The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Vig r 2.0101

Sequence Q198W3

Full FASTA alignment

Sequence name:
Query sequence:
MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD
RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH
ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND
NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF
KEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS
SQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGL
LLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDD
VFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEV
LDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILG
SLY

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Vig r 2.0101Q198W3Go!453634.82.7e-183
2Vig r 2.0201B1NPN8Go!454532.81.3e-152
3Gly m 5.0201Q9FZP9Go!559427.11.1e-120
4Gly m conglycininAAB23463Go!439415.62.5e-117
5Gly m 5.0101O22120Go!543413.11.8e-116
6Gly m conglycininCAA35691Go!605413.12.0e-116
7Gly m conglycininAAB01374Go!639316.03.5e-87
8Lup an 1.0101ACB05815Go!611267.91.0e-72
9Len c 1.0102CAD87731Go!415253.41.6e-68
10Len c 1.0101CAD87730Go!418253.02.1e-68
11Pis s 1.0101CAF25232Go!415247.31.1e-66
12Pis s 1.0102CAF25233Go!415243.71.4e-65
13Jug n 2AAM54366Go!481220.11.9e-58
14Gly m conglycininAAA33947Go!218217.36.2e-58
15Jug r 2AAF18269Go!593217.41.6e-57
16Mac i 1.0101Q9SPL3Go!625203.62.3e-53
17Mac i 1.0201Q9SPL4Go!666202.65.1e-53
18Car i 2.0101B3STU4Go!792189.74.7e-49
19Gos h 1P09801Go!588165.19.0e-42
20Gos h 2P09799Go!605161.98.3e-41
21Ara h 1P43237Go!614146.24.5e-36
22Ara h 1P43238Go!626145.67.1e-36
23Ses i 3AAK15089Go!585131.31.2e-31
24Pis v 3.0101EF116865Go!519131.11.3e-31
25Jug r 6.0101A0A2I4E5L6Go!502126.92.4e-30
26Pin k 2.0101V9VGU0Go!463117.31.6e-27
27Cor a 11AAL86739Go!44899.34.2e-22
28Ana o 1.0102AAM73729Go!53694.71.3e-20
29Ana o 1.0101AAM73730Go!53894.71.3e-20
30Coc n 1.0101A0A0S3B0K0Go!49056.73.1e-09
31Gly m Bd28KBAB21619Go!47353.72.3e-08
32Cuc ma 4.0101P13744Go!48046.73.0e-06
33Cor a 9AAL73404Go!51535.39.0e-03
34Gos h 4P09800Go!51635.39.0e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Vig r 2.0101, Sequence: Q198W3
Sequence identity: 100.00 (453/453)
Sequence 1 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD
           MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD
Sequence 2 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD

Sequence 1 RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH
           RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH
Sequence 2 RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH

Sequence 1 ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND
           ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND
Sequence 2 ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND

Sequence 1 NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF
           NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF
Sequence 2 NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF

Sequence 1 KEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS
           KEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS
Sequence 2 KEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS

Sequence 1 SQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGL
           SQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGL
Sequence 2 SQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGL

Sequence 1 LLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDD
           LLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDD
Sequence 2 LLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDD

Sequence 1 VFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEV
           VFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEV
Sequence 2 VFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEV

Sequence 1 LDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILG
           LDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILG
Sequence 2 LDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILG

Sequence 1 SLY
           SLY
Sequence 2 SLY



Alignment 2
Sequence 1:
Sequence 2: Allergen Vig r 2.0201, Sequence: B1NPN8
Sequence identity: 83.89 (380/453)
Sequence 1 MVRARVQLLL--GILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFN
           MVRAR--LLL--GILFLASLSVSFGIVHRE-----E-S-SRG-NNPFYFN
Sequence 2 MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFN

Sequence 1 SDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLP
           SDR-FHTLF-NQ-GHLRV--RFDQRSKQ-QNLENYRVVE--SKPNTLLLP
Sequence 2 SDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLP

Sequence 1 HHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNP
           HHADADFLLVVLNGRA-LTLVNPDGRDS-ILEQGHAQKIPAGTTFFLVNP
Sequence 2 HHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNP

Sequence 1 NDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDS
           -DN-NLRIIKLA-PVNNPHRFQ-FFLSSTEAQQSYL-GFSKNILEASFDS
Sequence 2 DDNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDS

Sequence 1 DFKEIDRVLFGEE-RQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRK
           D-KEI-RVLFGEE--QQQ-G-ESQ-EGVIVELKREQIREL-KHAKSSS-K
Sequence 2 DIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKK

Sequence 1 ELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKE
           -LSS-D-PFNLRN--PIYSNK-GRW-EITPEKNPQL-DLD-FI-SVDMKE
Sequence 2 SLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE

Sequence 1 GGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQ----DESLEVQRYR
           G-LLLPHYNSKAIVILVINEG-A-IELVG---QQ-Q-----ES-EVQRYR
Sequence 2 GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYR

Sequence 1 AELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVM
           AELSEDDVF-IPA-YPVAINATSNLNFFAFGINAENNQRNFLAGEKDNV-
Sequence 2 AELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVI

Sequence 1 SEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKG
           SEIPTEVLDV-FPASG-KV-KLIKKQSES-FVDAQPEQQ-REE--KG-KG
Sequence 2 SEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEARKGGKG

Sequence 1 SLSSILGSLY
           ----------
Sequence 2 PFVY------



Alignment 3
Sequence 1:
Sequence 2: Allergen Gly m 5.0201, Sequence: Q9FZP9
Sequence identity: 64.68 (293/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEW

Sequence 1 -----MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPF
           --------------------------------E--ESQ-E-------NPF
Sequence 2 QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPF

Sequence 1 YFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTL
           -FNS--RF-TLFKNQYGH-RV--RF--RS-Q-QNL--YR--EF-SKPNTL
Sequence 2 HFNS-KRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTL

Sequence 1 LLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFL
           LLPHHADAD-L-V-LNG-AILTLVN-D-RDSY-L--G-A---PAGTT---
Sequence 2 LLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYV

Sequence 1 VNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEAS
           VNP----NLR-I-LAIPVN-P-RF--FFLSST-AQQSYL-GFSKNILEAS
Sequence 2 VNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEAS

Sequence 1 FDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSS
           -D--F-EI--VLFG-E--QQ-GEE---E-VIVE----QIREL-KHAKSSS
Sequence 2 YDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSS

Sequence 1 RKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDM
           RK--SS-D-PFNLR---PIYSNK-G---EITPEKNPQL-DLDVF-S-VDM
Sequence 2 RKTISSEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDM

Sequence 1 KEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQ----QQQDESLEVQR
           -EG-L-LPH-NSKAIV-LVINEGEA-IELVG---Q----QQ----LEV--
Sequence 2 NEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRK

Sequence 1 YRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDN
           YRAELSE-D-FVIPA-YPV--NATS-LNFFAFGINAENNQRNFLAG-KDN
Sequence 2 YRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRNFLAGSKDN

Sequence 1 VMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGR
           V-S-IP--V----FP-S----E-LIK-QSES-FVDAQP--QQ-EEG-KGR
Sequence 2 VISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQP--QQKEEGNKGR

Sequence 1 KGSLSSILGSLY
           KG-LSSIL---Y
Sequence 2 KGPLSSILRAFY



Alignment 4
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB23463
Sequence identity: 67.55 (306/453)
Sequence 1 MVRARVQLL--LGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFN
           M-R-R--LL--LG--FLAS--VS-----RE-------------NNPFYF-
Sequence 2 MMRVRFPLLVLLGTVFLASVCVSLKV--REDE-----------NNPFYFR

Sequence 1 SDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLP
           S---F-TLF-NQ----R---RF--RS-Q--NL--YR-V-F-SKPNT-LLP
Sequence 2 SSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLP

Sequence 1 HHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNP
           HHADADFLL-VL-GRAILTLVN-D-RDSY-L--G-AQ-IPAGTT--LVNP
Sequence 2 HHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNP

Sequence 1 NDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDS
           -D--NL-IIKLAIPVN-P-R---FFLSST-AQQSYL-GFS-NILE-SF-S
Sequence 2 HDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHS

Sequence 1 DFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKE
           -F-EI-RVLFGEE--Q------Q-EGVIVEL--EQIR-L---AKSSSRK-
Sequence 2 EFEEINRVLFGEEEEQR-----QQEGVIVELSKEQIRQLSRRAKSSSRKT

Sequence 1 LSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEG
           -SS-DEPFNLR--NPIYSN-FG---EITPEKNPQL-DLD-F-SSVD--EG
Sequence 2 ISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEG

Sequence 1 GLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQ----DESLEVQRYRA
           -LLLPH-NSKAIVILVINEG-A-IELVG---QQQ------E-LEVQRYRA
Sequence 2 ALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRA

Sequence 1 ELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMS
           ELSEDDVFVIPAAYP---NATSNLNF-AFGINAENNQRNFLAGEKDNV--
Sequence 2 ELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVR

Sequence 1 EIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGS
           -I---V----FP-S---VE-L-KKQ-ES-FVDAQP--QQ-EEG-KGRKG-
Sequence 2 QIERQVQELAFPGSAQDVERLLKKQRESYFVDAQP--QQKEEGSKGRKGP

Sequence 1 LSSILGSLY
           --SILG-LY
Sequence 2 FPSILGALY



Alignment 5
Sequence 1:
Sequence 2: Allergen Gly m 5.0101, Sequence: O22120
Sequence identity: 62.91 (285/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPR

Sequence 1 --------------------------------------MVRARVQLLLGI
           --------------------------------------------------
Sequence 2 QEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQK

Sequence 1 LFLASLSVSFGIVHREHQESQEESDSRGQN-NPFYFNSDRRFHTLFKNQY
           --------------RE--ES------R--N-NPF-F-S-R-F-TLFKNQY
Sequence 2 EERKQEEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNR-FETLFKNQY

Sequence 1 GHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLN
           G--RV--RF-QRS-Q-QNL--YR--EF-SKPNTLLLP-HADAD-L-V-LN
Sequence 2 GRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILN

Sequence 1 GRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAI
           G-AIL-LVN-D-RDSY-L--G-A---P-GTT---VNP--N-NLR-I-LAI
Sequence 2 GTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAI

Sequence 1 PVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEE
           PVN-P-RF--FFLSSTEAQQSYL-GFS-NILEAS-D--F-EI--VLF--E
Sequence 2 PVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSRE

Sequence 1 RQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNS
           --QQ-GE----E-VIVE---EQIR-L-K-AKSSSRK--SS-D-PFNLR--
Sequence 2 EGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSR

Sequence 1 NPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIV
           -PIYSNK-G---EITPEKNPQL-DLD-F-S-VDM-EG-LLLPH-NSKAIV
Sequence 2 DPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIV

Sequence 1 ILVINEGEAKIELVG----PSDQQQQDESLEVQRYRAELSEDDVFVIPAA
           ILVINEG-A-IELVG-------QQQ----LEV--YRAELSE-D-FVIPA-
Sequence 2 ILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAG

Sequence 1 YPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPA
           YPV--NATSNLNFFA-GINAENNQRNFLAG--DNV-S-IP--V----FP-
Sequence 2 YPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPG

Sequence 1 SGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY
           S---VEKL-K-Q-ES-FVDAQP-----EEG-KGRKG-LSSIL---Y
Sequence 2 SAQAVEKLLKNQRESYFVDAQP--KKKEEGNKGRKGPLSSILRAFY



Alignment 6
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: CAA35691
Sequence identity: 62.91 (285/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE

Sequence 1 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQN-NPFYFNS
           --------------------------RE--ES------R--N-NPF-F-S
Sequence 2 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS

Sequence 1 DRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPH
           -R-F-TLFKNQYG--RV--RF-QRS-Q-QNL--YR--EF-SKPNTLLLP-
Sequence 2 NR-FETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPN

Sequence 1 HADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPN
           HADAD-L-V-LNG-AIL-LVN-D-RDSY-L--G-A---P-GTT---VNP-
Sequence 2 HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPD

Sequence 1 DNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSD
           -N-NLR-I-LAIPVN-P-RF--FFLSSTEAQQSYL-GFS-NILEAS-D--
Sequence 2 NNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTK

Sequence 1 FKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKEL
           F-EI--VLF--E--QQ-GE----E-VIVE---EQIR-L-K-AKSSSRK--
Sequence 2 FEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI

Sequence 1 SSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGG
           SS-D-PFNLR---PIYSNK-G---EITPEKNPQL-DLD-F-S-VDM-EG-
Sequence 2 SSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGA

Sequence 1 LLLPHYNSKAIVILVINEGEAKIELVG----PSDQQQQDESLEVQRYRAE
           LLLPH-NSKAIVILVINEG-A-IELVG-------QQQ----LEV--YRAE
Sequence 2 LLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAE

Sequence 1 LSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSE
           LSE-D-FVIPA-YPV--NATSNLNFFA-GINAENNQRNFLAG--DNV-S-
Sequence 2 LSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQ

Sequence 1 IPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSL
           IP--V----FP-S---VEKL-K-Q-ES-FVDAQP-----EEG-KGRKG-L
Sequence 2 IPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP--KKKEEGNKGRKGPL

Sequence 1 SSILGSLY
           SSIL---Y
Sequence 2 SSILRAFY



Alignment 7
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB01374
Sequence identity: 64.68 (293/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NQACHARCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPH

Sequence 1 -----------------MVRARVQLLLGILFLASLSVSFGIVHREHQESQ
           --------------------------------------------E--ESQ
Sequence 2 QPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQ

Sequence 1 EESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENY
           -E-------NPF-FNS--RF-TLFKNQYGH-RV--RF--RS-Q-QNL--Y
Sequence 2 REPRRHKNKNPFHFNS-KRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDY

Sequence 1 RVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGH
           R--EF-SKPNTLLLPHHADAD-L-V-LNG-AILTLVN-D-RDSY-L--G-
Sequence 2 RILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGD

Sequence 1 AQKIPAGTTFFLVNPN------------------DND-NLRIIKLAIPVN
           A---PAGTTF--VNP-------------------DND-NLR-I-LAIPVN
Sequence 2 ALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVN

Sequence 1 NPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQ
           -P-RF--FFLSST-AQQSYL-GFSKNILEAS-D--F-EI--VLFG-E--Q
Sequence 2 KPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQ

Sequence 1 QHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPI
           Q-GEE---E-VIVE----QIREL-KHAKSSSRK--SS-D-PFNL----PI
Sequence 2 QQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLGSRDPI

Sequence 1 YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILV
           YSNK-G---EIT---NPQL-DLDVF-S-VDM-EG-L-LPH-NSKAIV-LV
Sequence 2 YSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLV

Sequence 1 INEGEAKIELVGPSDQQQ----QDESLEVQRYRAELSEDDVFVIPAAYPV
           INEGEA-IELVG---QQQ--------LEV--YRAELSE-D-FVIPA-YPV
Sequence 2 INEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPV

Sequence 1 AINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGN
           --NATS-LNFFAFGINAENNQRNFLAG-KDNV-S-IP--V----FP-S--
Sequence 2 MVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAK

Sequence 1 KVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY
           --E-LIK-QSES-FVDAQP--QQ-EEG-KGRKG-LSSIL---Y
Sequence 2 DIENLIKSQSESYFVDAQP--QQKEEGNKGRKGPLSSILRAFY



Alignment 8
Sequence 1:
Sequence 2: Allergen Lup an 1.0101, Sequence: ACB05815
Sequence identity: 54.53 (247/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKMRVRLPMLILLLGVVFLLAASIGIAYGEKDFTKNPPKEREEEEHEPR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQPRPRQQEEQEREHRREEKHDGEPSRGRSQSEESQEEEHERRREHHRER

Sequence 1 ---------------------------------------MVRARVQLLLG
           --------------------------------------------------
Sequence 2 EQEQQPRPQRRQEEEEEEEEWQPRRQRPQSRREEREEREQEQGSSSGSQR

Sequence 1 ILFLASLSVSFGIVHREHQESQEES--DSRGQNNPFYFNSDRRFHTLFKN
           -------------VHRE--E----S--DSR-Q-NP--F-S-R-F-T---N
Sequence 2 GGGDERRQHRERRVHREEREQEQDSRSDSRRQRNPYHFSSNR-FQTYYRN

Sequence 1 QYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVV
           --G--RV--RF-QR-----NL-NYR--EF-SKPNTL-LP-H-DADF-LVV
Sequence 2 RNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDADFILVV

Sequence 1 LNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKL
           LNGRA--T-VNPD-R--Y-LEQG-A---PAGTT----NP-DN-NLR--KL
Sequence 2 LNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAKL

Sequence 1 AIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFG
           AIP-NNP-----F--S-T--QQSY--GFSKN-LEA-F-----EI-RVL-G
Sequence 2 AIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLG

Sequence 1 -----EERQQQHGEES--QEEGVIVELKREQIRELIKHAKSSSRKELSSQ
           -----E---Q--G-E---Q-EGVIV-----QI-EL-KHA-SSS-----S-
Sequence 2 DDELQENEKQRRGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSE

Sequence 1 DEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLL
           --PFNLR---PIYSNKFG--YEITP--NPQ--DL----------EG-LLL
Sequence 2 SGPFNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLL

Sequence 1 PHYNSKAIVILVINEGEAKIELVGPSDQQ-QQDESLE--------VQRYR
           PHYNSKAI-I-V--EGE---ELVG--DQQ-QQDE--E--------V-RY-
Sequence 2 PHYNSKAIFIVVVDEGEGNYELVGIRDQQRQQDEQEEEYEQGEEEVRRYS

Sequence 1 AELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVM
           --LS--DVF-IPA--P--INA-SNL----FGINA--NQRNFLAG--DNV-
Sequence 2 DKLSKGDVFIIPAGHPLSINASSNLRLLGFGINANENQRNFLAGSEDNVI

Sequence 1 SEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQ-RE-EGHKGR
           -----EV----FP-S---VE-LIK-Q--S-F--AQP-QQQ-RE-EG--GR
Sequence 2 KQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQQQQREKEGRRGR

Sequence 1 KGSLSSILGSLY
           -G--SSIL--LY
Sequence 2 RGPISSILNALY



Alignment 9
Sequence 1:
Sequence 2: Allergen Len c 1.0102, Sequence: CAD87731
Sequence identity: 49.67 (225/453)
Sequence 1 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD
           ----------------------------------------Q-NPF-F-S-
Sequence 2 ------------------------------------SRSDQENPFIFKSN

Sequence 1 RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH
           R-F-T---N--GH-R----FD-RSK---NL-NYR--E-KSKP-TL-LP--
Sequence 2 R-FQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY

Sequence 1 ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND
           -DADF-LVVL-G-A-LT--N---R-S--LE-G---K-PAGT---L-N--D
Sequence 2 TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDD

Sequence 1 NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF
           N--LR---LAIPVNNP-----F-LS-T--Q-S-L-GF-K-ILEA-F--D-
Sequence 2 NEDLRVLDLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDY

Sequence 1 KEIDRVLFGEERQQ-QHG-------EESQEEGVIVELKREQIRELIKHAK
           -EI--VL-----Q--QH---------E---E-VIV---REQI-EL-K-AK
Sequence 2 EEIEKVLLEDQEQEPQHRRSLRDRRQEINKENVIVKVSREQIKELSKNAK

Sequence 1 SSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISS
           SSS-K--SS--EPFNLR--NPIYSNKFG---EITPEKNPQL-DLD-F--S
Sequence 2 SSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNS

Sequence 1 VDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP---------SDQQQQ
           V--KEG-LLLP-YNS-AIVI---NEG----ELVG-----------D---Q
Sequence 2 VEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQREENDDEEEQ

Sequence 1 DE--SLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQ
           -E--S--VQRYRA-LS--DVFV-PA--PVAINA-S-LN---FGINA-NNQ
Sequence 2 EEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQ

Sequence 1 RNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQ
           RNFLAGE-DNV-S-I---V----FP-S---V--L---Q--SHF--AQP-Q
Sequence 2 RNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQ

Sequence 1 QQREEGHKGRKGSLSSILGSLY
           ----------------------
Sequence 2 IE--------------------



Alignment 10
Sequence 1:
Sequence 2: Allergen Len c 1.0101, Sequence: CAD87730
Sequence identity: 50.33 (228/453)
Sequence 1 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD
           ----------------------------------------Q-NPF-F-S-
Sequence 2 ------------------------------------SRSDQENPFIFKSN

Sequence 1 RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH
           R-F-T---N--GH-R---RFD-RSK---NL-NYR--E-KSKP-T--LP--
Sequence 2 R-FQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF

Sequence 1 ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND
           -DADF-LVVL-G-AILT--N---R-S--LE-G---K-PAGT---L-N--D
Sequence 2 TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDD

Sequence 1 NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF
           N--LR---LAIPVN-P---Q-F-LS-T--Q-S-L-GFSKNILEA-F----
Sequence 2 NEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEY

Sequence 1 KEIDRVLFGEERQQ-QH----GEESQE---EGVIVELKREQIRELIKHAK
           -EI--VL--E--Q--QH--------QE---E-VIV---REQI-EL-K-AK
Sequence 2 EEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAK

Sequence 1 SSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISS
           SSS-K--SS--EPFNLR--NPIYSNKFG---EITPEKNPQL-DLD-F--S
Sequence 2 SSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNS

Sequence 1 VDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLE----
           V--KEG-LLLP-YNS-AIVI---NEG----ELVG-----QQ----E----
Sequence 2 VEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEE

Sequence 1 ----------VQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAE
           ----------VQRYRA-LS--DV-VIPA--PVAINA-S-LN---FGINA-
Sequence 2 EGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAK

Sequence 1 NNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQ
           NNQRNFLAGE-DNV-S-I---V----FP-S---V--L---Q--SHF--AQ
Sequence 2 NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQ

Sequence 1 PEQQQREEGHKGRKGSLSSILGSLY
           P-Q----------------------
Sequence 2 PLQIE--------------------



Alignment 11
Sequence 1:
Sequence 2: Allergen Pis s 1.0101, Sequence: CAF25232
Sequence identity: 49.23 (223/453)
Sequence 1 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD
           ----------------------------------------Q-NPF-F-S-
Sequence 2 ------------------------------------SRSDQENPFIFKSN

Sequence 1 RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH
           R-F-TL--N--GH-R----FD-RSK---NL-NYR--E-KSKP-TL-LP--
Sequence 2 R-FQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY

Sequence 1 ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND
           -DADF-LVVL-G-A-LT------R-S--LE-G-A-K-PAGT---L-N--D
Sequence 2 TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDD

Sequence 1 NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF
           N--LR---LAIPVN-P---Q-F-LS-T--Q-S-L-GFSKNILEA-F----
Sequence 2 NEDLRVLDLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNY

Sequence 1 KEIDRVLFGEERQQ-QHG-------EESQEEGVIVELKREQIRELIKHAK
           -EI--VL-----Q--QH---------E--EE-VIV---REQI-EL-K-AK
Sequence 2 EEIEKVLLEQQEQEPQHRRSLKDRRQEINEENVIVKVSREQIEELSKNAK

Sequence 1 SSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISS
           SSS-K--SS---PFNLR--NPIYSNKFG---EITPEKN-QL-DLD-F--S
Sequence 2 SSSKKSVSSESGPFNLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNS

Sequence 1 VDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQ-----------Q
           VD-KEG-LLLP-YNS-AIVI----EG----ELVG---------------Q
Sequence 2 VDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQGKENDKEEEQ

Sequence 1 QQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQ
           ----S--VQ-YRA-LS--DVFVIPA--PVAINA-S-LN---FGINAENN-
Sequence 2 EEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNE

Sequence 1 RNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQ
           RNFLAGE-DNV-S-----V----FP-S---V--L-K-Q--S-F--AQP-Q
Sequence 2 RNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQ

Sequence 1 QQREEGHKGRKGSLSSILGSLY
           ----------------------
Sequence 2 RE--------------------



Alignment 12
Sequence 1:
Sequence 2: Allergen Pis s 1.0102, Sequence: CAF25233
Sequence identity: 48.79 (221/453)
Sequence 1 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD
           ----------------------------------------Q-NPF-F-S-
Sequence 2 ------------------------------------SRSDQENPFIFKSN

Sequence 1 RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH
           R-F-TL--N--GH-R----FD-RSK---NL-NYR--E-KSKP-TL-LP--
Sequence 2 R-FQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQC

Sequence 1 ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND
           -DADF-LVVL-G-A-LT------R-S--LE-G---K-PAGT---L-N--D
Sequence 2 TDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDD

Sequence 1 NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF
           N--LR---L-IPVN-P---Q-F-LS-T--Q-S-L-GFSKNILEA-F----
Sequence 2 NEDLRVLDLTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNY

Sequence 1 KEIDRVLFGEERQQ-QHG-------EESQEEGVIVELKREQIRELIKHAK
           -EI--VL-----Q--QH---------E--EE-VIV---REQI-EL-K-AK
Sequence 2 EEIEKVLLEQQEQEPQHRRSLKDRRQEINEENVIVKVSREQIEELSKNAK

Sequence 1 SSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISS
           SSS-K--SS---PFNLR--NPIYSNKFG---EITPEKN-QL-DLD-F--S
Sequence 2 SSSKKSVSSESGPFNLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNS

Sequence 1 VDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQ-----------Q
           VD-KEG-LLLP-YNS-AIVI----EG----ELVG---------------Q
Sequence 2 VDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQGKENDKEEEQ

Sequence 1 QQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQ
           ----S--VQ-YRA-LS--DVFVIPA--PVAINA-S-LN---FGINAENN-
Sequence 2 EEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNE

Sequence 1 RNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQ
           RNFLAGE-DNV-S-----V----FP-S---V--L-K-Q--S-F--AQP-Q
Sequence 2 RNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQ

Sequence 1 QQREEGHKGRKGSLSSILGSLY
           ----------------------
Sequence 2 RE--------------------



Alignment 13
Sequence 1:
Sequence 2: Allergen Jug n 2, Sequence: AAM54366
Sequence identity: 35.98 (163/453)
Sequence 1 ---------------------------MVRARVQLLLGILFLASLSVSFG
           --------------------------------------------------
Sequence 2 GRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPE

Sequence 1 IVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQR
           ---R------EE---R---NP-YF-S------------G------RF--R
Sequence 2 ASPRRESKGREEEQQR--HNPYYFHS-QSIRSRHESEEGEVKYLERFAER

Sequence 1 SKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDG
           -------ENYRVV-----PNT--LPHH-DA----VV--GRA-LTLV----
Sequence 2 TELLRGIENYRVVILDANPNTFMLPHHKDAESVIVVTRGRATLTLVSQET

Sequence 1 RDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFF
           R-S--LE-G-----PAG-T----N---N--L---KL--PVNNP-------
Sequence 2 RESFNLECGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNPGQVREYY

Sequence 1 LSSTEA-QQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQE
           --------QSYLR-FS--IL-A----------R-------QQ------Q-
Sequence 2 AAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF----DQQE-----QR

Sequence 1 EGVIVELKREQIRELIKHAKSSSRKELS--SQDEPFNLRNSNPIYSNKFG
           EGVI-----E--R-L--HA-S---------S---P--L----P-YSN-FG
Sequence 2 EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFG

Sequence 1 RWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEA
           ---E--PE---QL---DV-------K-G----PHYNSKA-V-----EG--
Sequence 2 QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTG

Sequence 1 KIELVGPS-------DQ----QQQDESL-EVQRYRAELSEDDVFVIPAAY
           --E---P--------DQ----Q---ES----Q---A-L---D-FVIPA--
Sequence 2 RYEMACPHVSSQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH

Sequence 1 PVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFP
           P-AI-A--N-N-----FGIN-ENNQRNFLAG-----------E----SF-
Sequence 2 PIAITASQNENLRLLGFGINGENNQRNFLAGQ-NSIINQLEREAKELSFN

Sequence 1 ASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY-
           ------E-----Q-ES-FV---P---Q---G--GR---L-SILG----
Sequence 2 MPREEIEEIFESQMESYFV---PTERQSRRG-QGRDHPLASILGFAFF



Alignment 14
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAA33947
Sequence identity: 32.89 (149/453)
Sequence 1 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS
           --------------------------------------K-AKSSSRK--S
Sequence 2 -------------------------------------SKRAKSSSRKTIS

Sequence 1 SQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGL
           S-D-PFNL----PIYS-K-G---EITPEKNPQL-DLD-F-S-VDM-EG-L
Sequence 2 SEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL

Sequence 1 LLPHYNSKAIVILVINEGEAKIELVG----PSDQQQQDESLEVQRYRAEL
           LLPH-NSKAIVILVINEG-A-IELVG-------QQQ----LEV--YRAEL
Sequence 2 LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL

Sequence 1 SEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEI
           SE-D-FVIPA-YPV--NATSNLNFFA-GINAENNQRNFLAG--DNV-S-I
Sequence 2 SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI

Sequence 1 PTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLS
           P--V----FP-S---VEKL-K-Q-ES-FVDAQP-----EEG-KGRKG-LS
Sequence 2 PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPNE--KEEGNKGRKGPLS

Sequence 1 SILGSLY
           SIL---Y
Sequence 2 SILRAFY



Alignment 15
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 35.98 (163/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE

Sequence 1 ---------------------------------------MVRARVQLLLG
           --------------------------------------------------
Sequence 2 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ

Sequence 1 ILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQY
           ---------------R------EE---R---NP-YF-S------------
Sequence 2 YKEQQGRERGPEASPRRESRGREEEQQR--HNPYYFHS-QSIRSRHESEE

Sequence 1 GHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLN
           G------RF--R-------ENYRVV-----PNT--LPHH-DA----VV--
Sequence 2 GEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTR

Sequence 1 GRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAI
           GRA-LTLV----R-S--LE-G-----PAG-T----N---N--L---KL--
Sequence 2 GRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQ

Sequence 1 PVNNPHRFQNFFLSSTEA-QQSYLRGFSKNILEASFDSDFKEIDRVLFGE
           PVNNP--F------------QSYLR-FS--IL-A----------R--F--
Sequence 2 PVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFD-

Sequence 1 ERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS--SQDEPFNL
           --QQ------Q-EGVI-----E--R-L--HA-S---------S---P--L
Sequence 2 --QQE-----QREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISL

Sequence 1 RNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSK
           ----P-YSN-FG---E--PE---QL---DV-------K-G----PHYNSK
Sequence 2 KSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSK

Sequence 1 AIVILVINEGEAKIELVGP--SDQ---------QQQDESL-EVQRYRAEL
           A-V-----EG----E---P--S-Q---------Q---ES----Q---A-L
Sequence 2 ATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARL

Sequence 1 SEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVMS
           ---D-FVIPA--P-AI-A--N-N-----F-IN-ENNQR-FLAG---N---
Sequence 2 ARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ-NNIIN

Sequence 1 EIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGS
           ----E----SF-------E-----Q-ES-FV---P---Q---G--GR---
Sequence 2 QLEREAKELSFNMPREEIEEIFESQMESYFV---PTERQSRRG-QGRDHP

Sequence 1 LSSILGSLY-
           L-SIL-----
Sequence 2 LASILDFAFF



Alignment 16
Sequence 1:
Sequence 2: Allergen Mac i 1.0101, Sequence: Q9SPL3
Sequence identity: 34.44 (156/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQEDPQTECQQCQRRCRQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QESDPRQQQYCQRRCKEICEEEEEYNRQRDPQQQYEQCQKRCQRRETEPR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 HMQICQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEGDNKRDPQQ

Sequence 1 ----------------MVRARVQLLLGILFLASLSVSFGIVHREHQESQE
           ------------------------------------------R------E
Sequence 2 REYEDCRRHCEQQEPRLQYQCQRRCQEQQRQHGRGGDLMNPQRGGSGRYE

Sequence 1 ESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYR
           E-------NP-YF---R---T-F----GH--V---F--RSK----L-NYR
Sequence 2 EGEEKQSDNPYYFD-ERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYR

Sequence 1 VVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHA
           -V-----PN---LP-H-DAD--L-V--GR--L-----D-R-SY-LE-G--
Sequence 2 LVLLEANPNAFVLPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGDV

Sequence 1 QKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYL
           --IPAGTTF-L-N---N--L-I-K-------P-----FF---------YL
Sequence 2 IRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYL

Sequence 1 RGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQI
           --FSK-ILEA-----------VL-G--R----------EGVI-----EQI
Sequence 2 STFSKEILEAALNTQTERLRGVL-GQQR----------EGVIIRASQEQI

Sequence 1 RELIKHAKSSSRKELSSQDE----PFNLRNSNPIYSNKFGRWYEITPEKN
           REL------S-R-------E----P-NL-N--P-YSNK-G--YE--PE--
Sequence 2 RELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDY

Sequence 1 PQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP---
           -QL-D-DV---------G----P--N-------V---GEA--E---P---
Sequence 2 RQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS

Sequence 1 --------SDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLN
           ---------------E-------RA-LS-----V--A--PV------N-N
Sequence 2 GRHGGRGGGKRHEEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNEN

Sequence 1 F--FAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIK
           ---FAFGINA-NN--NFLAG---NV---I--------F-AS---VE-L--
Sequence 2 LLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAASRKEVEELFN

Sequence 1 KQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY-
           -Q-ES-F-------QQ-----------L-SIL-----
Sequence 2 SQDESIFFPGPRQHQQQSPRSTKQQQPLVSILDFVGF



Alignment 17
Sequence 1:
Sequence 2: Allergen Mac i 1.0201, Sequence: Q9SPL4
Sequence identity: 34.00 (154/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAINTSNLCSLLFLLSLFLLSTTVSLAESEFDRQEYEECKRQCMQLETSG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QMRRCVSQCDKRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YCQRRCKEICEEEEEYNRQRDPQQQYEQCQERCQRHETEPRHMQTCQQRC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKRDPQQREYEDCRRR

Sequence 1 -------MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNN
           ---------------------------------R------EE-------N
Sequence 2 CEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRYEEGEEKQSDN

Sequence 1 PFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPN
           P-YF---R---T-F----GH--V---F--RSK----L-NYR-V-----PN
Sequence 2 PYYFD-ERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPN

Sequence 1 TLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTF
           ---LP-H-DAD--L-V--GR--L-----D-R-SY-LE-G----IPAGTTF
Sequence 2 AFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTF

Sequence 1 FLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILE
           -L-N---N--L-I-K-------P-----FF---------YL--FSK-ILE
Sequence 2 YLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILE

Sequence 1 ASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKS
           A-----------VL-G--R----------EGVI-----EQIREL------
Sequence 2 AALNTQAERLRGVL-GQQR----------EGVIISASQEQIRELTRDDSE

Sequence 1 SSRKELSSQDE----PFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVF
           S-R-------E----P-NL-N--P-YSNK-G--YE--PE---QL-D-DV-
Sequence 2 SRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVS

Sequence 1 ISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP-----------S
           --------G----P--N-------V---GEA--E---P------------
Sequence 2 VFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGG

Sequence 1 DQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGIN
           ------E--------A-LS-----V-P---PV------N-N---FAFGIN
Sequence 2 KRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGIN

Sequence 1 AENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVD
           A-NN--NFLAG---NV---I--------F-A----VE-L---Q-ES-F--
Sequence 2 AQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFP

Sequence 1 AQPEQQQREEGHKGRKGSLSSILGSLY-
           -----QQ-----------L-SIL-----
Sequence 2 GPRQHQQQSSRSTKQQQPLVSILDFVGF



Alignment 18
Sequence 1:
Sequence 2: Allergen Car i 2.0101, Sequence: B3STU4
Sequence identity: 34.88 (158/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVTKAKIPLFLFLSALFLALVCSSLALETEDLSNELNPHHDPESHRWEFQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCQERCQHEERGQRQAQQCQRRCEEQLREREREREREEIVDPREPRKQYE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCRETCEKQDPRQQPQCERRCERQFQEQQERERRERRRGRDDDDKENPRD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PREQYRQCEEHCRRQGQGQRQQQQCQSRCEERFEEEQRRQEERERRRGRD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NDDEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ERERRRGRDEDDQNPRDPEQRYEQCQQQCERQRRGQEQQLCRRRCEQQRQ

Sequence 1 ------------------------------------MVRARVQLLLGILF
           --------------------------------------------------
Sequence 2 QEERERQRGRDRQDPQQQYHRCQRRCQTQEQSPERQRQCQQRCERQYKEQ

Sequence 1 LASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHL
           ------------R------EE---R---NP-YF-S------------G--
Sequence 2 QGREWGPDQASPRRESRGREEEQQR--HNPYYFHS-QGLRSRHESGEGEV

Sequence 1 RVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRA
           ----RF--R-------ENYRVV-----PNT--LP-H-DA----VV--GRA
Sequence 2 KYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAESVIVVTRGRA

Sequence 1 ILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVN
           -LT-V----R-S--LE-G-----PAG-T----N---N--L---KL--PVN
Sequence 2 TLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQPVN

Sequence 1 NPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQ
           NP--F------------SYLR-FS--IL-A----------R-------QQ
Sequence 2 NPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFF----DQQ

Sequence 1 QHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS--SQDEPFNLRNSN
           ------Q-EGVI-----E--R-L--HA-S---------S---P--L----
Sequence 2 E-----QREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQR

Sequence 1 PIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVI
           --YSN-FG---E--PE---QL---DV-------K-G----PHYNSKA-V-
Sequence 2 SSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVV

Sequence 1 LVINEGEAKIELVGPSD------------QQQQDESL--EVQRYRAELSE
           ----EG----E---P-D-------------Q---ES-----Q---A-L--
Sequence 2 VYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLAR

Sequence 1 DDVFVIPAAYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVMSEI
           -D-FVIPA--P-AI-A--N-N-----FGIN--NNQRNFLAG---N-----
Sequence 2 GDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAGQ-NNIINQL

Sequence 1 PTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLS
           --E----SF-------E-----Q-ES-FV---P---Q---G--GR---L-
Sequence 2 EREAKELSFNMPREEIEEIFERQVESYFV---PMERQSRRG-QGRDHPLA

Sequence 1 SILGSLY--
           SIL------
Sequence 2 SILDFAGFF



Alignment 19
Sequence 1:
Sequence 2: Allergen Gos h 1, Sequence: P09801
Sequence identity: 33.55 (152/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVRNKSACVVLLFSLFLSFGLLCSAKDFPGRRGDDDPPKRYEDCRRRCEW

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DTRGQKEQQQCEESCKSQYGEKDQQQRHRPEDPQRRYEECQQECRQQEER

Sequence 1 -------------------------------------MVRARVQLLLGIL
           ---------------------------------------R----------
Sequence 2 QRPQCQQRCLKRFEQEQQQSQRQFQECQQHCHQQEQRPERKQQCVRECRE

Sequence 1 FLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGH
           -----------------E--EE-------NPF-F---R-F---F----G-
Sequence 2 RYQENPWRREREEEAEEEETEEGEQEQSHNPFHFHR-RSFQSRFREEHGN

Sequence 1 LRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGR
           -RV--RF--R----------R-------PNT--LPHH-DA-----V-NGR
Sequence 2 FRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDAEKIYLVTNGR

Sequence 1 AILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPV
           --LT--------SY----G-----PAG-T--L-N------L-I--L--PV
Sequence 2 GTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPV

Sequence 1 NNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQ
           NNP--F--FF-------QSYLR-FS--ILE--F-------D--LFG----
Sequence 2 NNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDE-LFGG--R

Sequence 1 QQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNP
           Q-H----Q--G-------EQIR-L---A---S--E-S-----FNL----P
Sequence 2 QSH-RRQQGQGMFRKASQEQIRALSQEA--TSPREKSGERFAFNLLYRTP

Sequence 1 IYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVIL
           -YSN--GR-YE--P----QL-D--V--S------G----PHYNSKA----
Sequence 2 RYSNQNGRFYEACPREFRQLSDINVTVSALQLNQGSIFVPHYNSKATFVV

Sequence 1 VINEGEAKIELVGPS-----------DQQQQDESLEVQR------YRAEL
           --NEG----E-V-P-------------QQQ--E--E--R-------R--L
Sequence 2 LVNEGNGYVEMVSPHLPRQSSFEEEEEQQQEQEQEEERRSGQYRKIRSQL

Sequence 1 SEDDVFVIPAAYPVAINATSNLNF--FAFG-----INAENNQRNFLAGEK
           S--D-FV-PA--PV---A--N-N-----FG-----IN---NQR-F-AG--
Sequence 2 SRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDHNQRIFVAGKI

Sequence 1 DNVMSEIPTEVLDVSFPASGNKVEKLIKKQ-SESHFVDAQPEQQQREEGH
           --V------------F--S---V---------ES-FV-----Q-QR----
Sequence 2 NHV-RQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVS---RQRQRASE-

Sequence 1 KGRKGSLSSILGSLY
           ---------------
Sequence 2 ---------------



Alignment 20
Sequence 1:
Sequence 2: Allergen Gos h 2, Sequence: P09799
Sequence identity: 33.33 (151/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVRNKSVFVVLLFSLFLSFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ETRGQTEQDKCEDRSETQLKEEQQRDGEDPQRRYQDCRQHCQQEERRLRP

Sequence 1 --------------------------------------MVRARVQLLLGI
           --------------------------------------------------
Sequence 2 HCEQSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPERKQQCVKECREQY

Sequence 1 LFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYG
           ---------------E--E---E------NNP-YF---R-F---F----G
Sequence 2 QEDPWKGERENKWREEEEEESDEGEQQQRNNPYYFHR-RSFQERFREEHG

Sequence 1 HLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNG
           --RV--RF-------------R-------PNT--LPHH-DA----VV-NG
Sequence 2 NFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAEKIYVVTNG

Sequence 1 RAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIP
           R---T-V------SY----G----IPAG-T--L-N------L-I--L--P
Sequence 2 RGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRP

Sequence 1 VNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEER
           VNNP--FQ-FF----E--QSYLR-FS--ILEA-F-------D----G---
Sequence 2 VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGG---

Sequence 1 QQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSN
           -Q-H----Q--G-------EQIR-L---A-S---K---S----FNL----
Sequence 2 RQSH-RRQQGQGMFRKASQEQIRALSQGATSPRGK--GSEGYAFNLLSQT

Sequence 1 PIYSNKFGRWYEITPEK-NPQLKDLDVFISSVDMKEGGLLLPHYNSKAIV
           P-YSN--GR-YE--P-----QL---D----------G----PHYNSKA--
Sequence 2 PRYSNQNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATF

Sequence 1 ILVINEGEAKIELVGP------SD-----QQQQDE------SLEVQRYRA
           -----EG----E-V-P------SD--------Q-E------S----R-RA
Sequence 2 VVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRA

Sequence 1 ELSEDDVFVIPAAYPVAINATSN--LNFFAFGI-NAENNQRNFLAGEKDN
           -LS----FV-PA--PV---A--N--L----FG--N---N-R-F-AG---N
Sequence 2 QLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGKTNN

Sequence 1 VMSEIPTEVLDVSFPASGNKVEKLIKKQ-SESHFVDAQPEQQQREEGHKG
           V------------F------V---------ES-FV---------E----G
Sequence 2 V-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDER--RG

Sequence 1 RKGSLSSILGSLY--
           ----LS--L------
Sequence 2 SNNPLSPFLDFARLF



Alignment 21
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43237
Sequence identity: 50.33 (228/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MRGRVSPLMLLLGILVLASVSATQAKSPYRKTENPCAQRCLQSCQQEPDD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LKQKACESRCTKLEYDPRCVYDTGATNQRHPPGERTRGRQPGDYDDDRRQ

Sequence 1 ---------------------------MVRARVQLLLGILFLASLSVSFG
           -------------------------------R------------------
Sequence 2 PRREEGGRWGPAEPREREREEDWRQPREDWRRPSHQQPRKIRPEGREGEQ

Sequence 1 IVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQR
           -------E--EE--SR--NNPFYF-S-RRF-T---NQ-G--RV--RFDQR
Sequence 2 EWGTPGSEVREET-SR--NNPFYFPS-RRFSTRYGNQNGRIRVLQRFDQR

Sequence 1 SKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDG
           SKQ-QNL-N-R-V-----PNTL-LP-HADAD--LV---G-A--T--N---
Sequence 2 SKQFQNLQNHRIVQIEARPNTLVLPKHADADNILVIQQGQATVTVANGNN

Sequence 1 RDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFF
           R-S--L--GHA--IP-G------N--DN-NLR--K---PVN-P--F--FF
Sequence 2 RKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFF

Sequence 1 LSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEE---RQQQHGEE-
           --S---Q-SYL-GFS-N-LEA-F---F-EI-RVL--E-----Q---G---
Sequence 2 PASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRR

Sequence 1 -----SQEEGVIVELKREQIRELIKHAKSSSRKELSSQD--EPFNLRNSN
           -----S--EGVIV----E---EL-KHAKS-S-K-----D---P-NLR---
Sequence 2 RSTRSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGE

Sequence 1 PIYSNKFGRWYEITPEK-NPQLKDLDVFISSVDMKEGGLLLPHYNSKAIV
           P--SN-FGR--E--P-K-NPQL-DLD-----V--KEG-L-LPH-NSKA-V
Sequence 2 PDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMV

Sequence 1 ILVINEGEAKIELVGPSDQQQQ-------------DE-----SLEVQRYR
           I-V-N-G----ELV-----QQQ-------------DE-------EV-RY-
Sequence 2 IVVVNKGTGNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYT

Sequence 1 AELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVM
           A-L-E-DVF--PAA-PVAINA-S-L----FGINAENN-R-FLAG-KDNV-
Sequence 2 ARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDKDNVI

Sequence 1 SEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQP--------EQQQRE
           --I-----D--FP-SG--VEKLIK-Q-ESHFV-A-P--------E----E
Sequence 2 DQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKEDQE

Sequence 1 EGHKGRKGSLSSILGSLY
           E---G-KG-L-SIL----
Sequence 2 EENQGGKGPLLSILKAFN



Alignment 22
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43238
Sequence identity: 49.89 (226/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MRGRVSPLMLLLGILVLASVSATHAKSSPYQKKTENPCAQRCLQSCQQEP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DDLKQKACESRCTKLEYDPRCVYDPRGHTGTTNQRSPPGERTRGRQPGDY

Sequence 1 --------------------------------MVRARVQLLLGILFLASL
           ------------------------------------R-------------
Sequence 2 DDDRRQPRREEGGRWGPAGPREREREEDWRQPREDWRRPSHQQPRKIRPE

Sequence 1 SVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIH
           ----------------E--SR--NNPFYF-S-RRF-T---NQ-G--RV--
Sequence 2 GREGEQEWGTPGSHVREETSR--NNPFYFPS-RRFSTRYGNQNGRIRVLQ

Sequence 1 RFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTL
           RFDQRS-Q-QNL-N-R-V----KPNTL-LP-HADAD--LV---G-A--T-
Sequence 2 RFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTV

Sequence 1 VNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHR
           -N---R-S--L--GHA--IP-G------N--DN-NLR--K---PVN-P--
Sequence 2 ANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQ

Sequence 1 FQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEE---RQQQ
           F--FF--S---Q-SYL-GFS-N-LEA-F---F-EI-RVL--E-----Q--
Sequence 2 FEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEE

Sequence 1 HGEE-----SQE--EGVIVELKREQIRELIKHAKSSSRK---ELSSQDEP
           -G-------S-E--EGVIV----E---EL-KHAKS-S-K---E------P
Sequence 2 RGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNP

Sequence 1 FNLRNSNPIYSNKFGRWYEITPEK-NPQLKDLDVFISSVDMKEGGLLLPH
           -NLR---P--SN-FG---E--P-K-NPQL-DLD-----V--KEG-L-LPH
Sequence 2 INLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPH

Sequence 1 YNSKAIVILVINEGEAKIELVGPSDQQQQ----------DE-----SLEV
           -NSKA-VI-V-N-G----ELV-----QQQ----------DE-------EV
Sequence 2 FNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNREV

Sequence 1 QRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEK
           -RY-A-L-E-DVF--PAA-PVAINA-S-L----FGINAENN-R-FLAG-K
Sequence 2 RRYTARLKEGDVFIMPAAHPVAINASSELHLLGFGINAENNHRIFLAGDK

Sequence 1 DNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQP----------
           DNV---I-----D--FP-SG--VEKLIK-Q-ESHFV-A-P----------
Sequence 2 DNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQSPSSP

Sequence 1 -----EQQQREEGHKGRKGSLSSILGSLY
           -----E----EE---G-KG-L-SIL----
Sequence 2 EKESPEKEDQEEENQGGKGPLLSILKAFN



Alignment 23
Sequence 1:
Sequence 2: Allergen Ses i 3, Sequence: AAK15089
Sequence identity: 32.01 (145/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF

Sequence 1 ---MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYF
           -------R---------------------RE--E-QEE---RG---P--F
Sequence 2 SREHCERRREEKYREQQGREGGRGEMYEGREREEEQEEQ-GRGRI-PYVF

Sequence 1 NSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLL
           --D--F-T-F--Q-G--RV---F--RS------ENYRV------P-T---
Sequence 2 E-DQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIV

Sequence 1 PHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVN
           P-H-DA-----V--GR----LV--D-R-S----QG---KI-AGTT--L-N
Sequence 2 PNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLIN

Sequence 1 PNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFD
           ---N--L---KL--PV--P--F--FF----E---S----FS--ILEA-F-
Sequence 2 RDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFN

Sequence 1 SDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRK
           -------R--FG--RQ----------GVIV----EQ-R----H-------
Sequence 2 TRRDRLQRI-FGQQRQ----------GVIVKASEEQVRAMSRHEEGGIWP

Sequence 1 ELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKE
           ---------N-----P--SN--G---E-------QL-DLD---S------
Sequence 2 FGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQ

Sequence 1 GGLLLPHYNSKAIVILVINEGEAKIELVGP----SDQQQQDESL---EVQ
           G----PHYNSKA--I-----GE---E---P----S----Q-E-------Q
Sequence 2 GAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQ

Sequence 1 RYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQRNFLAGE
           R----L----V--IPA--P----A-SN-N-----F--NA-NN----LAG-
Sequence 2 RVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGR

Sequence 1 KDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGH
           --NVM-----E-----F------VE-----Q-E--F----P-QQQ-----
Sequence 2 R-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQQGRAD

Sequence 1 KGRKGSLSSILGSLY
           ---------------
Sequence 2 A--------------



Alignment 24
Sequence 1:
Sequence 2: Allergen Pis v 3.0101, Sequence: EF116865
Sequence identity: 30.91 (140/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KTDPELKQCKHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQEEEEEEE

Sequence 1 --------------------------------------MVRARVQLLLGI
           ----------------------------------------R-R-Q-----
Sequence 2 WGSGRGRGDEFSTHEPGEKRLSQCMKQCERQDGGQQKQLCRFRCQEKYKK

Sequence 1 LFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYG
           ---------------E--E-QEE-D-----NP--F--D--F-T--K---G
Sequence 2 ERREHSYSRDEEEEEEGDEEQEEED----ENPYVFE-DEHFTTRVKTEQG

Sequence 1 HLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNG
           ---V---F--RSK----LE-YR-------P-----P-H-DAD----V--G
Sequence 2 KVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDADSIFFVSWG

Sequence 1 RAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIP
           R---T------R-S----QG----I-AGT-F--VN---N--L-I-KL--P
Sequence 2 RGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQP

Sequence 1 VNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEER
           VN-P-----F-----E---S--R-FS---LEA------------LF----
Sequence 2 VNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-LF----

Sequence 1 QQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDE-PFNLRNS
           ------E-Q-EG-IV----EQIR---------S-----------FNL---
Sequence 2 ------EKQDEGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKK

Sequence 1 NPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIV
           -P--SN--G---E------P-L--LD---S-V----GG---P-YNS-A--
Sequence 2 DPSQSNNYGQLFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATK

Sequence 1 ILVINEGEAKIELVGP----SDQQQQDESLE-VQRYRAELSEDDVFVIPA
           I-----GE---E---P----S----Q--S-------------D-VFV-PA
Sequence 2 IAIVVSGEGRLEIACPHLSSSKNSGQEKSGPSYKKLSSSIRTDSVFVVPA

Sequence 1 AYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVS
           --P----A--N-N-----F--NAE-N-R--LAG-K-N-------E-----
Sequence 2 GHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKK-NIIEVMEKEAKELA

Sequence 1 FPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY
           F---G--V-K---KQ-E--F----P---Q---G----------------
Sequence 2 FKTKGEEVDKVFGKQDEEFFFQG-PKWRQHQQGRADE------------



Alignment 25
Sequence 1:
Sequence 2: Allergen Jug r 6.0101, Sequence: A0A2I4E5L6
Sequence identity: 32.01 (145/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAFKPKIPIALLLLTSLLAICAGLALAMQDPELKQCKHQCRHQRQFDEQE

Sequence 1 ------MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNP
           ----------------------------G----E--E--E----R---NP
Sequence 2 KEHCQRSCDEYHIEKKARERAERRRSEEGSSREEGYEEEELGGEREEENP

Sequence 1 FYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNT
           --F--D--F-T------G---V---F--RSK-----EN-RV------P-T
Sequence 2 YVFE-DEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQT

Sequence 1 LLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFF
           ---P-H-DA-----V--GRA--T-V----R-----EQG----IPAGT---
Sequence 2 FISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVY

Sequence 1 LVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEA
           L-N---N--L-I-K---PV--P--F--F--S--E---S--R-FS---LEA
Sequence 2 LINRDENEKLYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEA

Sequence 1 SFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSS
           ------------LFG---Q----------GVI-----EQIR---KH----
Sequence 2 ALKTRRDQLEK-LFGKQTQ----------GVIIKASKEQIRSMSKHEETT

Sequence 1 SRKELSSQD--EPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISS
           -R------D---PFNL----P--SN-FGR--E--P----QL-DLD---S-
Sequence 2 PRIWPFGGDSTHPFNLFHKRPSQSNQFGRLFETDPKECKQLQDLDLMVSF

Sequence 1 VDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP---------------
           -----G----P-YNS-A--I-V--EGE---E---P---------------
Sequence 2 ANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLSSSGSRGQREGSG

Sequence 1 SDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINAT--SNLNFFAFGI
           S-----------Q--R--L----VFV-PA--PVA--A----NL----F--
Sequence 2 SSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFDV

Sequence 1 NAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFV
           NA--N-R--LAG-K-N---E---E-----F------VEK----Q----F-
Sequence 2 NAQGNIRFPLAG-KNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFFF

Sequence 1 DAQPEQQQREEGHKGRKGSLSSILGSLY
           ---P--Q--E-G----------------
Sequence 2 PG-PSRQPEEGGRAFE------------



Alignment 26
Sequence 1:
Sequence 2: Allergen Pin k 2.0101, Sequence: V9VGU0
Sequence identity: 29.58 (134/453)
Sequence 1 --------------------MVRARVQLLLGILFLASLSVSFGIVHREHQ
           ------------------------------G-----------G----EH-
Sequence 2 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG

Sequence 1 ESQEES--DSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQ
           --------------NP--F-SDR-F--------G--R----F---S----
Sequence 2 RGHHRGGREEEREENPYVFHSDR-FRIRASSEAGEIRALPNFGEVSELLE

Sequence 1 NLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYI
           ----YRV-----KPNT--LPH--DA---L-V--GR-----V---------
Sequence 2 GISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRK

Sequence 1 LEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHR--FQNFFLSS
           LE-G-----P-G-TF-LVN--D---LRI--L--------R-----F----
Sequence 2 LEEGDVFGVPSGHTFYLVNNDDHNSLRIASL-LRTESTMRGEYEPFYVAG

Sequence 1 TEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVI
           ----------FS---LEA-F--D--------FG--R-----------GVI
Sequence 2 GRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FGAHRR----------GVI

Sequence 1 VELKREQIRELIKHAKSSSRKELSS-QDEPFNLRNSNPIYSNKFGRWYEI
           -----EQIRE-------S------S-Q--PFNLRN--P---N--GR----
Sequence 2 FYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRA

Sequence 1 TPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELV
           -P--NP-L---DV---------G----P--N-KA--I----EGE--IE--
Sequence 2 GPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMA

Sequence 1 GP---------SDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATS
           -P---------S------------R-RA-L----V-V-PA--P----A--
Sequence 2 CPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIAST

Sequence 1 N--LNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPAS-GNKVE
           N--L----F-IN---N-R-FLAG-K-NV------EV---SF----G---E
Sequence 2 NGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIPRGEEIE

Sequence 1 KLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY
           -----Q---------P--Q-R-E-----------------
Sequence 2 EVLQAQKD-QVILRGPQRQRRDEPRSSS------------



Alignment 27
Sequence 1:
Sequence 2: Allergen Cor a 11, Sequence: AAL86739
Sequence identity: 32.01 (145/453)
Sequence 1 ----------------MVRARVQLLLGILFLASLSVSFGIVHREHQESQE
           -------------------------------------------E---S-E
Sequence 2 MLPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQEEGNSSE

Sequence 1 ESDSRGQN-NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENY
           ES----Q--NP--F--D--F----K---G---V---F--RS------EN-
Sequence 2 ESYGKEQEENPYVFQ-DEHFESRVKTEEGRVQVLENFTKRSRLLSGIENF

Sequence 1 RVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGH
           R-------P-T---P-H-DA---L-V--GRA--T-V----R-S---E-G-
Sequence 2 RLAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGD

Sequence 1 AQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSY
           ---IPAGT-----N---N--L-I-K---PV--P--F--F-----E---S-
Sequence 2 IIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFEAFYGAGGEDPESF

Sequence 1 LRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQ
           -R-FS---LEA-----------V-FGE----------Q--G-IV---RE-
Sequence 2 YRAFSWEVLEAALKVRREQLEKV-FGE----------QSKGSIVKASREK

Sequence 1 IRELIKHAKSSSR--KELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNP
           IR-L--H-----R----------P-NL----P--SN-FGR-YE--P----
Sequence 2 IRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHK

Sequence 1 QLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQ
           QL-DLD---S------G----P-YNS-A--I-V--EGE---E---P----
Sequence 2 QLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACP---H

Sequence 1 QQDESLEVQRYRAELSEDDVFVIPAAYPVAINAT--SNLNFFAFGINAEN
           ----S---Q---A-L----VFV-PA--PVA--A----NL----F--NA--
Sequence 2 LSSSSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHG

Sequence 1 NQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQP
           N-R--LAG-K-N---E---------F------VE---K-Q----F----P
Sequence 2 NSRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPG-P

Sequence 1 EQQQREEGHKGRKGSLSSILGSLY
           --QQ-E-G--GR------------
Sequence 2 NKQQEEGGRGGRAFE---------



Alignment 28
Sequence 1:
Sequence 2: Allergen Ana o 1.0102, Sequence: AAM73729
Sequence identity: 27.81 (126/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQ

Sequence 1 -----MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQN-NP
           -------------------------------RE--E---E--------NP
Sequence 2 CERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEEDENP

Sequence 1 FYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNT
           --F--D--F-T--K---G-------F-Q-SK----LE-YR-------P--
Sequence 2 YVFE-DEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQA

Sequence 1 LLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFF
           ---P-H-DAD----V--GR---T------R-S----QG----I--GT-F-
Sequence 2 FVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFY

Sequence 1 LVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEA
           --N---N--L-------PVN-P--F--F-----E---S--R-FS--ILEA
Sequence 2 IANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEA

Sequence 1 SFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSS
           ------------LF----------E-Q--G-I-----EQ-R---------
Sequence 2 ALKTSKDTLEK-LF----------EKQDQGTIMKASKEQVRAMSRRGEGP

Sequence 1 SRKELSSQDE-PFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSV
           ------------F-L----P--SNK-G---E------P-L--LD---S--
Sequence 2 KIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYA

Sequence 1 DMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYR
           ----GG---P-YNS-A--I-----GE---E---P---------------R
Sequence 2 NITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPSYKKLR

Sequence 1 AELSEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDN
           A----D-VF--PA--P-A--A--N-N-----F--NAE-N-R--LAG-K-N
Sequence 2 ARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-N

Sequence 1 VMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGR
           -------E-----F---G--V-K---KQ-E--F----PE-----EG----
Sequence 2 IIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKEKEGRADE

Sequence 1 KGSLSSILGSLY
           ------------
Sequence 2 ------------



Alignment 29
Sequence 1:
Sequence 2: Allergen Ana o 1.0101, Sequence: AAM73730
Sequence identity: 28.04 (127/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCM

Sequence 1 -------MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQN-
           ---------------------------------RE--E---E--------
Sequence 2 RQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEEDE

Sequence 1 NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKP
           NP--F--D--F-T--K---G-------F-Q-SK----LE-YR-------P
Sequence 2 NPYVFE-DEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANP

Sequence 1 NTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTT
           -----P-H-DAD----V--GR---T------R-S----QG----I--GT-
Sequence 2 QAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTP

Sequence 1 FFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNIL
           F---N---N--L-------PVN-P--F--F-----E---S--R-FS--IL
Sequence 2 FYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEIL

Sequence 1 EASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAK
           EA------------LF----------E-Q--G-I-----EQIR-------
Sequence 2 EAALKTSKDTLEK-LF----------EKQDQGTIMKASKEQIRAMSRRGE

Sequence 1 SSSRKELSSQDE-PFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFIS
           --------------F-L----P--SNK-G---E------P-L--LD---S
Sequence 2 GPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVS

Sequence 1 SVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQR
           ------GG---P-YNS-A--I-----GE---E---P--------------
Sequence 2 YANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPSYKK

Sequence 1 YRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQRNFLAGEK
           -RA----D-VF--PA--P-A--A--N-N-----F--NAE-N-R--LAG-K
Sequence 2 LRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK

Sequence 1 DNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHK
           -N-------E-----F---G--V-K---KQ-E--F----PE-----EG--
Sequence 2 -NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKEKEGRA

Sequence 1 GRKGSLSSILGSLY
           --------------
Sequence 2 DE------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Coc n 1.0101, Sequence: A0A0S3B0K0
Sequence identity: 25.61 (116/453)
Sequence 1 ----MVRARVQLLLGILFLASLSVSFGIVHR----EHQESQ-EESDSRGQ
           ----M--------L--L-L-S-S------------E--E---EE---R--
Sequence 2 MVSAMGDRTASAILALLLLSSWSLMVVMAYQGRGMEGREKRVEEKAPRSP

Sequence 1 NNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSK
           -----F---RR-----K---G--R-------R-----N------------
Sequence 2 EDRGLFIL-RRSKEVLKTDAGEVRLMMGYRYRG----NHSPMHIGFITME

Sequence 1 PNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGT
           PNTL--P---DA---L-V--G-A--------------L--G----IPAG-
Sequence 2 PNTLYIPQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGS

Sequence 1 TFFLVNPNDNDNLRIIKLAIPVNNPHRF----QNFFLSSTEAQQSYLRGF
           -F--VN------L-II----------------Q-F---------S-L-GF
Sequence 2 SFYIVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVLPRSVLSGF

Sequence 1 SKNILEASFDSDFKEIDRVL---FGEERQQQHGEESQEE---GVIVELKR
           ----L-A-F----------L----G-------GE----------I--LK-
Sequence 2 DASTLSAAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKE

Sequence 1 EQIRE-----------------------LIKH------AKSSSRKELSSQ
           ----E-----------------------L-K---------------L---
Sequence 2 RMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQRKHKLAHS

Sequence 1 DEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLL
           ----NL----P-Y-N--G----I-------LK--------V--K-G--L-
Sequence 2 PGSYNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLS

Sequence 1 PHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVF
           PH-N--A-----I--G---I--V-P----------------A--SE-DVF
Sequence 2 PHVNPTATEYGIILRGSGTIQVVFPNGTAAMN---------AKVSEGDVF

Sequence 1 VIPAAYPVAINATSN--LNFFAFGINAENNQRNFLAGEKDNVMSEIPTEV
           -IP---P----A-----L-FF-F---A--N---FL-G-K-----------
Sequence 2 WIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVG-KSSLLHSMRGPE

Sequence 1 LDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILG
           L---F--S----E---K-Q-E-------P-----E---K--KG-------
Sequence 2 LAAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKKWKGEEVLVMK

Sequence 1 SLY--
           -----
Sequence 2 RGLFA



Alignment 31
Sequence 1:
Sequence 2: Allergen Gly m Bd28K, Sequence: BAB21619
Sequence identity: 21.85 (99/453)
Sequence 1 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSD
           ------------L-L------------------E--D-------F-----
Sequence 2 --------KTTLLLLLFVLCHGVATTTMAFHDDEGGDKKSPKSLFLMSNS

Sequence 1 RRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKS-KPNTLLLPH
           -R----FK---G--RV-------S-------------F-S--P--L--P-
Sequence 2 TR---VFKTDAGEMRVL-----KSHGGRIFYRHMHIGFISMEPKSLFVPQ

Sequence 1 HADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPN
           --D---------G-A-L-----D------L--G----IP-G--F-LVN--
Sequence 2 YLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIG

Sequence 1 DNDNLRIIKLAIPVNN--PHRFQNFFLSSTEAQQSYLRGFSKNILEASFD
           ----L--I----P--------FQ-F---------S-L-GF---ILE--F-
Sequence 2 EGQRLHVICSIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFN

Sequence 1 SD-------F-KEIDR-VLF-------------------GEERQQQHGEE
           ---------F-KE-D----F---------------------E-Q------
Sequence 2 ESRTVVEEIFSKELDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQ

Sequence 1 SQEEGVIVELKREQIRELIKHAKSSSRKELSSQDE---P--FNLRNSNPI
           -QEE-----------R-L---------------D----P---NL------
Sequence 2 DQEEDEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKA

Sequence 1 -YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVIL
           ---N--G----------P-L---D-----V----G--L-PH-N-------
Sequence 2 DFKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYT

Sequence 1 VINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAIN
           ----G--------P----------------------DVFV-P---P----
Sequence 2 IVLSGYGELHIGYPNGSRAM---------KTKIKQGDVFVVPRYFPFCQV

Sequence 1 ATSN--LNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNK
           A-----L-FF-F---A--N---FLAG-----------E-L---F--S---
Sequence 2 ASRDGPLEFFGFSTSARKNKPQFLAGAASLLRTLMGPE-LSAAFGVSEDT

Sequence 1 VEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY-------
           -------Q-E---------------G----------I------------
Sequence 2 LRRAVDAQHEAVILPSAWAAPPENAGKLKMEEEPNAIRSFANDVVMDVF



Alignment 32
Sequence 1:
Sequence 2: Allergen Cuc ma 4.0101, Sequence: P13744
Sequence identity: 23.40 (106/453)
Sequence 1 --MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFN
           ---------L-L-------LS--------E-Q-S------R-Q-------
Sequence 2 MARSSLFTFLCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPRACRL

Sequence 1 SDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLP
           ---R------------------DQ-----Q-------------P--LLLP
Sequence 2 ENLRAQDPVRRAEAEAIFTEVWDQDNDEFQC-AGVNMIRHTIRPKGLLLP

Sequence 1 HHADADFLLVVLNGRAILTLVNPDGRDSYILE------QGHA-----QKI
           ----A--L--V--G--I-----P-----Y----------G-A-----QKI
Sequence 2 GFSNAPKLIFVAQGFGIRGIAIPGCAETYQTDLRRSQSAGSAFKDQHQKI

Sequence 1 -----------PAGTTFFLVNPNDNDNLRIIKLAIPVN-----NPHRFQN
           -----------PAG------N----D-L--I--A---N------P-----
Sequence 2 RPFREGDLLVVPAGVSHWMYNRGQSD-LVLIVFADTRNVANQIDPY-LRK

Sequence 1 FFL---------------------SSTEAQQSYLRGFSKNILEASFDSDF
           F-L---------------------SS-E-------GF----LE--F--D-
Sequence 2 FYLAGRPEQVERGVEEWERSSRKGSSGEKSGNIFSGFADEFLEEAFQIDG

Sequence 1 KEIDRVLFGEERQQQHGEESQEE-GVIVELKREQIRELIKHAKSSSRKEL
           ----R-L-GE-----------E---V----K-E--R-------S-S--E-
Sequence 2 GLV-RKLKGEDDERDRIVQVDEDFEVLLPEKDEEERSRGRYIESESESEN

Sequence 1 SSQDEPFNLR-NSN-------PIYSNKFGRWYEITPEKNPQLKDLDVFIS
           --------LR---N--------------GR---------P-L--------
Sequence 2 GLEETICTLRLKQNIGRSVRADVFNPRGGRISTANYHTLPILRQVRLSAE

Sequence 1 SVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQR
           -----------PHY------------G-A----V----Q---D-------
Sequence 2 RGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFD-------

Sequence 1 YRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQRNFLAGEK
           ---E--E--V--IP----V-I---S---F---AF--N--N---N-LAG--
Sequence 2 --GEVREGQVLMIPQNF-VVIKRASDRGFEWIAFKTN-DNAITNLLAGRV

Sequence 1 DNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHK
           ---M---P--VL------S------L---Q-E---------Q--RE----
Sequence 2 SQ-MRMLPLGVLSNMYRISREEAQRLKYGQQEMRVLSPGRSQGRRE----

Sequence 1 GRKGSLSSILGSLY
           --------------
Sequence 2 --------------



Alignment 33
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 17.44 (79/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTN

Sequence 1 --------------------------------MVRARVQLLLGILFLASL
           ----------------------------------------------L---
Sequence 2 RIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYI

Sequence 1 SVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIH
           ----GI---------E------Q---------------------------
Sequence 2 ERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHF

Sequence 1 RFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTL
           R--------------------S---T--L-H-------L--------L--
Sequence 2 REGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAG

Sequence 1 VNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHR
           ---D--------Q-------------------------------------
Sequence 2 NPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEFLA

Sequence 1 FQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGE
           --------T------------NI-------------R-----ERQ-----
Sequence 2 DAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER

Sequence 1 ESQEEGVIVELKREQ---IRELIKHAKSSSRKELSSQDEPFNLRNSNPIY
           ES--E----E--R-Q----R-------------L----E----R----IY
Sequence 2 ESEQER---ERQRRQGGRGRDVNGFEETICSLRLR---ENICTRSRADIY

Sequence 1 SNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVI
           ----GR---------P-L--L-------D----GL--PH-N--A------
Sequence 2 TEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYA

Sequence 1 NEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINAT
           --G-A----V--------D----------EL----V--IP----VA--A-
Sequence 2 IRGRARVQVVDDNGNTVFDD---------ELRQGQVLTIPQNFAVAKRAE

Sequence 1 SN-LNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEK
           S------AF--N--N-Q---LAG---------P--VL---F--S------
Sequence 2 SEGFEWVAFKTN-DNAQISPLAG-RTSAIRALPDDVLANAFQISREEARR

Sequence 1 LIKKQSESHFVD---AQPEQQQREEGHKGRKGSLSSILGSLY
           L-----E---V-------E---R-E---GR------------
Sequence 2 LKYNRQETTLVRSSRSSSERKRRSES-EGRAEA---------



Alignment 34
Sequence 1:
Sequence 2: Allergen Gos h 4, Sequence: P09800
Sequence identity: 16.34 (74/453)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAYTSLLSFSVCLLVLFHGCCAQIDLVTNHHQDPPWGQPQQPQPRHQSQC

Sequence 1 ----------------------------------------MVRARVQLLL
           --------------------------------------------R--LLL
Sequence 2 QLQNLNALQPKHRFRSEAGETEFWDQNEDQFQCAGVAFLRHKIQRKGLLL

Sequence 1 GILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQ
           -----A------------H-----------Q--------DR---------
Sequence 2 PSFTSAPMLFYVEQGEGIHGAVFPGCPETYQSQSQQNIQDRPQRDQHQKL

Sequence 1 YGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVL
           ---------------------N-R--------------------------
Sequence 2 RRLKEGDVVALPAGVAHWIFNNGRSQLVLVALVDVGNDANQLDENFRKFF

Sequence 1 NGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLA
           --------V---G---------------------------N--L------
Sequence 2 LAGSPQGGVVRGGQSRDRNQRQSRTQRGEREEEESQESGGNNVLSGFRDN

Sequence 1 IPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGE
           --------------------------------------------R---GE
Sequence 2 LLAQAFGIDTRLARKLQNERDNRGAIVRMEHGFEWPEEGQRRQGREEEGE

Sequence 1 ERQQ---QHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFN
           E------Q---ESQEEG---E---E--R--------------S-------
Sequence 2 EEREPKWQRRQESQEEGSEEEEREERGRGRRRSGNGLEETFCSMRLKHRT

Sequence 1 LRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNS
           ---S--------GR---------P-L--L----------------PH-N-
Sequence 2 PASSADVFNPRGGRITTVNSFNLPILQYLQLSAERGVLYNNAIYAPHWNM

Sequence 1 KAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAA
           -A--I--I--G---I--V--------DE--E----R-------V---P--
Sequence 2 NAHSIVYITRGNGRIQIVSENGEAIFDEQVE----RGQ-----VITVPQN

Sequence 1 YPVAINA-TSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFP
           --V---A--------AF--NA-N------AG-----M---P--VL--SF-
Sequence 2 HAVVKKAGRRGFEWIAFKTNA-NAKISQIAG-RVSIMRGLPVDVLANSFG

Sequence 1 ASGNKVEKLIKKQSE-SHFVDAQPEQQQREEGHKGRKGSLSSILGSLY
           -S------L-----E-S-F---Q--QQ---------------------
Sequence 2 ISREEAMRLKHNRQEVSVFSPRQGSQQ---------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.