC-C---A---------------P--C
Sequence 2 SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHC

Sequence 1 GV---NIPYKISTTTNCNTVKF----------------------------
           G------P--I-----C-TV------------------------------
Sequence 2 GIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARL

Sequence 1 ---------------
           ---------------
Sequence 2 ERPQIRVPPPAPEKA



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 23.73 (28/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG-P
           ----------------------------CG-----L-PCL----G----P
Sequence 2 -------------------------QETCGTMVRALMPCLPFVQGKEKEP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           S--CC-G-K-L-----T-P-R--AC-C---A---------------P--C
Sequence 2 SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHC

Sequence 1 GV---NIPYKISTTTNCNTVKF----------------------------
           G------P--I-----C-T-------------------------------
Sequence 2 GIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARL

Sequence 1 ---------------
           ---------------
Sequence 2 ERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 25.42 (30/118)
Sequence 1 ------------MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSP
           -------------------------------AP-------CG-V---L-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKL
           CL----G----PS--CC-G-K-L-----T---R--AC-C---A-------
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NTNNAAALPGKCGV---NIPYKISTTTNCNTVKF----------------
           --------P--CG------P--I-----C-T-------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 31.36 (37/118)
Sequence 1 MARGMKLACVVLVICMVVIAP-MAEGAISCGAVTSDLSPCLTYLTGGPGP
           M-----L--V------V---P-M------C--V---L-PC---LTG---P
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQE-P

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           S--CC-GV--L-----T--DR-A-CNC-K----SI----------L--KC
Sequence 2 SKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA-YDPKRMPLLSTKC

Sequence 1 GVNIPYK-ISTTTNCNTVKF
           GV------------C-----
Sequence 2 GVKPDFPAVDKNLDCSKLPV



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 22.88 (27/118)
Sequence 1 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG-P
           -----------------------------------L-PCL----G----P
Sequence 2 -------------------------------MVRALMPCLPFVQGKEKEP

Sequence 1 SPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC
           S--CC-G-K-L-----T-P-R--AC-C---A---------------P--C
Sequence 2 SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHC

Sequence 1 GV---NIPYKISTTTNCNTVKF----------------------------
           G------P--I-----C-TV------------------------------
Sequence 2 GIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARL

Sequence 1 ---------------
           ---------------
Sequence 2 ERPQIRVPPPAPEKA


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.