The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ara h 17.0101

Sequence A0A510A9S3_ARAHY

Full FASTA alignment

Sequence name:
Query sequence:
AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ara h 17.0101A0A510A9S3Go!93126.31.4e-31
2Mal d 3Q9M5X7Go!11589.91.5e-20
3Fra a 3.0102Q4PLT9Go!11788.83.4e-20
4Pyr c 3Q9M5X6Go!11587.48.4e-20
5Fra a 3.0101Q8VX12Go!11787.11.1e-19
6Rub i 3.0101Q0Z8V0Go!11787.11.1e-19
7Lup an 3.0101XP_019446786Go!11685.24.0e-19
8Pru p 3CAB96876Go!9184.64.6e-19
9Ara h 9.0201ABX75045Go!9284.36.0e-19
10Pru ar 3P81651Go!9183.97.7e-19
11Fra a 3.0201Q4PLU0Go!11783.51.3e-18
12Pru p 3P81402Go!9182.81.7e-18
13Fra a 3.0202Q4PLT6Go!11782.91.9e-18
14Pru d 3P82534Go!9182.42.2e-18
15Pha v 3.0201ADC80503Go!11882.82.2e-18
16Pru av 3Q9M5X8Go!11781.84.2e-18
17Mor n 3.0101P85894Go!9179.91.2e-17
18Can s 3.0101W0U0V5Go!9178.82.6e-17
19Ara h 9.0101ABX56711Go!11678.83.4e-17
20Len c 3.0101A0AT29Go!11878.83.4e-17
21Pha v 3.0101ADC80502Go!11577.86.5e-17
22Pis s 3.0101A0A161AT60Go!12077.96.6e-17
23Pla or 3.0101ABY21307Go!11877.11.1e-16
24Pla a 3.0101CAL07989Go!11876.41.9e-16
25Cor a 8AAK28533Go!11575.24.0e-16
26Zea m 14.0101P19656-1Go!12075.24.1e-16
27Hev b 12AAL25839Go!11674.85.3e-16
28Zea m 14.0102P19656-2Go!12874.76.3e-16
29Pun g 1.0101A0A059STC4Go!12074.57.0e-16
30Art v 3.0202ACE07187Go!11673.11.7e-15
31Art si 3.0102ANC85027Go!11673.11.7e-15
32Art ar 3.0102ANC85020Go!11673.11.7e-15
33Art ca 3.0101ANC85021Go!11772.82.2e-15
34Art an 3.0101ANC85017Go!11772.82.2e-15
35Art an 3.0102ANC85018Go!11772.42.9e-15
36Art gm 3.0101ANC85022Go!11772.42.9e-15
37Art gm 3.0102ANC85023Go!11772.42.9e-15
38Art v 3.0201EU564845Go!11471.26.2e-15
39Art ar 3.0101ANC85019Go!11671.36.3e-15
40Art la 3.0101ANC85024Go!11671.36.3e-15
41Pru du 3.0101ACN11576Go!12371.36.5e-15
42Pun g 1.0201A0A059SSZ0Go!12071.17.3e-15
43Art ca 3.0102QIN55516Go!11770.98.2e-15
44Tri tu 14.0101CAH69206Go!11569.03.0e-14
45Lyc e 3AAB42069Go!11468.83.4e-14
46Sola l 3.0101P93224Go!11468.83.4e-14
47Art si 3.0101ANC85026Go!11668.83.4e-14
48Pun g 1.0301A0A059ST23Go!12068.35.2e-14
49Art la 3.0102ANC85025Go!11568.15.8e-14
50Art v 3.0301EU564847Go!11768.15.8e-14
51Tri a 14.010119846220Go!9067.37.5e-14
52Sin a 3.0101ABU95411Go!9267.37.5e-14
53Hor v 1AAA32970Go!11767.58.6e-14
54Api g 2ACV04796Go!11866.91.3e-13
55Hor v 1CAA42832Go!13466.81.6e-13
56Hel a 3.0101P82007Go!11664.95.3e-13
57Sola l 7.0101NP_001316123Go!11563.21.7e-12
58Amb a 6O04004Go!11850.41.2e-08
59Par j 2O04403Go!13341.27.9e-06
60Par j 2P55958Go!13339.92.0e-05
61Par j 1P43217Go!13939.23.4e-05
62Par j 1O04404Go!17639.33.9e-05
63Par j 1.0103CAI94601Go!13938.84.4e-05
64Par j 1Q40905Go!13838.65.0e-05
65Par j 1.0101CAA54587Go!13337.11.4e-04
66Art v 3.0101P0C088Go!3734.52.3e-04
67Cas s 810998016Go!3629.85.9e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 100.00 (93/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
Sequence 2 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
Sequence 2 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK



Alignment 2
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 63.44 (59/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP
           -----------------------AI-C--VT-S-APC-GY--SGG-V---
Sequence 2 MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA

Sequence 1 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV
           CC-GI--ING-A-TT-DRQ--CNCLK--A-S--S--NPNNAA-LPGKCGV
Sequence 2 CCNGIRTINGLARTTADRQTACNCLKNLAGSI-SGVNPNNAAGLPGKCGV

Sequence 1 SIPYKISTSINCSSIK
           --PYKISTS-NC---K
Sequence 2 NVPYKISTSTNCATVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 63.44 (59/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------AI-C--V---I-PC--Y-KSGG-V-
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           -PCCSGI-N-NG-AKTT-DRQA-CNCLK-AA-------NPN-AA-LPGKC
Sequence 2 APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKG-LNPNLAAGLPGKC

Sequence 1 GVSIPYKISTSINCSSIK
           GVS-PYKIST--NC---K
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 4
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 62.37 (58/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP
           -----------------------AI-CS-V----APC--Y--SGG-V---
Sequence 2 MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVPPA

Sequence 1 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV
           CC-GI--ING-AKTT-DRQA-CNCLK--A-S--S--NP-NA-SLPGKCGV
Sequence 2 CCNGIKTINGLAKTTPDRQAACNCLKNLAGSV-SGVNPGNAESLPGKCGV

Sequence 1 SIPYKISTSINCSSIK
           --PYKISTS-NC---K
Sequence 2 NVPYKISTSTNCATVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 62.37 (58/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------AI-C--V---I-PC--Y-KSGG-V-
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CCSGI-N-NG-AKTT-DRQA-CNCLK-AA-------NPN-AA-LPGKC
Sequence 2 AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKG-LNPNLAAGLPGKC

Sequence 1 GVSIPYKISTSINCSSIK
           GVS-PYKIST--NC---K
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 60.22 (56/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------AI-C--VT---APCF-Y-K-GG-V-
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G--N-N--AKTT-DRQ--CNCLK-AA-S-----NP--AA-LPGKC
Sequence 2 AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPG-LNPSLAAGLPGKC

Sequence 1 GVSIPYKISTSINCSSIK
           GVS-PYKISTS-NC---K
Sequence 2 GVSVPYKISTSTNCATVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 63.44 (59/93)
Sequence 1 ------------------------AIQCSFVTKSIAPCFGYLKSGGTVSG
           ------------------------AI-C--VT---A-C--YL-SGG-V--
Sequence 2 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA

Sequence 1 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG
           PCC-GI-NI---AKTT-DR---CNCLK-AAA------NP-NA-SLPGKCG
Sequence 2 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPG-LNPSNAGSLPGKCG

Sequence 1 VSIPYKISTSINCSSIK
           V-IPYKISTS-NC-SIK
Sequence 2 VNIPYKISTSTNCASIK



Alignment 8
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 59.14 (55/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           -I-C--V--S-APC--Y---GG-V---CC-GI-N-N--A-TT-DRQA-CN
Sequence 2 -ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACN

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           CLK---AS-----NPNNAA-LPGKCGVSIPYKIS-S-NC---K
Sequence 2 CLKQLSASVPG-VNPNNAAALPGKCGVSIPYKISASTNCATVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 60.22 (56/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           ---C--V----APC---L--GG--SGPCCSG-----G-AKTT-DRQA-CN
Sequence 2 -LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACN

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK-
           CLK-AA-SL----N--NAA-LPG-CGVSIPYKISTS-NC--IK-
Sequence 2 CLKAAAGSLHG-LNQGNAAALPGRCGVSIPYKISTSTNCATIKF



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 56.99 (53/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           -I-C--V--S-APC-GY---GG-V---CC-GI-N-N--A-TT-DR---CN
Sequence 2 -ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACN

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           CLK----S--S--NPNNAA-LPGKCGV-IPYKIS-S-NC---K
Sequence 2 CLKQLSGSI-SGVNPNNAAALPGKCGVNIPYKISASTNCATVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 59.14 (55/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------AI-C--V--SI-PC--Y-KSGG-V-
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-GI---N--AKTT-DRQA-CNCLK-A--------NP--AA-LPGKC
Sequence 2 AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKG-LNPSLAAGLPGKC

Sequence 1 GVSIPYKISTSINCSSIK
           GVS-PYKISTS-NC---K
Sequence 2 GVSVPYKISTSTNCAAVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 56.99 (53/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           -I-C--V----APC--Y---GG-V---CC-GI-N-N--A-TT-DRQA-CN
Sequence 2 -ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACN

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           CLK---AS-----NPNNAA-LPGKCGV-IPYKIS-S-NC---K
Sequence 2 CLKQLSASVPG-VNPNNAAALPGKCGVHIPYKISASTNCATVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 58.06 (54/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------AI-C--V--SI-PC--Y-KSGG-V-
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-GI---N--AKTT-DRQ--CNCLK-A--------NPN-AA-LPGKC
Sequence 2 AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKG-LNPNLAAGLPGKC

Sequence 1 GVSIPYKISTSINCSSIK
           GV--PYKISTS-NC---K
Sequence 2 GVNVPYKISTSTNCAAVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 54.84 (51/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           -I-C--V----APC--Y-K-GG-V---CC-GI-N-N--A-TT-DR-A-CN
Sequence 2 -ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACN

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           CLK----S-----NPNNAA-LPGKCGV--PYKIS-S-NC---K
Sequence 2 CLKQLSGSIPG-VNPNNAAALPGKCGVNVPYKISASTNCATVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 62.37 (58/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------AI-C--VT-S-A-C---L--GG-V-
Sequence 2 MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CCSG----N--AKTT-DRQAVCNCLKSAA-------N-NNA--LPGKC
Sequence 2 ASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPG-FNANNAGILPGKC

Sequence 1 GVSIPYKISTSINCSSIK-
           GVSIPYKISTS-NC--IK-
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 16
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 55.91 (52/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--C--V----APC--Y---GG-V-
Sequence 2 MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-GI-NIN--AKTT-DRQ--CNCLK---AS-----N-NNAA-LPGKC
Sequence 2 PACCNGIRNINNLAKTTADRQTACNCLKQLSASVPG-VNANNAAALPGKC

Sequence 1 GVSIPYKISTSINCSSIK
           GV--PYKIS-S-NC---K
Sequence 2 GVNVPYKISPSTNCATVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 56.99 (53/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           -I-C--V--S-APC--YL--GG-V---CC-G----N--AKTT-DRQA-CN
Sequence 2 -ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACN

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           CLKSA--S-----N-N-AA-LPGKCGVS-PYKIS-S--C-S-K
Sequence 2 CLKSAFNSIKG-LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 58.06 (54/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           -I-C--V--S-APC--YLK-GG-V---CC--I----G-AKT--DRQA-C-
Sequence 2 -ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACK

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           CLKSAA-S-----N-N-A--LPGKCGVSIPYKIS-S--CSS-K
Sequence 2 CLKSAASSIKG-VNFNLASGLPGKCGVSIPYKISPSTDCSSVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 56.99 (53/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP
           -----------------------AI-C--V----APC---L--GG-----
Sequence 2 MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPA

Sequence 1 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV
           CCSG-----G---TT-DRQA-CNCLK-AA-SL----N--NAA-LPG-CGV
Sequence 2 CCSGVRGLLGALRTTADRQAACNCLKAAAGSLRG-LNQGNAAALPGRCGV

Sequence 1 SIPYKISTSINCSSIK-
           SIPYKISTS-NC--IK-
Sequence 2 SIPYKISTSTNCATIKF



Alignment 20
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 55.91 (52/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------AI-C--VT----PC--YL--G---S
Sequence 2 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G-------A-TT-DRQA-CNCLKSAA-S-----N-NNAA-LPGKC
Sequence 2 PQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSI-TKLNTNNAAALPGKC

Sequence 1 GVSIPYKISTSINCSSIK-
           GV-IPYKIST--NC---K-
Sequence 2 GVNIPYKISTTTNCNTVKF



Alignment 21
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 51.61 (48/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP
           --------------------------C--V-----PC---L--GG-V---
Sequence 2 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG

Sequence 1 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV
           CC-G--NI---A--T-DR---CNCLK-AA-------NPNNA--LPGKCGV
Sequence 2 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG-LNPNNAQALPGKCGV

Sequence 1 SIPYKISTSINCSSIK
           -IPYKISTS-NC-SI-
Sequence 2 NIPYKISTSTNCASIN



Alignment 22
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 55.91 (52/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--C--V----APC--YL------S
Sequence 2 MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNAS

Sequence 1 GP--CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPG
           -P--CC-G-------A-TT-DRQA-CNCLKSAA-S-----N-NNAA-LPG
Sequence 2 PPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSI-PKLNTNNAAALPG

Sequence 1 KCGVSIPYKISTSINCSSIK-
           KCGVSIPYKISTS-NC-----
Sequence 2 KCGVSIPYKISTSTNCNTVRF



Alignment 23
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 54.84 (51/93)
Sequence 1 --------------------------AIQCSFVTKSIAPCFGYLKSGGTV
           --------------------------AI-C--V-----PC--YL-SGG-V
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 SGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGK
           ---CC-G----N--AKTT-DRQA-C-CLK-A--S--S-I---NAASL-GK
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSI-SGIQLGNAASLAGK

Sequence 1 CGVSIPYKISTSINCSSIK
           CGV--PYKIS--I-CS--K
Sequence 2 CGVNLPYKISPTIDCSKVK



Alignment 24
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 53.76 (50/93)
Sequence 1 --------------------------AIQCSFVTKSIAPCFGYLKSGGTV
           --------------------------AI-C--V-----PC---L-SGG-V
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 SGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGK
           ---CC-G----N--AKTT-DRQA-C-CLK-A--S--S-I---NAASL-GK
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSI-SGIQLGNAASLAGK

Sequence 1 CGVSIPYKISTSINCSSIK
           CGV--PYKIS--I-CS--K
Sequence 2 CGVNLPYKISPTIDCSKVK



Alignment 25
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 49.46 (46/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP
           --------------------------C--------PC--YLK-GG-----
Sequence 2 MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS

Sequence 1 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV
           CC-G----N----TTSDRQ--CNCLK--A-------NPN-AA-LPGKCGV
Sequence 2 CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG-LNPNLAAGLPGKCGV

Sequence 1 SIPYKISTSINCSSIK
           -IPYKIS-S-NC---K
Sequence 2 NIPYKISPSTNCNNVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 56.99 (53/93)
Sequence 1 ---------------------------AIQCSFVTKSIAPCFGYLKSGGT
           ---------------------------AI-C--V---IAPC--Y----G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQG-

Sequence 1 VSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAAS
           -SGP---CCSG----N--A-TT-DR-A-CNCLK-AAA---S--N--NAAS
Sequence 2 -SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGV-SGLNAGNAAS

Sequence 1 LPGKCGVSIPYKISTSINCSSIK
           -P-KCGVSIPY-ISTS--CS---
Sequence 2 IPSKCGVSIPYTISTSTDCSRVN



Alignment 27
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 53.76 (50/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKS-GGTVSG
           -----------------------AI-C--V-----PC--YLK--G-T---
Sequence 2 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA

Sequence 1 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG
           -CC-G---IN--AKTT-DR---C-CLKSAA-S-----NP---A-LPGKCG
Sequence 2 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKG-LNPTTVAGLPGKCG

Sequence 1 VSIPYKISTSINCSSIK
           V-IPYKIS-S-NC---K
Sequence 2 VNIPYKISLSTNCATVK



Alignment 28
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 56.99 (53/93)
Sequence 1 ---------------------------AIQCSFVTKSIAPCFGYLKSGGT
           ---------------------------AI-C--V---IAPC--Y----G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQG-

Sequence 1 VSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAAS
           -SGP---CCSG----N--A-TT-DR-A-CNCLK-AAA---S--N--NAAS
Sequence 2 -SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGV-SGLNAGNAAS

Sequence 1 LPGKCGVSIPYKISTSINCSSIK--------
           -P-KCGVSIPY-ISTS--CS-----------
Sequence 2 IPSKCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 29
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 55.91 (52/93)
Sequence 1 ---------------------------AIQCSFVTKSIAPCFGYLKS-GG
           ---------------------------A--C--V--S-APC--Y--S-GG
Sequence 2 MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGG

Sequence 1 TVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLP
           -V---CCSGI----G-A-TT-DRQA-C-CLKSA--S--S-IN----ASLP
Sequence 2 AVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSI-SGINYGLVASLP

Sequence 1 GKCGVSIPYKISTSINCSSIK
           -KCGV-IPYKIS-S--C---K
Sequence 2 AKCGVNIPYKISPSTDCARVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 50.54 (47/93)
Sequence 1 ------------------------AIQCSFVTKSIAPCFGYLKSGGTVSG
           ------------------------A--CS-V---I-PC--YLK-GG-V--
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG
           -CC-G----N--AKTT-DRQ--CNCLK----S---------AASLP-KCG
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-NKDLKSDFAASLPSKCG

Sequence 1 VSIPYKISTSINCSSIK
           V-IPYKIS----C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 50.54 (47/93)
Sequence 1 ------------------------AIQCSFVTKSIAPCFGYLKSGGTVSG
           ------------------------A--CS-V---I-PC--YLK-GG-V--
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG
           -CC-G----N--AKTT-DRQ--CNCLK----S---------AASLP-KCG
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-NKDLKSDFAASLPSKCG

Sequence 1 VSIPYKISTSINCSSIK
           V-IPYKIS----C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 32
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 50.54 (47/93)
Sequence 1 ------------------------AIQCSFVTKSIAPCFGYLKSGGTVSG
           ------------------------A--CS-V---I-PC--YLK-GG-V--
Sequence 2 MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPA

Sequence 1 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG
           -CC-G----N--AKTT-DRQ--CNCLK----S---------AASLP-KCG
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-NKDLKSDFAASLPSKCG

Sequence 1 VSIPYKISTSINCSSIK
           V-IPYKIS----C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 33
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 50.54 (47/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--CS-V---I-PC---LK-GG-VS
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G----N--AKTT-DRQA-CNCLK----S--------NA--LP-KC
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKS-NKDFKSDNAVVLPSKC

Sequence 1 GVSIPYKISTSINCSSIK
           GV-IPYKIS----C---K
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 34
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 50.54 (47/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--CS-V---I-PC---LK-GG-VS
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G----N--AKTT-DRQA-CNCLK----S--------NA--LP-KC
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKS-NKDFKSDNAVVLPSKC

Sequence 1 GVSIPYKISTSINCSSIK
           GV-IPYKIS----C---K
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 35
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 50.54 (47/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--C--VTK-I-PC---L--GG-V-
Sequence 2 MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G----N--AKTT-DRQA-CNCLK----S--------NAA-LP-KC
Sequence 2 VDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKS-SNNFKEENAAVLPSKC

Sequence 1 GVSIPYKISTSINCSSIK
           GV-IPYKIS----C---K
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 36
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 49.46 (46/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--CS-V---I-PC---LK-GG-V-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G----N--AKTT-DRQ--CNCLK----S--------NAA-LP-KC
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-NKDFKSDNAAVLPSKC

Sequence 1 GVSIPYKISTSINCSSIK
           GV-IPYKIS----C---K
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 37
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 48.39 (45/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--CS-V---I-PC---LK-GG-V-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G----N--AKTT-DRQ--CNCLK----S--------NA--LP-KC
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKS-NKDLKSDNAVVLPSKC

Sequence 1 GVSIPYKISTSINCSSIK
           GV-IPYKIS----C---K
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 38
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 49.46 (46/93)
Sequence 1 ----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGPC
           ----------------------A--CS-V---I--C--YLK-GG-V---C
Sequence 2 MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADC

Sequence 1 CSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGVS
           C-G----N--AKTT-DRQ--CNCLK----S---------AASLP-KCGV-
Sequence 2 CTGVKGLNDAAKTTPDRQTACNCLKTTFKS-NKDFKSDFAASLPSKCGVN

Sequence 1 IPYKISTSINCSSIK
           IPYKIS----C---K
Sequence 2 IPYKISLETDCNKVK



Alignment 39
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 49.46 (46/93)
Sequence 1 ------------------------AIQCSFVTKSIAPCFGYLKSGGTVSG
           ------------------------A--CS-V---I--C--YLK-GG-V--
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG
           -CC-G----N--AKTT-DRQ--CNCLK----S---------AASLP-KCG
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKS-NKDFKSDFAASLPSKCG

Sequence 1 VSIPYKISTSINCSSIK
           V-IPYKIS----C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 40
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 49.46 (46/93)
Sequence 1 ------------------------AIQCSFVTKSIAPCFGYLKSGGTVSG
           ------------------------A--CS-V---I--C--YLK-GG-V--
Sequence 2 MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG
           -CC-G----N--AKTT-DRQ--CNCLK----S---------AASLP-KCG
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKS-NKDFKSDFAASLPSKCG

Sequence 1 VSIPYKISTSINCSSIK
           V-IPYKIS----C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 41
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 46.24 (43/93)
Sequence 1 -----------------------------AIQCSFVTKSIAPCFGYLKSG
           -----------------------------A--C--V-----PC--Y---G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG-SQINPNNAAS
           G-----CC-G-------A-TT-DRQ--CNCLK-A---------N---AA-
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 LPGKCGVSIPYKISTSINCSSIK
           LPGKCGV-IPYKIS-S--C--IK
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK



Alignment 42
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 53.76 (50/93)
Sequence 1 ---------------------------AIQCSFVTKSIAPCFGYLKSGGT
           ---------------------------A--C--VT-S--PC--Y----G-
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR--GV

Sequence 1 VSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAAS
           V--P---CCSG----N--AKTT-DRQ--CNCLK--A-S----IN------
Sequence 2 VAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSI-TGINYGRVGA

Sequence 1 LPGKCGVSIPYKISTSINCSSIK
           LPGKCGVSIPYKIS-S--CS--K
Sequence 2 LPGKCGVSIPYKISPSTDCSRVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 47.31 (44/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--CS-V---I-PC---LK-GG-V-
Sequence 2 MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G----N--AKT--DRQ--CNCLK----S--------NA--LP-KC
Sequence 2 ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKS-NKDLKSDNAVVLPSKC

Sequence 1 GVSIPYKISTSINCSSIK
           GV-IPYKIS----C---K
Sequence 2 GVNIPYKISLETDCNTVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 45.16 (42/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLK-SGGTV
           -------------------------A--C--V-----PC--Y----G---
Sequence 2 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP

Sequence 1 SGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGK
           S--CCSG-------A--T-D-QA-C-C-KSAAA-L----N---AA--P-K
Sequence 2 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGL----NAGKAAGIPTK

Sequence 1 CGVSIPYKISTSINCSSIK
           CGVS-PY-IS-S--CS-I-
Sequence 2 CGVSVPYAISSSVDCSKIR



Alignment 45
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 48.39 (45/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP
           --------------------------C--VT---APC--YL---G---G-
Sequence 2 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGG-

Sequence 1 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV
           CC-G-----G-AKT--DR---C-CLKSAA-S----I----AA-LPG-CGV
Sequence 2 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG-IDTGKAAGLPGVCGV

Sequence 1 SIPYKISTSINCSSIK
           -IPYKIS-S--CS---
Sequence 2 NIPYKISPSTDCSTVQ



Alignment 46
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 48.39 (45/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP
           --------------------------C--VT---APC--YL---G---G-
Sequence 2 MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGG-

Sequence 1 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV
           CC-G-----G-AKT--DR---C-CLKSAA-S----I----AA-LPG-CGV
Sequence 2 CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG-IDTGKAAGLPGVCGV

Sequence 1 SIPYKISTSINCSSIK
           -IPYKIS-S--CS---
Sequence 2 NIPYKISPSTDCSTVQ



Alignment 47
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 45.16 (42/93)
Sequence 1 ------------------------AIQCSFVTKSIAPCFGYLKSGGTVSG
           ------------------------A--CS-V---I-PC--YLK-GG-V--
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPA

Sequence 1 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG
           -CC-G----N--AKTT-DRQ--C-CLK--------------A--LP-KCG
Sequence 2 NCCAGVKGLNDAAKTTPDRQTACTCLKNSFKT-NKDLKSDYAVPLPSKCG

Sequence 1 VSIPYKISTSINCSSIK
           V-IPYK-S----C---K
Sequence 2 VTIPYKLSMETDCNKVK



Alignment 48
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 52.69 (49/93)
Sequence 1 --------------------------AIQCSFVTKSIAPCFGYLKSGGTV
           ---------------------------I-C--V--S-A-C--Y----G--
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 SGP--CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLP
           --P--CC-GI---N--AKTT-DRQA-C-CLKS-A-S--S-IN----A--P
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI-SGINYGLVAGAP

Sequence 1 GKCGVSIPYKISTSINCSSIK
           GKCGVSIPYKI--S-NC---K
Sequence 2 GKCGVSIPYKIAPSTNCDNVK



Alignment 49
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 44.09 (41/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP
           -----------------------A--CS-V---I-PC--YLK-GG-V---
Sequence 2 MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPAD

Sequence 1 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV
           CC-G----N---KTT-DRQ--CNCLK----S---------A--LP-KCG-
Sequence 2 CCTGVKGLNDATKTTPDRQTACNCLKASFKS-NKDLKSDFAVPLPSKCGL

Sequence 1 SIPYKISTSINCSSIK
           --PYK-S----C---K
Sequence 2 NLPYKLSLETDCNKVK



Alignment 50
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 44.09 (41/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--CS-V---I-PC--YLK-GG-V-
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G----N---KTT-DRQ--CNCLK----S---------A--LP-KC
Sequence 2 ADCCTGVKGLNDATKTTPDRQTACNCLKASFKS-NKDLKSDFAVPLPSKC

Sequence 1 GVSIPYKISTSINCSSIK
           G---PYK-S----C---K
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 51
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 43.01 (40/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           -I-C--V-----PC--Y---G---SG-CC-G--N----A---SDRQ--CN
Sequence 2 -IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACN

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           CLK--A-------N--NA-S-P-KCGV--PY-IS--I-CS---
Sequence 2 CLKGIARGIHN-LNEDNARSIPPKCGVNLPYTISLNIDCSRV-



Alignment 52
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 47.31 (44/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           A--C--V----A-C-GYL---------CC-G--N-N--A-TT-DRQ--C-
Sequence 2 ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACR

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           CL--AA-S--S--N---AA-LP--CGV-IPYKIS-S-NC-S--
Sequence 2 CLVGAANSFPS-LNAARAAALPKACGVNIPYKISKSTNCNSVR



Alignment 53
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 44.09 (41/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--C--V-----PC--Y---G---S
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           G-CC-G-------A----DRQ-VCNCLK--A-------N-NNAAS-P-KC
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN-LNLNNAASIPSKC

Sequence 1 GVSIPYKISTSINCSSIK
           -V--PY-IS--I-CS-I-
Sequence 2 NVNVPYTISPDIDCSRIY



Alignment 54
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 46.24 (43/93)
Sequence 1 --------------------------AIQCSFVTKSIAPCFGYLKSGGTV
           -----------------------------C--VT-----C-GYLK-GG--
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP

Sequence 1 SGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGK
           S--CC-G----N--AKT--DR---C-CLK--A-S----IN---A--LPGK
Sequence 2 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKG-INYGAASALPGK

Sequence 1 CGVSIPYKISTSINCSSIK
           CG--IPY-IS-S--CS---
Sequence 2 CGIRIPYPISPSTDCSRVN



Alignment 55
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 43.01 (40/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------A--C--V-----PC--Y---G---S
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           G-CC-G-------A----DRQ-VCNCLK--A-------N-NNAAS-P-KC
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN-LNLNNAASIPSKC

Sequence 1 GVSIPYKISTSINCSSIK-----------------
           -V--PY-IS--I-CS--------------------
Sequence 2 NVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 56
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 41.94 (39/93)
Sequence 1 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS
           -------------------------AI-C--VT----PC--YL-SGG---
Sequence 2 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT

Sequence 1 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC
           --CC-G-----G---T--DR---C-C-K-AA--L-----P--A-SLPGKC
Sequence 2 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQL--KVRPDMASSLPGKC

Sequence 1 GVSIPYKISTSINCSSIK
           G-S----I----NC--I-
Sequence 2 GISTSIPINPNVNCNTIP



Alignment 57
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 40.86 (38/93)
Sequence 1 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP
           -----------------------AI-C--V----APC---L--GG-----
Sequence 2 MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAA

Sequence 1 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV
           CCSG----NG------DR---CNC-K-AAA----------A-SLP-KCG-
Sequence 2 CCSGVRTLNGNTQSSDDRRTACNCVK-AAANRYPNLKDDAAQSLPSKCGI

Sequence 1 SIPYKISTSINCSSIK
           S----IS---NC--I-
Sequence 2 SLTVPISRTVNCDTIS



Alignment 58
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 35.48 (33/93)
Sequence 1 --------------------------AIQCSFVTKSIAPCFGYLKSGGTV
           -----------------------------C--V----APC-G-L--G---
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFL-TGQEP

Sequence 1 SGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGK
           S--CC-G--N-N---KT--DR-AVCNC-K----S------P-----L--K
Sequence 2 SKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA--YDPKRMPLLSTK

Sequence 1 CGVSIPYK-ISTSINCSSIK-
           CGV------------CS----
Sequence 2 CGVKPDFPAVDKNLDCSKLPV



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 32.26 (30/93)
Sequence 1 -------------------------------AIQCSFVTKSIAPCFGYLK
           ----------------------------------C--V---I-PC----K
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 SGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPN
           --G----P---CCSG--------KTT------C-C---A-----S-I---
Sequence 2 --GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGI-SGIKNE

Sequence 1 NAASLPGKCGV--SIPYKISTSINCSSIK--------
           --A--P-KCG-----P--I-----CS-I---------
Sequence 2 LVAEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 31.18 (29/93)
Sequence 1 -------------------------------AIQCSFVTKSIAPCFGYLK
           ----------------------------------C--V---I-PC----K
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 SGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPN
           --G----P---CCSG--------KTT------C-C---A-----S-I---
Sequence 2 --GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGI-SGIKNE

Sequence 1 NAASLPGKCGV--SIPYKISTSINCSSIK--------
           --A--P-KC------P--I-----CS-I---------
Sequence 2 LVAEVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 25.81 (24/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQA
           ---C--------PC-------G----P---CCSG-----G--KT---R--
Sequence 2 QETCGTMVRALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGPQRVH

Sequence 1 VCNCLKSAAASLGSQINPNNAASLPGKCGV---SIPYKISTSINCSSIK-
           -C-C---A-----S-I--------P--CG------P--I-----C-----
Sequence 2 ACECIQTAMKTY-SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTVGV

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 VPRQPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 26.88 (25/93)
Sequence 1 -------------------------------------AIQCSFVTKSIAP
           ----------------------------------------C--V-----P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG
           C-------G----P---CCSG-----G--KT---R---C-C---A-----
Sequence 2 CLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTY-

Sequence 1 SQINPNNAASLPGKCGV---SIPYKISTSINCSSIK--------------
           S-I--------P--CG------P--I-----C------------------
Sequence 2 SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRH

Sequence 1 ------------------------------
           ------------------------------
Sequence 2 GPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 25.81 (24/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQA
           ---C--------PC-------G----P---CCSG-----G--KT---R--
Sequence 2 QETCGTMVRALMPCLPFVQ--GKEKEPSKGCCSGAKRLDGETKTGPQRVH

Sequence 1 VCNCLKSAAASLGSQINPNNAASLPGKCGV---SIPYKISTSINCSSIK-
           -C-C---A-----S-I--------P--CG------P--I-----C-----
Sequence 2 ACECIQTAMKTY-SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGV

Sequence 1 -------------------------------------------
           -------------------------------------------
Sequence 2 VPRQPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 26.88 (25/93)
Sequence 1 ------------------------------------AIQCSFVTKSIAPC
           ---------------------------------------C--V-----PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 FGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS
           -------G----P---CCSG-----G--KT---R---C-C---A-----S
Sequence 2 LPFVQ--GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY-S

Sequence 1 QINPNNAASLPGKCGV---SIPYKISTSINCSSIK-------
           -I--------P--CG------P--I-----C-----------
Sequence 2 DIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 23.66 (22/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSG-GTVSGPCCSGIQNINGTAKTTSDRQAVC
           ------------PC-----------S--CCSG-----G--KT---R---C
Sequence 2 ------MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHAC

Sequence 1 NCLKSAAASLGSQINPNNAASLPGKCGV---SIPYKISTSINCSSIK---
           -C---A-----S-I--------P--CG------P--I-----C-------
Sequence 2 ECIQTAMKTY-SDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTVGVVP

Sequence 1 -----------------------------------------
           -----------------------------------------
Sequence 2 RQPQLPVSLRHGPVTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 18.28 (17/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCN
           A--CS-V---I-PC--YLK-GG-V---CC-G----N--------------
Sequence 2 ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND-------------

Sequence 1 CLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           -------------------------------------------
Sequence 2 -------------------------------------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 18.28 (17/93)
Sequence 1 AIQCSFVTKSIAPCFGYLKS-GGTVS-GPCCSGIQNINGTAKTTSDRQAV
           -I-C--V-KS--PC--YLKS-GG----G-CC-G-----------------
Sequence 2 SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVKL--------------

Sequence 1 CNCLKSAAASLGSQINPNNAASLPGKCGVSIPYKISTSINCSSIK
           ---------------------------------------------
Sequence 2 ---------------------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.