The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Sec c 5.0101

Sequence 332205751

Full FASTA alignment

Sequence name:
Query sequence:
MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS
DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV
HAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESS
FNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALS
KAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Sec c 5.0101CBG76811Go!292375.71.1e-105
2Phl p 5.0109CAD87529Go!284232.81.1e-62
3Phl p 5.0101CAA52753Go!312232.41.6e-62
4Poa p 5P22285Go!333232.12.2e-62
5Phl p 5.0107AAC16527Go!276229.79.4e-62
6Poa p 5P22284Go!373228.62.7e-61
7Poa p 5P22286Go!307228.13.1e-61
8Phl p 5.0106AAC16526Go!276227.25.2e-61
9Phl p 5.0102Q40962Go!286226.87.1e-61
10Phl p 5.0108AAC16528Go!276226.21.1e-60
11Phl p 5.0105AAC16525Go!276223.56.8e-60
12Phl p 5.0104CAB05372Go!276221.72.5e-59
13Phl p 5AAK25823Go!275206.01.3e-54
14Lol p 5Q40237Go!339204.54.5e-54
15Lol p 5AAD20386Go!301199.51.3e-52
16Hor v 5.0101U57845Go!313197.36.3e-52
17Hol l 5.0201CAB10766Go!240189.51.0e-49
18Poa p 5.0101Q9FPR0Go!303182.02.4e-47
19Dac g 5.02AAK62277Go!265181.72.5e-47
20Dac g 5.01AAK62276Go!265180.75.1e-47
21Hol l 5.0101CAB10765Go!264175.32.1e-45
22Pha a 5P56164Go!320165.42.6e-42
23Phl p 5.0202CAB05371Go!281164.54.2e-42
24Phl p 5.0201Q40963Go!284163.77.4e-42
25Phl p 5.0204AAC25996Go!265160.56.0e-41
26Phl p 5.02059249029Go!265158.32.9e-40
27Pha a 5P56165Go!305149.11.9e-37
28Pha a 5P56167Go!175144.33.2e-36
29Lol p 5Q40240Go!308137.17.7e-34
30Pha a 5P56166Go!294112.61.8e-26
31Phl p 6.0102CAA76556Go!13859.76.9e-11
32Phl p 6.0101P43215Go!13255.81.0e-09

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Sec c 5.0101, Sequence: CBG76811
Sequence identity: 100.00 (292/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
           MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
Sequence 2 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN

Sequence 1 NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS
           NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS
Sequence 2 NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS

Sequence 1 DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV
           DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV
Sequence 2 DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV

Sequence 1 HAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESS
           HAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESS
Sequence 2 HAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESS

Sequence 1 FNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALS
           FNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALS
Sequence 2 FNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALS

Sequence 1 KAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA
           KAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA
Sequence 2 KAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA



Alignment 2
Sequence 1:
Sequence 2: Allergen Phl p 5.0109, Sequence: CAD87529
Sequence identity: 61.99 (181/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAP-GTQP--KATTPEQKLME
           -----------------A-PA-----Y-PAAP-G--P--KATT-EQKL-E
Sequence 2 ----------ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIE

Sequence 1 NINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIP
           -IN-GFKAA--AAA-V-PADKY-TF--TF---SNKAFA--L-----G---
Sequence 2 KINAGFKAALAAAAGVPPADKYRTFVATFGAASNKAFAEGLSGEPKGA--

Sequence 1 AQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGA
           A-S-S-A-L---L---YKLAY--AEGATPE-KYD-YVA-L-E-LR-I-G-
Sequence 2 AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGT

Sequence 1 FEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVF
           -EVHAVKPA-EEVK--PA--L-V----DAA---AATAANAAP-NDKF-VF
Sequence 2 LEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVF

Sequence 1 ESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQA
           E--FN-AIK--TGGAY-SY-F-PALE-AVKQAYAATVA-APEVKY-VF--
Sequence 2 EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET

Sequence 1 ALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAA---AGGYKA
           AL-KAI-AM-EA-K-AKPAAAA--TATAT--VGAA-GAA----GGYK-
Sequence 2 ALKKAITAMSEAQKAAKPAAAA--TATATSAVGAATGAATAATGGYKV



Alignment 3
Sequence 1:
Sequence 2: Allergen Phl p 5.0101, Sequence: CAA52753
Sequence identity: 68.84 (201/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSY------GTYAPAAP--GTQP------
           MAV-QYTVALFLAVALVAGPA-SY------G---PAAP--G--P------
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADLGYGPATPAAPAAGYTPATPAAP

Sequence 1 -------KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKG
           -------KATT-EQKL-E-IN-GFKAA--AAA-V-PADKY-TF--TF---
Sequence 2 AEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAA

Sequence 1 SNKAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETK
           SNKAFA--L-----G---A-S-S-A-L---L---YKLAY--AEGATPE-K
Sequence 2 SNKAFAEGLSGEPKGA--AESSSKAALTSKLDAAYKLAYKTAEGATPEAK

Sequence 1 YDTYVASLTESLRVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAAYR
           YD-YVA-L-E-LR-I-G--EVHAVKPA-EEVK--PA--L-V----DAA--
Sequence 2 YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFK

Sequence 1 TAATAANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQA
           -AATAANAAP-NDKF-VFE--FN-AIK--TGGAY-SY-F-PALE-AVKQA
Sequence 2 VAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQA

Sequence 1 YAATVASAPEVKYAVFQAALSKAINAMVEAEKDAKPAAAAAATATATATV
           YAATVA-APEVKY-VF--AL-KAI-AM-EA-K-AKPAAAA--TATATA-V
Sequence 2 YAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAA--TATATAAV

Sequence 1 GAAAGAA---AGGYKA
           GAA-GAA----GGYK-
Sequence 2 GAATGAATAATGGYKV



Alignment 4
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22285
Sequence identity: 67.81 (198/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGT----------------------YA
           MAV-QYTVALFLAVALVAGPA-SY------------------------Y-
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAAPAAGYT

Sequence 1 PAAP-GTQPKATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFI
           PAAP-G--PKATT-EQKL-E-IN-GFKAAV-AAA-V---DKYKTF--TF-
Sequence 2 PAAPAGAAPKATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFG

Sequence 1 KGSNKAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPE
           --SNKAFA--L-----G---A-S-----L---L---YKLAY-SAEGATPE
Sequence 2 TASNKAFAEALSTEPKGAAAASSNAV--LTSKLDAAYKLAYKSAEGATPE

Sequence 1 TKYDTYVASLTESLRVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAA
           -KYD-YVA-L-E-LR-I-G--EVHAVKPA-EEVK--PA--L-V-D--DAA
Sequence 2 AKYDAYVATLSEALRIIAGTLEVHAVKPAGEEVKAIPAGELQVIDKVDAA

Sequence 1 YRTAATAANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVK
           ---AATAANAAP-NDKF-VFE--FN-AIK--TGGAY-SY-F-PALE-AVK
Sequence 2 FKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVK

Sequence 1 QAYAATVASAPEVKYAVFQAALSKAINAMVEAEKDAKPAAAAAATAT---
           Q-YAATVA-AP-VKY-VF--AL-KAI-AM--A-K-AKPAAA--ATAT---
Sequence 2 QSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTATATGAV

Sequence 1 --ATATVGAAAGAA---AGGYKA------------
           --AT--VGAA-GAA---AGGYK-------------
Sequence 2 GAATGAVGAATGAATAAAGGYKTGAATPTAGGYKV



Alignment 5
Sequence 1:
Sequence 2: Allergen Phl p 5.0107, Sequence: AAC16527
Sequence identity: 61.30 (179/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPG-TQP--KATTPEQKLME
           ------------------------G---PAAP----P--KATT-EQKL-E
Sequence 2 ------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLIE

Sequence 1 NINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIP
           -IN-GFKAA--AAA-V-PADKYKTF--TF---SNKAFA--L-A---G---
Sequence 2 KINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGA--

Sequence 1 AQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGA
           A-S-S-A-L---L---YKLAY--AEGATPE-KYD-YVA-L-E-LR-I-G-
Sequence 2 AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGT

Sequence 1 FEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVF
           -EVHAVKPA-EEVK--PA--L-V----D-A---AATAANAAP-NDKF-VF
Sequence 2 LEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF

Sequence 1 ESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQA
           E--FN-AIK--TGGAY-SY-F-PALE-AVKQAYAATVA-APEVKY-VF--
Sequence 2 EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET

Sequence 1 ALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGA---AAGGYKA
           AL-KAI-AM-EA-K-AKPAAAA--TATAT--VGAA-GA---AAGGYK-
Sequence 2 ALKKAITAMSEAQKAAKPAAAA--TATATSAVGAATGATTAAAGGYKV



Alignment 6
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22284
Sequence identity: 61.30 (179/292)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSGPDAVGFAKK

Sequence 1 -------------------------------MAVQQYTVALFLAVALVAG
           --------------------------------------V----A----A-
Sequence 2 LDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKAPPASKFPAK

Sequence 1 PAVSYGTYAPAAP-GTQPKATTPEQKLMENINNGFKAAVEAAAAVAPADK
           PA-----Y-PAAP-G--PKATT-EQKL-E-IN-GFKAAV-AAA-V--A-K
Sequence 2 PAPKVAAYTPAAPAGAAPKATTDEQKLIEKINVGFKAAVAAAAGVPAASK

Sequence 1 YKTFQTTFIKGSNKAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAY
           YKTF--TF---SNKAFA--L-----G---A---S-A-L---L---YKLAY
Sequence 2 YKTFVATFGAASNKAFAEALSTEPKGA--AVASSKAVLTSKLDAAYKLAY

Sequence 1 DSAEGATPETKYDTYVASLTESLRVISGAFEVHAVKPASEEVKGVPAPQL
           -SAEGATPE-KYD-YVA-L-E-LR-I-G--EVH-VKPA-EEVK--PA--L
Sequence 2 KSAEGATPEAKYDAYVATLSEALRIIAGTLEVHGVKPAAEEVKAIPAGEL

Sequence 1 KVVDQIDAAYRTAATAANAAPTNDKFNVFESSFNKAIKENTGGAYASYTF
           -V-D--DAA---AATAANAAP-NDKF-VFE--FN-AIK--TGGAY-SY-F
Sequence 2 QVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKF

Sequence 1 VPALESAVKQAYAATVASAPEVKYAVFQAALSKAINAMVEAEKDAKPAAA
           -PALE-AVKQ-YAATVA-AP-VKY-VF--AL-KAI-AM--A-K-AKPAAA
Sequence 2 IPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAA

Sequence 1 AAATATATATVGAAAGAA---AGGYKA
           ---T-TAT--VGAA-GAA---AGGYK-
Sequence 2 V--TGTATSAVGAATGAATAAAGGYKV



Alignment 7
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22286
Sequence identity: 66.44 (194/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGT----------------YAPAAP-G
           MAVQ-YTVALFL-VALV-GPA-SY------------------Y-PAAP-G
Sequence 2 MAVQKYTVALFL-VALVVGPAASYAADLSYGAPATPAAPAAGYTPAAPAG

Sequence 1 TQPKATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKA
           --PKATT-EQK--E-IN-GFKAAV-AA--V--A-KYKTF--TF---SNKA
Sequence 2 AAPKATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAASNKA

Sequence 1 FADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTY
           FA--L-----G---A---S-A-L---L---YKLAY-SAEGATPE-KYD-Y
Sequence 2 FAEALSTEPKGA--AVDSSKAALTSKLDAAYKLAYKSAEGATPEAKYDDY

Sequence 1 VASLTESLRVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAAT
           VA-L-E-LR-I-G--EVH-VKPA-EEVK--PA--L-V-D--DAA---AAT
Sequence 2 VATLSEALRIIAGTLEVHGVKPAAEEVKATPAGELQVIDKVDAAFKVAAT

Sequence 1 AANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAAT
           AANAAP-NDKF-VFE--FN-AIK--TGGAY-SY-F-PALE-AVKQ-YAAT
Sequence 2 AANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAAT

Sequence 1 VASAPEVKYAVFQAALSKAINAMVEAEKDAKPAAAAAATATATATVGAAA
           VA-AP-VKY-VF--AL-KAI-AM--A-K-AKPAAAA--T-TATA-VGAA-
Sequence 2 VATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAA--TGTATAAVGAAT

Sequence 1 GAA---AGGYKA
           GAA---AGGYK-
Sequence 2 GAATAAAGGYKV



Alignment 8
Sequence 1:
Sequence 2: Allergen Phl p 5.0106, Sequence: AAC16526
Sequence identity: 60.62 (177/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPG-TQP--KATTPEQKLME
           ------------------------G---PAAP----P--KATT-EQKL-E
Sequence 2 ------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLIE

Sequence 1 NINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIP
           -IN-GFKAA--AAA-V-PADKYKTF--TF---SNKAFA--L-A---G---
Sequence 2 KINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGA--

Sequence 1 AQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGA
           A-S-S-A-L---L---YKLAY--AEGATPE-KYD-YVA-L-E-LR-I-G-
Sequence 2 AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGT

Sequence 1 FEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVF
           -EVHAVKPA-EEVK--PA--L-V----D-A---AATAANAAP-NDKF-VF
Sequence 2 LEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF

Sequence 1 ESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQA
           E--FN-AIK--TGGAY-SY-F-PALE-AVKQAYAATVA-APEVKY-VF--
Sequence 2 EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET

Sequence 1 ALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAA---AGGYKA
           AL-KAI-AM-EA-K-AKPA--A--TATATA-VGAA-GAA----GGYK-
Sequence 2 ALKKAITAMSEAQKAAKPATEA--TATATAAVGAATGAATAATGGYKV



Alignment 9
Sequence 1:
Sequence 2: Allergen Phl p 5.0102, Sequence: Q40962
Sequence identity: 61.99 (181/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAP-GTQP--KATTPEQKLME
           ---------L----A--A-PA--Y----PAAP-G-----KATT-EQKL-E
Sequence 2 -------ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIE

Sequence 1 NINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIP
           -IN-GFKAA--A-A-V-PADKY-TF--TF---SNKAFA--L-----G---
Sequence 2 KINAGFKAAL-AGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGA--

Sequence 1 AQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGA
           A-S-S-A-L---L---YKLAY--AEGATPE-KYD-YVA-L-E-LR-I-G-
Sequence 2 AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGT

Sequence 1 FEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVF
           -EVHAVKPA-EEVK--PA--L-V----DAA---AATAANAAP-NDKF-VF
Sequence 2 LEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVF

Sequence 1 ESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQA
           E--FN--IK--TGGAY-SY-F-PALE-AVKQAYAATVA-APEVKY-VF--
Sequence 2 EAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET

Sequence 1 ALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAA---AGGYKA
           AL-KAI-AM-EA-K-AKPAAAA--TATATA-VGAA-GAA----GGYK-
Sequence 2 ALKKAITAMSEAQKAAKPAAAA--TATATAAVGAATGAATAATGGYKV



Alignment 10
Sequence 1:
Sequence 2: Allergen Phl p 5.0108, Sequence: AAC16528
Sequence identity: 60.27 (176/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPG-TQP--KATTPEQKLME
           ------------------------G---PAAP----P--KATT-EQKL-E
Sequence 2 ------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLIE

Sequence 1 NINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIP
           -IN-GFKAA--AAA-V-PADKYKTF--TF---SNKAFA--L-A---G---
Sequence 2 KINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGA--

Sequence 1 AQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGA
           A-S-S-A-L---L---YKLAY--AEGATPE-KYD-YVA-L-E-LR-I-G-
Sequence 2 AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGT

Sequence 1 FEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVF
           -EVHAVKPA-EEVK--PA--L-V----D-A---AATAANAAP-NDKF-VF
Sequence 2 LEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF

Sequence 1 ESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQA
           E--FN-AIK--TGGAY-SY-F-PALE-AVKQAYAATVA-APEVKY-VF--
Sequence 2 EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET

Sequence 1 ALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAA---AGGYKA
           AL-KA--AM-EA-K-AKPA--A--TATATA-VGAA-GAA----GGYK-
Sequence 2 ALKKAFTAMSEAQKAAKPATEA--TATATAAVGAATGAATAATGGYKV



Alignment 11
Sequence 1:
Sequence 2: Allergen Phl p 5.0105, Sequence: AAC16525
Sequence identity: 59.93 (175/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPG-TQP--KATTPEQKLME
           ------------------------G---PAAP----P--KATT-EQKL-E
Sequence 2 ------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLIE

Sequence 1 NINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIP
           -IN-GFKAA--AAA-V-PADKYKTF--TF---SNKAFA--L-A---G---
Sequence 2 KINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGA--

Sequence 1 AQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGA
           A-S-S-A-L---L---YKLAY--AEGATPE--YD-YVA-L-E-LR-I-G-
Sequence 2 AESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVATLSEALRIIAGT

Sequence 1 FEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVF
           -EVHAVKPA-EEVK--PA--L-V----D-A---AATAANAAP-NDKF-VF
Sequence 2 LEVHAVKPAAEEVKVIPAGELQVIEKVDSALKVAATAANAAPANDKFTVF

Sequence 1 ESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQA
           E--FN-AIK--TGGAY-SY-F-PALE-AVKQAYAATVA-APEVKY-VF--
Sequence 2 EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET

Sequence 1 ALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAA---AGGYKA
           AL-KAI-A--EA-K-AKPA--A--TATATA-VGAA-GAA----GGYK-
Sequence 2 ALKKAITATSEAQKAAKPATEA--TATATAAVGAATGAATAATGGYKV



Alignment 12
Sequence 1:
Sequence 2: Allergen Phl p 5.0104, Sequence: CAB05372
Sequence identity: 59.59 (174/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPG-TQP--KATTPEQKLME
           ------------------------G---PAAP----P--KATT-EQKL-E
Sequence 2 ------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLIE

Sequence 1 NINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIP
           -IN-GFKAA--AAA-V-PADKYKTF--TF---SNKAFA--L-A---G---
Sequence 2 KINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGA--

Sequence 1 AQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGA
           A-S-S---L---LE--YKLAY---EGATPE-KYD-YVA-L-E-LR-I-G-
Sequence 2 AESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRIIAGT

Sequence 1 FEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVF
           -EVHAVKPA-EEVK--PA--L------D-A---AATAANAA--NDKF-VF
Sequence 2 LEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF

Sequence 1 ESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQA
           E--FN-AIK--TGGAY-SY-F-PALE-AVKQAYAATVA-APEVKY-VF--
Sequence 2 EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET

Sequence 1 ALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAA---AGGYKA
           AL-KAI-AM-EA-K-AKPA--A--TATATA-VGAA-GAA----GGYK-
Sequence 2 ALKKAITAMSEAQKAAKPATEA--TATATAAVGAATGAATAATGGYKV



Alignment 13
Sequence 1:
Sequence 2: Allergen Phl p 5, Sequence: AAK25823
Sequence identity: 55.14 (161/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLME-NI
           ----------------------------P--P-T-P----P---------
Sequence 2 -----------------PISVTAPPPQLPRPPATPPPPPPPQLGASPYKL

Sequence 1 NNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQ
           ----KA--E--A-V-PADKY-TF--TF---SNKAFA--L-----G---A-
Sequence 2 GPSPKARSERPAIVPPADKYRTFVATFGAASNKAFAEGLSGEPKGG--AE

Sequence 1 SDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFE
           S-S-A-L---L---YKLAY--AEGATPE-KYD-YVA-L-E-LR-I-G--E
Sequence 2 SSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLE

Sequence 1 VHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFES
           VHAVKPA-EEVK--PA--L-V----DAA---AATAANAAP-NDKF-VFE-
Sequence 2 VHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEA

Sequence 1 SFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAAL
           -FN-AIK--TGGAY-SY-F-PALE-AVKQAYAATVA-APEVKY-VF--AL
Sequence 2 AFNNAIKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL

Sequence 1 SKAINAMVEAEKDAKPAAAAAATATATATVGAAAGA---AAGGYKA
           -KAI-AM-EA-K-AKPAAAA--TATAT--VGA--GA---AAGGYK-
Sequence 2 KKAITAMSEAQKAAKPAAAA--TATATSAVGAPTGATTAAAGGYKV



Alignment 14
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40237
Sequence identity: 62.33 (182/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGT---YAPAAPGTQ--------P---
           MAVQ--TVALFLAVALVAGPA-SY-----YAPA-P-T---------P---
Sequence 2 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP

Sequence 1 ------------KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQT
           ------------KATT-EQKL-E-IN-GFKAAV-AAA-V-PADKYKTF--
Sequence 2 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE

Sequence 1 TFIKGSNKAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGA
           TF----NKAF---L------Q------S---L---L----KLAY--A-GA
Sequence 2 TFGTATNKAFVEGLASGYADQ------SKNQLTSKLDAALKLAYEAAQGA

Sequence 1 TPETKYDTYVASLTESLRVISGAFEVHAVKPASEEVK--GVPAPQLKVVD
           TPE-KYD-YVA-LTE-LRVI-G--EVHAVKPA-EEVK----PA------D
Sequence 2 TPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLID

Sequence 1 QIDAAYRTAATAANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPAL
           --DAAYRTAATAANAAP-NDKF-VFE--FN-AIK---G-AY-SY-F-P-L
Sequence 2 KVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTL

Sequence 1 ESAVKQAYAATVASAPEVKYAVFQAALSKAINAMVEAEKDAKPAAAAAAT
           --AVKQAYAA--A-APEVKY-V---AL-KA--AM-EAEK-A-PAAAA-AT
Sequence 2 VAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATAT

Sequence 1 ATATATVGAAAGAAAGGYKA-------------------------
           -T--A----A--AAA------------------------------
Sequence 2 PTPAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV



Alignment 15
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: AAD20386
Sequence identity: 65.07 (190/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGT---YAPAA------PGTQP-----
           MAVQ-YTVALFLAVALVAGPA-SY-----Y-PAA------P---P-----
Sequence 2 MAVQKYTVALFLAVALVAGPAASYAADAGYTPAAAATPATPAATPAAAGG

Sequence 1 KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFAD
           KATT-EQKL-E--N-GFKAAV-AAA---PADK-K-F---F---S-K----
Sequence 2 KATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSE-SSKGLLA

Sequence 1 VLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVAS
           ---A-A-G-IP------------L---Y--AY--AEGATPE-KYD--V--
Sequence 2 TSAAKAPGLIP-----------KLDTAYDVAYKAAEGATPEAKYDAFVTA

Sequence 1 LTESLRVISGAFEVHAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATA
           LTE-LRVI-GA-EVHAVKPA-EEV-----P---L--VD-IDAA---AATA
Sequence 2 LTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATA

Sequence 1 ANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATV
           ANAAPTNDKF-VFES-FNKA--E-TGGAY--Y-F-P-LE-AVKQAYAATV
Sequence 2 ANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATV

Sequence 1 ASAPEVKYAVFQAALSKAINAMVEAEKDAKPAAAAA------ATATATAT
           A-APEVKYAVF-AAL-KAI-AM--A-K--KPAAAAA------AT--ATA-
Sequence 2 AAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATGAATVATGAATAA

Sequence 1 VGAAAGAAAGGYKA
           -GAA--AAAGGYKA
Sequence 2 AGAAT-AAAGGYKA



Alignment 16
Sequence 1:
Sequence 2: Allergen Hor v 5.0101, Sequence: U57845
Sequence identity: 54.45 (159/292)
Sequence 1 -----------------------MAVQQYTVALFLAVALVAGPAVSYGTY
           ----------------------------------------A---V---T-
Sequence 2 MANSGREHSAVPRRRNLVALVPRHGCYAEFSLYVCVGNINAPFPVFNRTT

Sequence 1 APAAPGTQPKATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFI
           --A--G-----------L---------------------D----------
Sequence 2 FIANAGIEAELEPHFLLLLFTFSSSSSFFTLLKTMIHFTDRSDNKNKAMM

Sequence 1 KGSN--KAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGAT
           -G----KAFA-VL--AA-GQI--QS-SMA-LS-SLE-SYKLAYD-A-GAT
Sequence 2 RGREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGAT

Sequence 1 PETKYDTYVASLTESLRVISGAFEVHAVKPASEEVKGVPAPQLKVVDQID
           PE-KYD-YVA-LTESLRVISG--EVH-VKPA-EEVKGVPA--LK--DQ-D
Sequence 2 PEAKYDAYVATLTESLRVISGTLEVHSVKPAAEEVKGVPAGELKAIDQVD

Sequence 1 AAYRTAATAANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPALESA
           AA-RTAATAA-AAP-NDKF-VFES----------GGAY-SY-F-PALE-A
Sequence 2 AAFRTAATAADAAPANDKFTVFESLQQGPSRKPRGGAYESYKFIPALEAA

Sequence 1 VKQAYAATVASAPEVKYAVFQAALSKAINAMVEAEKDAKPAAAAAATATA
           VKQAYAATVA-APEVK--VFQ-ALSKAINAM--A-K-AKPAAAA----TA
Sequence 2 VKQAYAATVAAAPEVKFTVFQTALSKAINAMTQAGKVAKPAAAA----TA

Sequence 1 TATVGAAAGAAAGGYKA
           TATV-A-A-A-AG-YK-
Sequence 2 TATVAAGAAATAGNYKV



Alignment 17
Sequence 1:
Sequence 2: Allergen Hol l 5.0201, Sequence: CAB10766
Sequence identity: 51.03 (149/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
           ------------------------------------------QKL-E--N
Sequence 2 ------------------------------------------QKLLEDVN

Sequence 1 NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS
           --FKAAV-AAA-V-PADKYKTF---F----------VL------Q--A--
Sequence 2 ASFKAAVAAAAKVPPADKYKTFLRAFT---------VLDRGSTEQSKAEE

Sequence 1 DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV
           --M--LS--L---Y--A-----G-T-E-KYD--V--LTE-LRVI-GA-EV
Sequence 2 TKMPELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEV

Sequence 1 HAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFE
           HAVKPA-EEV-----PA--L-VVD-IDA----AATAANAAP-NDKF-VFE
Sequence 2 HAVKPATEEVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFE

Sequence 1 SSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAA
           --FNKA-KE-TGGAY-SY-F-P-LE-AVKQAYA-TVA-APEVKYAVF-AA
Sequence 2 TAFNKALKESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAA

Sequence 1 LSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA
           L-KAI-AM--A-K-A-PAAAA---AT--A--GAA---AAGGYK-
Sequence 2 LTKAITAMSQAQKVAQPAAAATGAATVAA--GAAT-TAAGGYKV



Alignment 18
Sequence 1:
Sequence 2: Allergen Poa p 5.0101, Sequence: Q9FPR0
Sequence identity: 60.62 (177/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGT---YAPAAP---GTQPKATTP--E
           MAVQ-YTVALFL-VALVAGPA-SY-----YAPA-P---G------TP--E
Sequence 2 MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQE

Sequence 1 QKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAA
           QKLME-IN-GFKAAV-AAA---PADK-KTFQ--F---S--A-A--L-AA-
Sequence 2 QKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAF-SASVEASAAKLNAA-

Sequence 1 SGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLR
           --Q-P------A--S------YK-----A-GATPE-K-D--VA--TE-LR
Sequence 2 --QAPGFVSHVAATS---DATYK----AAVGATPEAKFDSFVAAFTEALR

Sequence 1 VISGAFEVHAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPT
           -I-G---VHAVKP--EE------PA------D-IDAA---AATAANAAP-
Sequence 2 IIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPA

Sequence 1 NDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEV
           NDKF-VFE--FN-AIKE-TGGAY--Y---P-LE-AVKQAYAAT-A-APEV
Sequence 2 NDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEV

Sequence 1 KYAVFQAALSKAINAMVEAEKDAKP---------AAAAAATATATATVGA
           K-AVF-AAL-KAI-AM-E--K--KP----------AA-AAT--AT---GA
Sequence 2 KFAVFKAALTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGA

Sequence 1 AAGAA---AGGYKA
           A-GAA---AGGYK-
Sequence 2 ATGAATVSAGGYKV



Alignment 19
Sequence 1:
Sequence 2: Allergen Dac g 5.02, Sequence: AAK62277
Sequence identity: 57.19 (167/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQP----KATTPEQKLM
           --------------------------Y-PAA--T------KA-T-EQKL-
Sequence 2 ----------------------ADAGYTPAAAATPAAAGGKAMTEEQKLI

Sequence 1 ENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQI
           E--N-GFKAAV-AA----PADK-KTF--TF------------TAA----I
Sequence 2 EDVNAGFKAAVAAASSAPPADKFKTFEATF------------TAACKANI

Sequence 1 PAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISG
           -A-----------L---Y--AY--A-G-TPE-KYD--VA-LTE-LRVI-G
Sequence 2 AAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAG

Sequence 1 AFEVHAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKF
           A-EVHAVKPA-EEV-----PA--L--VD-IDAAY--AATAANAAP-NDKF
Sequence 2 ALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKF

Sequence 1 NVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAV
           -VFE--FNKAIKE-TGGAY-SY-F-P-LE-AVKQAYAATVA-APEVKYAV
Sequence 2 TVFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAV

Sequence 1 FQAALSKAINAMVEAEKDAKPAAAA--AATATATATVGAAAGAAAGGYKA
           F-AAL-KAI-AM-EA-K-A-PAAAA--AATA-A-A--GAA--AAAGGYK-
Sequence 2 FEAALTKAITAMSEAQKVATPAAAATGAATAAASAATGAAT-AAAGGYKV



Alignment 20
Sequence 1:
Sequence 2: Allergen Dac g 5.01, Sequence: AAK62276
Sequence identity: 56.85 (166/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAA---PGTQP-KATTPEQKLM
           --------------------------Y-PAA---P-T---KA-T-EQ-L-
Sequence 2 ----------------------ADAGYTPAAAATPATAGGKAMTEEQTLI

Sequence 1 ENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQI
           E--N-GFKAAV-AA----PADK-KTF--TF------------TAA----I
Sequence 2 EDVNAGFKAAVAAASSAPPADKFKTFEATF------------TAACKANI

Sequence 1 PAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISG
           -A-----------L---Y--AY--A-G-TPE-KYD--VA-LTE-LRVI-G
Sequence 2 AAAATKVPLFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTEALRVIAG

Sequence 1 AFEVHAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKF
           A-EVHAVKPA-EEV-----PA--L--VD-IDAAY--AATAANAAP-NDKF
Sequence 2 ALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKF

Sequence 1 NVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAV
           -VFE--FNKAIKE-TGGAY-SY-F-P-LE-AVKQAYAATVA-APEVKYAV
Sequence 2 TVFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAV

Sequence 1 FQAALSKAINAMVEAEKDAKPAAAA--AATATATATVGAAAGAAAGGYKA
           F-AAL-KAI-AM-EA-K-A-PAA-A--AATA-A-A--GAA--AAAGGYK-
Sequence 2 FEAALTKAITAMSEAQKVATPAAVATGAATAAASAATGAAT-AAAGGYKV



Alignment 21
Sequence 1:
Sequence 2: Allergen Hol l 5.0101, Sequence: CAB10765
Sequence identity: 57.19 (167/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
           -----------------------Y---APAA-G---KATT-EQKL-E--N
Sequence 2 -------------------ADAGYTPAAPAAAGAGGKATTDEQKLLEDVN

Sequence 1 NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS
           -GFK-AV-AAA-V-PADKYKTF---F---S----A---T-A--G-IP---
Sequence 2 AGFKTAVAAAANVPPADKYKTFEAAFTASSKASIAAAATKAP-GLIP---

Sequence 1 DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV
           ---------L------AY--A-GATPE-KYD--V--LTE-LRVI-GA-EV
Sequence 2 --------QLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV

Sequence 1 HAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFE
           HAVKPA-EEV-----PA--L--VD-IDAA-R-AATAANAAP-NDKF-VFE
Sequence 2 HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFE

Sequence 1 SSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAA
           --FNKAIKE-TGGAY--Y-F-P-LE-AVKQAYAATVA-APEVKY-VF--A
Sequence 2 GAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETA

Sequence 1 LSKAINAMVEAEKDAKPAAAAAATATATATVGA-AAGAAAGGYKA
           L-KAI-AM-EA-K-AKP-AAA---ATA-A-V-A-AA-AAAGGYK-
Sequence 2 LKKAITAMSEAQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV



Alignment 22
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56164
Sequence identity: 52.74 (154/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
           MAVQ-YT-ALFLAVALVAGPA-------P--P-T-P----P---------
Sequence 2 MAVQKYTMALFLAVALVAGPAAP----TPPTPRTPPLLPPPRARDKATLT

Sequence 1 NGFKAAVEAA------AAVAPADKYKTFQTTFIKGSNKAFADVLTAAASG
           --------AA------A-V-PADK-KTF--------N---ADV--AA---
Sequence 2 SRSVEDINAASRRPWWASVPPADKFKTFADHVLCVPN---ADVTSAAT--

Sequence 1 QIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVI
           --P--------L---L---Y--AY--AEG-TPE-KYD---A-LTE-LRVI
Sequence 2 KAP-------QLKAKLDAAYRVAYEAAEGSTPEAKYDAFIAALTEALRVI

Sequence 1 SGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKF
           -GAFEVHAVKPA-EEV---P---L--VD-IDAA---AATAAN-AP-NDKF
Sequence 2 AGAFEVHAVKPATEEVVADPVGELQIVDKIDAAFKIAATAANSAPANDKF

Sequence 1 NVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAV
           -VFE--FNKAIKE-T-GAY--Y-F-P-LE-AVKQAY-ATVA-APEVKYAV
Sequence 2 TVFEGAFNKAIKESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYAV

Sequence 1 FQAALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA--
           F-A-L-KAI-AM-EA-K-AKP--------------G-AA--AA-------
Sequence 2 FEAGLTKAITAMSEAQKVAKPPLSPQPPQVLPLAAGGAATVAAASDVRVC

Sequence 1 ------------------------------------
           ------------------------------------
Sequence 2 RSHGTLQDACLLRCRGGCQPVVWRGGSHRARGGYKV



Alignment 23
Sequence 1:
Sequence 2: Allergen Phl p 5.0202, Sequence: CAB05371
Sequence identity: 55.14 (161/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGT---YAPAAP---GTQP-KATTPEQ
           ------------------GP--SY-----YAPA-P---G----KATT-EQ
Sequence 2 ---------AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKATTEEQ

Sequence 1 KLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAAS
           KL-E-IN-GFKAAV-AAA-V---DK-KTF---F---S--A-----TA-A-
Sequence 2 KLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTSSSKAA-----TAKAP

Sequence 1 GQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRV
           G--P------------L---Y--AY--A-GATPE-K-D--VASLTE-LRV
Sequence 2 GLVP-----------KLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRV

Sequence 1 ISGAFEVHAVKPASEE--VKGVPAPQLKVVDQIDAAYRTAATAANAAPTN
           I-GA-EVHAVKP--EE------PA--L---D-IDAA---AATAA--AP--
Sequence 2 IAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPAD

Sequence 1 DKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVK
           DKF-VFE--FNKAIKE-TGGAY--Y---P-LE-AVKQAYAATVA-AP-VK
Sequence 2 DKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVK

Sequence 1 YAVFQAALSKAINAMVEAEKDAKPAAAAAATATATATV--GAAAGAA---
           YAVF-AAL-KAI-AM-E--K---PA--AA--A---AT---GAA-GAA---
Sequence 2 YAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVA

Sequence 1 AGGYKA
           AGGYK-
Sequence 2 AGGYKV



Alignment 24
Sequence 1:
Sequence 2: Allergen Phl p 5.0201, Sequence: Q40963
Sequence identity: 55.14 (161/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGT---YAPAAPGTQ----PKATTPEQ
           --------A---------GP--SY-----YAPA-P--------KATT-EQ
Sequence 2 ------AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQ

Sequence 1 KLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAAS
           KL-E-IN-GFKAAV-AAA-V--ADK-KTF---F---S--A------A-A-
Sequence 2 KLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAA-----AAKAP

Sequence 1 GQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRV
           G--P------------L---Y--AY--A-GATPE-K-D--VASLTE-LRV
Sequence 2 GLVP-----------KLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRV

Sequence 1 ISGAFEVHAVKPASEE--VKGVPAPQLKVVDQIDAAYRTAATAANAAPTN
           I-GA-EVHAVKP--EE------PA--L---D-IDAA---AATAA--AP--
Sequence 2 IAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPAD

Sequence 1 DKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVK
           DKF-VFE--FNKAIKE-TGGAY--Y---P-LE-AVKQAYAATVA-AP-VK
Sequence 2 DKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVK

Sequence 1 YAVFQAALSKAINAMVEAEKDAKPAAAAAATATATATV--GAAAGAA---
           YAVF-AAL-KAI-AM-E--K---PA--AA--A---AT---GAA-GAA---
Sequence 2 YAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVA

Sequence 1 AGGYKA
           AGGYK-
Sequence 2 AGGYKV



Alignment 25
Sequence 1:
Sequence 2: Allergen Phl p 5.0204, Sequence: AAC25996
Sequence identity: 53.77 (157/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQP-KATTPEQKLMENI
           -----------------------Y----PAA-G----KATT-EQKL-E-I
Sequence 2 -------------------ADAGYAPATPAAAGAEAGKATTEEQKLIEDI

Sequence 1 NNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQ
           N-GFKAAV-AAA-V--ADK-KTF---F---S--A-----TA-A-G--P--
Sequence 2 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAA-----TAKAPGLVP--

Sequence 1 SDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFE
           ----------L---Y--AY--A-GATPE-K-D--VASLTE-LRVI-GA-E
Sequence 2 ---------KLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALE

Sequence 1 VHAVKPASEE--VKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVF
           VHAVKP--EE------PA--L---D-IDAA---AATAA--AP--DKF-VF
Sequence 2 VHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVF

Sequence 1 ESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQA
           E--FNKAIKE-TGGAY--Y---P-LE-AVKQAYAATVA-AP-VKYAVF-A
Sequence 2 EAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEA

Sequence 1 ALSKAINAMVEAEKDAKPAAAAAATATATATV--GAAAGAA---AGGYKA
           AL-KAI-AM-E--K---PA--AA--A---AT---GAA-GAA---AGGYK-
Sequence 2 ALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV



Alignment 26
Sequence 1:
Sequence 2: Allergen Phl p 5.0205, Sequence: 9249029
Sequence identity: 53.08 (155/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQP-KATTPEQKLMENI
           -----------------------Y----PAA-G----KATT-EQKL-E-I
Sequence 2 -------------------ADAGYAPATPAAAGAEAGKATTEEQKLIEDI

Sequence 1 NNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQ
           N-GF-AAV-AAA-V--ADK-KTF---F---S--A-----TA-A-G--P--
Sequence 2 NVGFNAAVAAAASVPAADKFKTFEAAFTSSSKAA-----TAKAPGLVP--

Sequence 1 SDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFE
           ----------L---Y--AY--A-GATPE-K-D--VASLTE-LRVI-GA-E
Sequence 2 ---------KLDAAYSVAYKAAVGATPEAKFDSLVASLTEALRVIAGALE

Sequence 1 VHAVKPASEE--VKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVF
           VHAVKP--EE------PA--L---D-IDAA---AATAA--AP--DKF-VF
Sequence 2 VHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVF

Sequence 1 ESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQA
           E--FNKAIKE-TGGAY--Y---P-LE-AVKQ-YAATVA-AP-VKYAVF-A
Sequence 2 EAAFNKAIKESTGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEA

Sequence 1 ALSKAINAMVEAEKDAKPAAAAAATATATATV--GAAAGAA---AGGYKA
           AL-KAI-AM-E--K---PA--AA--A---AT---GAA-GAA---AGGYK-
Sequence 2 ALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV



Alignment 27
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56165
Sequence identity: 49.66 (145/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGT--YAPAAPGTQPKATTPEQKLMEN
           MAVQ-YTVALFLAVALVAGPA--Y----YAPA-P-------TP-------
Sequence 2 MAVQKYTVALFLAVALVAGPAALYAGDGYAPATPAASATLATPATPAASP

Sequence 1 INNGF-------KAAV--EAAAAVAPADKYKTFQTTFIKGSNKAFADVLT
           ---G--------KA----E--AA----D--K----------NK-------
Sequence 2 QHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKS-----V

Sequence 1 AAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTE
           -------P--S---A--S--------L-Y-S--G-------D--V-S---
Sequence 2 HCRADRLPVCSSTSAH-SSKQDVAWMLGYGSIQGFSMD---DASVGSVSS

Sequence 1 SLRVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAP
           ---VI--A-EV-------EEVK--PA----V-----AA--TAATAA--AP
Sequence 2 EFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAP

Sequence 1 TNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPE
           -NDKF-VF-SSFNKAIKE-TGGAYA-Y-F-P-LE-AVKQAYAA--A-APE
Sequence 2 ANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPE

Sequence 1 VKYAVFQAALSKAINAMVEAEKDAKPAAA-AAATATATAT----------
           VKYAVF--AL-KAI-AM-EA-K-AKPAAA--AAT-T--A-----------
Sequence 2 VKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPP

Sequence 1 -VGAAAGAA-AGGYKA
           --G-A--AA-AGGYK-
Sequence 2 QLGTATPAAVAGGYKV



Alignment 28
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56167
Sequence identity: 38.36 (112/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV
           ----------------------------KYD---A-LTE-LRVI-GAFEV
Sequence 2 ---------------------------AKYDAFIAALTEALRVIAGAFEV

Sequence 1 HAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFE
           HAVKPA-EEV-----PA--L--VD-IDAA---AATAAN-AP-NDKF-VFE
Sequence 2 HAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAANSAPANDKFTVFE

Sequence 1 SSFNKAIKENTGGAYASYTFVPALE-SAVKQAYAATVASAPEVKYAVFQA
           --FNKAIKE--GGAY--Y-F-P-LE-S--KQAY-ATVA-APEVKYAVF-A
Sequence 2 GAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEA

Sequence 1 ALSKAINAMVEAEKDAKP------AAAAAATATA-TATVGAAAGAAAGGY
           -L-KAI-AM-EA-K-AKP------AAA-AATA----ATV-A-----AGGY
Sequence 2 GLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGY

Sequence 1 KA
           K-
Sequence 2 KV



Alignment 29
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40240
Sequence identity: 41.78 (122/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
           MAVQ-YTVALFL------GP--SY---A---P-------TP---------
Sequence 2 MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWR

Sequence 1 NGFKAAVEAAAA---VAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIP
           -G-----EAA------A---------T-----S----------------P
Sequence 2 EGDDRRAEAAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRASSP

Sequence 1 AQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGA
           --------L---L---Y--AY--AE-A-P-------------SLRVI-GA
Sequence 2 TSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIAGA

Sequence 1 FEVHAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKFN
           -EVHAVKPA-EEV-----P---L--VD-IDAA---AATAANAAPTNDKF-
Sequence 2 LEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFT

Sequence 1 VFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVF
           VFES-FNKA--E-TGGA-------P----------------APEVKYAVF
Sequence 2 VFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVF

Sequence 1 QAALSKAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA---
           -AAL-KAI-AM--A-K--KPAAAAA--A---AT--A-A-A----------
Sequence 2 EAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQ

Sequence 1 ---------
           ---------
Sequence 2 SLISLLIYY



Alignment 30
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56166
Sequence identity: 53.77 (157/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYA--------PAAPGTQP-KATTP
           MAVQ-YTVALFLA-ALVAGPA-SY---A--------PA-PG----KATT-
Sequence 2 MAVQKYTVALFLAMALVAGPAASYAADAGTPPTPATPAVPGAAAGKATTH

Sequence 1 EQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAA
           EQKL-E-IN--FK------A---PADKYKTF-T-F-K------A----A-
Sequence 2 EQKLIEDINAAFKWW---PASAPPADKYKTFETAFSK------ANIAGAS

Sequence 1 ASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESL
           --G---------------L---Y---Y--A-GATPE-KYD--V--LTE-L
Sequence 2 TKG---------------LDAAYSVVYNTAAGATPEAKYDSFVTALTEAL

Sequence 1 RVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAA----YRTAAT----
           R---G--EVHAVKPA-EE---VP--------------------AAT----
Sequence 2 RIMAGTLEVHAVKPATEEE--VPSAKILRANSRSSTRSSRFKIAATVATP

Sequence 1 -----AANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQ
           -----AAN-AP-NDKF-VFE--FNKAIKE--GG----Y-F-P-LE-AVKQ
Sequence 2 LSHSTAANSAPANDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQ

Sequence 1 AYAATVASAPEVKYAVFQAALSKAINAMVEAEKDAKPA--AAAAATATAT
           AY-ATVA-APEVKYAVF-A-L-KAI-AM-EA-K-AKP-------------
Sequence 2 AYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRLSPQPPQVLPL

Sequence 1 ATVGAAAGAAA----GGYKA
           A--GAA--AAA----GGYK-
Sequence 2 AAGGAATVAAASDSRGGYKV



Alignment 31
Sequence 1:
Sequence 2: Allergen Phl p 6.0102, Sequence: CAA76556
Sequence identity: 23.63 (69/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
           MA-----VA-FLAVA-V-G-A-S-----P-A-G---KATT-EQKL-E-IN
Sequence 2 MAAHKFMVAMFLAVAVVLGLATS-----PTAEGG--KATTEEQKLIEDIN

Sequence 1 NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS
           --F-AA----A-V-PADKYKTF---F---S----AD----A-----P---
Sequence 2 ASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKA-----P---

Sequence 1 DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV
           -----L---L---Y--AY--A--A-PE-KY---V----E-L--I-G--EV
Sequence 2 ----QLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPEV

Sequence 1 HAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESS
           HAVKP---------------------------------------------
Sequence 2 HAVKPGA-------------------------------------------

Sequence 1 FNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA
           ------------------------------------------
Sequence 2 ------------------------------------------



Alignment 32
Sequence 1:
Sequence 2: Allergen Phl p 6.0101, Sequence: P43215
Sequence identity: 22.95 (67/292)
Sequence 1 MAVQQYTVALFLAVALVAGPAVSYGTYAPAAPGTQPKATTPEQKLMENIN
           -------VA-FLAVA-V-G-A-S-----P-A-G---KATT-EQKL-E--N
Sequence 2 ------MVAMFLAVAVVLGLATS-----PTAEGG--KATTEEQKLIEDVN

Sequence 1 NGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAASGQIPAQS
           --F-AA----A-V-PADKYKTF---F---S----AD----A-----P---
Sequence 2 ASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKA-----P---

Sequence 1 DSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRVISGAFEV
           -----L---L---Y--AY--A--A-PE-KY---V----E-LR-I-G--EV
Sequence 2 ----QLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEV

Sequence 1 HAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESS
           HAVKP---------------------------------------------
Sequence 2 HAVKPGA-------------------------------------------

Sequence 1 FNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KAINAMVEAEKDAKPAAAAAATATATATVGAAAGAAAGGYKA
           ------------------------------------------
Sequence 2 ------------------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.