The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Cla h 12

Sequence P50344

Full FASTA alignment

Sequence name:
Query sequence:
MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
LEGKDVKDLLLNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEES
DDDMGFGLFD

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Cla h 12P50344Go!110149.51.6e-38
2Alt a 12P49148Go!110111.05.9e-27
3Pen cr 26.0101AEX34122Go!107106.91.0e-25
4Pen b 26.0101AAX11194Go!107103.61.0e-24
5Cla h 5.0101P42039Go!11161.64.5e-12
6Cla h 5.0101CAA55067Go!11161.64.5e-12
7Asp f 8Q9UUZ6Go!11159.42.2e-11
8Cla h 10.0101P42039Go!11159.42.2e-11
9Alt a 6P42037Go!11352.32.9e-09
10Alt a 6AAB48041Go!11352.32.9e-09
11Fus c 1AAL79930Go!10952.13.2e-09
12Pru du 5.0101Q8H2B9Go!11348.25.0e-08
13Cul n 1AAK00899Go!7830.57.2e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Cla h 12, Sequence: P50344
Sequence identity: 100.00 (110/110)
Sequence 1 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
           MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
Sequence 2 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA

Sequence 1 LEGKDVKDLLLNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEES
           LEGKDVKDLLLNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEES
Sequence 2 LEGKDVKDLLLNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEES

Sequence 1 DDDMGFGLFD
           DDDMGFGLFD
Sequence 2 DDDMGFGLFD



Alignment 2
Sequence 1:
Sequence 2: Allergen Alt a 12, Sequence: P49148
Sequence identity: 73.64 (81/110)
Sequence 1 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
           MS--ELA-SYAALILAD-G--ITADKLQ-LI-AAK--E-EPIWT-LFAKA
Sequence 2 MSTSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKA

Sequence 1 LEGKDVKDLLLNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEES
           LEGKDVKDLLLNVGSGGGAAP----------AA-----AEEK-EEEKEES
Sequence 2 LEGKDVKDLLLNVGSGGGAAPLPEALLLRWRAADAAPAAEEKKEEEKEES

Sequence 1 DDDMGFGLFD
           D-DMGFGLFD
Sequence 2 DEDMGFGLFD



Alignment 3
Sequence 1:
Sequence 2: Allergen Pen cr 26.0101, Sequence: AEX34122
Sequence identity: 71.82 (79/110)
Sequence 1 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
           MS-AELA-SYAALILAD-G-EI-ADK-Q-LISAA-V-E-EPIW-S-FA-A
Sequence 2 MSTAELACSYAALILADDGIEISADKIQTLISAANVQEVEPIWASIFARA

Sequence 1 LEGKDVKDLLLNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEES
           LEGKD-K-LL-NVGS-G-A--A--GAA--GAAA-----AEEK-EEEKEES
Sequence 2 LEGKDIKELLTNVGSAGPASAAPAGAA--GAAAPAEEKAEEK-EEEKEES

Sequence 1 DDDMGFGLFD
           D-DMGFGLFD
Sequence 2 DEDMGFGLFD



Alignment 4
Sequence 1:
Sequence 2: Allergen Pen b 26.0101, Sequence: AAX11194
Sequence identity: 67.27 (74/110)
Sequence 1 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
           MS-AELA-SYAALILAD-G-E--ADK-Q----AAKV-E-EPIW---FAKA
Sequence 2 MSTAELAVSYAALILADDGIEVSADKIQTILGAAKVQEVEPIWATIFAKA

Sequence 1 LEGKDVKDLLLNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEES
           LEGKD-K--L-NVGS-G-A---AG--AA-GAAA------EEK-EEEKEES
Sequence 2 LEGKDIKEILTNVGSAGPAT--AGAPAAAGAAAPAEEKKEEK-EEEKEES

Sequence 1 DDDMGFGLFD
           D-DMGFGLFD
Sequence 2 DEDMGFGLFD



Alignment 5
Sequence 1:
Sequence 2: Allergen Cla h 5.0101, Sequence: P42039
Sequence identity: 46.36 (51/110)
Sequence 1 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
           ------------L----------A-------S-------E----SL--K-
Sequence 2 ----MKYLAAFLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLL-KE

Sequence 1 LEGKDVKDL-------LLNVGSGG-GAAPAAGGAAAGGAAAVLDAPAEEK
           LEGKD---L-------L--V-SGG-GAA-A-G-AAAGGAA----AP--E-
Sequence 2 LEGKDINELISSGSEKLASVPSGGAGAASAGGAAAAGGAAEA--APEAER

Sequence 1 AEEEKEESDDDMGFGLFD
           AEEEKEESDDDMGFGLFD
Sequence 2 AEEEKEESDDDMGFGLFD



Alignment 6
Sequence 1:
Sequence 2: Allergen Cla h 5.0101, Sequence: CAA55067
Sequence identity: 46.36 (51/110)
Sequence 1 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
           ------------L----------A-------S-------E----SL--K-
Sequence 2 ----MKYLAAFLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLL-KE

Sequence 1 LEGKDVKDL-------LLNVGSGG-GAAPAAGGAAAGGAAAVLDAPAEEK
           LEGKD---L-------L--V-SGG-GAA-A-G-AAAGGAA----AP--E-
Sequence 2 LEGKDINELISSGSEKLASVPSGGAGAASAGGAAAAGGAAEA--APEAER

Sequence 1 AEEEKEESDDDMGFGLFD
           AEEEKEESDDDMGFGLFD
Sequence 2 AEEEKEESDDDMGFGLFD



Alignment 7
Sequence 1:
Sequence 2: Allergen Asp f 8, Sequence: Q9UUZ6
Sequence identity: 49.09 (54/110)
Sequence 1 MSAAELASSYAALILADEG-LEITADKLQALISAAKVPEIEPIWTSLFAK
           ----------A-L-LA--G----------A--S-------E-----L-A-
Sequence 2 -----MKYLAAFLLLALAGNTSPSSEDVKAVLSSVGIDADEERLNKLIAE

Sequence 1 ALEGKDVKDL-------LLNVGSGGGAA--PAAGGAAAGGAAAVLDAPAE
           -LEGKD---L-------L--V-SGG-AA--PAA-GAAAGGAAA-----A-
Sequence 2 -LEGKDLQELIAEGSTKLASVPSGGAAAAAPAAAGAAAGGAAA---PAAK

Sequence 1 EKAEEEKEESDDDMGFGLFD
           EK-EEEKEESD-DMGFGLFD
Sequence 2 EKNEEEKEESDEDMGFGLFD



Alignment 8
Sequence 1:
Sequence 2: Allergen Cla h 10.0101, Sequence: P42039
Sequence identity: 44.55 (49/110)
Sequence 1 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
           ------------L----------A-------S-------E----SL--K-
Sequence 2 ----MKYMAAYLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLL-KE

Sequence 1 LEGKDVKDL-------LLNVGSGG-GAAPAAGGAAAGGAAAVLDAPAEEK
           LEGKD---L-------L--V-SGG-GAAP-AGGAAA-G-A----A--E--
Sequence 2 LEGKDINELISSGSQKLASVPSGGSGAAPSAGGAAAAGGAT--EAAPEAA

Sequence 1 AEEEKEESDDDMGFGLFD
           -EEEKEESDDDMGFGLFD
Sequence 2 KEEEKEESDDDMGFGLFD



Alignment 9
Sequence 1:
Sequence 2: Allergen Alt a 6, Sequence: P42037
Sequence identity: 42.73 (47/110)
Sequence 1 ------------MSAAELASSYAALILADEGLEITADKLQALISAAKVPE
           --------------------------L---G-E---D-L--LIS------
Sequence 2 MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISE-----

Sequence 1 IEPIWTSLFAKALEGKDVKDL-------LLNVGSGG-GAAPAAGGAAAGG
           ------------LEGKD---L-------L--V-SGG-G-A-A-GGAAA-G
Sequence 2 ------------LEGKDINELIASGSEKLASVPSGGAGGAAASGGAAAAG

Sequence 1 AAAVLDAPAEEKAEEEKEESDDDMGFGLFD
           --A---A--E---EEEKEESD-DMGFGLFD
Sequence 2 GSAQAEAAPEAAKEEEKEESDEDMGFGLFD



Alignment 10
Sequence 1:
Sequence 2: Allergen Alt a 6, Sequence: AAB48041
Sequence identity: 42.73 (47/110)
Sequence 1 ------------MSAAELASSYAALILADEGLEITADKLQALISAAKVPE
           --------------------------L---G-E---D-L--LIS------
Sequence 2 MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISE-----

Sequence 1 IEPIWTSLFAKALEGKDVKDL-------LLNVGSGG-GAAPAAGGAAAGG
           ------------LEGKD---L-------L--V-SGG-G-A-A-GGAAA-G
Sequence 2 ------------LEGKDINELIASGPEKLASVPSGGAGGAAASGGAAAAG

Sequence 1 AAAVLDAPAEEKAEEEKEESDDDMGFGLFD
           --A---A--E---EEEKEESD-DMGFGLFD
Sequence 2 GSAEAEAAPEAAKEEEKEESDEDMGFGLFD



Alignment 11
Sequence 1:
Sequence 2: Allergen Fus c 1, Sequence: AAL79930
Sequence identity: 40.00 (44/110)
Sequence 1 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
           ------------L----------A----A----------E-----L----
Sequence 2 ----MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISE-

Sequence 1 LEGKDVKDL-------LLNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKA
           LEGKD---L-------L--V-SGG------G-AAAGGAA----A--EEK-
Sequence 2 LEGKDIQQLIAEGSEKLASVPSGGAGGASGGAAAAGGAAE--EAKEEEK-

Sequence 1 EEEKEESDDDMGFGLFD
           EEEKEESD-DMGFGLFD
Sequence 2 EEEKEESDEDMGFGLFD



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru du 5.0101, Sequence: Q8H2B9
Sequence identity: 40.00 (44/110)
Sequence 1 ------------MSAAELASSYAALILADEGLEITADKLQALISAAKVPE
           -------------------------IL---G-E---D--Q-L-S--K---
Sequence 2 MKVVAAYLLAVLGGNTTPSAEDLKDILGSVGAETDDDRIQLLLSEVKGKD

Sequence 1 IEPIWTSLFAKALEGKDVKDLLLNVGSGGGA-APAAGGAAAGGAAAVLDA
           I----T-L-A-----------L--V-SGGGA-A-AA-GA-AG-AA-----
Sequence 2 I----TELIASG------REKLASVPSGGGAVAVAAPGAGAGAAAPAAAE

Sequence 1 PAEEKAEEEKEESDDDMGFGLFD
           P--E---EEKE--DDDMGF-LFD
Sequence 2 PKKEEKVEEKEDTDDDMGFSLFD



Alignment 13
Sequence 1:
Sequence 2: Allergen Cul n 1, Sequence: AAK00899
Sequence identity: 20.91 (23/110)
Sequence 1 MSAAELASSYAALILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKA
           ------------------------------------P-------------
Sequence 2 -----------------------------------APHSIANGFKNLLAL

Sequence 1 LEGKDVKDLLLNVGSGGGAAPAAGGAAAGGAAAVLDAPAEEKAEEEKE--
           ----DV--------------P----AAA---A-------EEK-EE-KE--
Sequence 2 AATTDVDSKEAETIKEYIKDPSKIAAAAAATAPAAETKKEEKKEEKKEET

Sequence 1 -ESDDDMGFGLFD
           -ESDDD-G--LF-
Sequence 2 EESDDDIGLSLFH


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.