The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Alt a 15.0101

Sequence A0A0F6N3V8_ALTAL

Full FASTA alignment

Sequence name:
Query sequence:
PQRQMDSAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKNNEERMELRKR
SSQFPVTTEVFDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERD
SEVHTLGHDEPEIEKNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDV
YVIDTGTNTKHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYG
VAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGF
KGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAA
ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISG
TSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGALS
DVPRNTKNILAWNGGGSSNYTEIVEKGGYTVKKAAEKNEEESEFRITIPS
LSEIEDDFEKAKESAGRNAHRVGGKLQHLEAEIEDFIAEEMESMFEKVKE
RVASQKL

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Alt a 15.0101A0A0F6N3V8Go!507614.93.3e-177
2Cur l 4.0101ACF19589Go!506529.31.9e-151
3Cla h 9.0101AAX14379Go!518420.11.5e-118
4Pen o 18AAG44478Go!503404.57.4e-114
5Asp f 18.0101Y13338Go!495393.41.6e-110
6Pen ch 18AAF71379Go!494392.62.6e-110
7Cla c 9.0101ABQ59329Go!388355.23.7e-99
8Fus p 9.0101A0A0U1Y1N5Go!386328.54.1e-91
9Rho m 2.0101Q32ZM1Go!342268.73.8e-73
10Tri r 2.0101AAD52013Go!412149.92.5e-37
11Pen ch 13AAF23726Go!397104.11.5e-23
12Asp v 13.0101ADE74975Go!40393.82.0e-20
13Asp f 13P28296Go!40392.83.8e-20
14Asp o 13CAA35594Go!40387.81.3e-18
15Asp fl proteaseAAD47202Go!40387.81.3e-18
16Pen c 13.0101AAD25926Go!39775.46.7e-15

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Alt a 15.0101, Sequence: A0A0F6N3V8
Sequence identity: 100.00 (507/507)
Sequence 1 PQRQMDSAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKNNEERMELRKR
           PQRQMDSAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKNNEERMELRKR
Sequence 2 PQRQMDSAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKNNEERMELRKR

Sequence 1 SSQFPVTTEVFDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERD
           SSQFPVTTEVFDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERD
Sequence 2 SSQFPVTTEVFDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERD

Sequence 1 SEVHTLGHDEPEIEKNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDV
           SEVHTLGHDEPEIEKNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDV
Sequence 2 SEVHTLGHDEPEIEKNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDV

Sequence 1 YVIDTGTNTKHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYG
           YVIDTGTNTKHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYG
Sequence 2 YVIDTGTNTKHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYG

Sequence 1 VAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGF
           VAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGF
Sequence 2 VAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGF

Sequence 1 KGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAA
           KGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAA
Sequence 2 KGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAA

Sequence 1 ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISG
           ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISG
Sequence 2 ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISG

Sequence 1 TSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGALS
           TSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGALS
Sequence 2 TSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGALS

Sequence 1 DVPRNTKNILAWNGGGSSNYTEIVEKGGYTVKKAAEKNEEESEFRITIPS
           DVPRNTKNILAWNGGGSSNYTEIVEKGGYTVKKAAEKNEEESEFRITIPS
Sequence 2 DVPRNTKNILAWNGGGSSNYTEIVEKGGYTVKKAAEKNEEESEFRITIPS

Sequence 1 LSEIEDDFEKAKESAGRNAHRVGGKLQHLEAEIEDFIAEEMESMFEKVKE
           LSEIEDDFEKAKESAGRNAHRVGGKLQHLEAEIEDFIAEEMESMFEKVKE
Sequence 2 LSEIEDDFEKAKESAGRNAHRVGGKLQHLEAEIEDFIAEEMESMFEKVKE

Sequence 1 RVASQKL
           RVASQKL
Sequence 2 RVASQKL



Alignment 2
Sequence 1:
Sequence 2: Allergen Cur l 4.0101, Sequence: ACF19589
Sequence identity: 84.62 (429/507)
Sequence 1 -----------------------------PQRQMDSAKEVPNSYMVVFKK
           -----------------------------P-----SAKEVPNSYMVVFKK
Sequence 2 MKYSLIAALPALAAASPTFSTETIHKQSAPVLSSTSAKEVPNSYMVVFKK

Sequence 1 HVKDASKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYEMA
           HVKDASKHHDWVQSVHSKN--ERMELRKRSS--PV--EVF-GLKH-YE--
Sequence 2 HVKDASKHHDWVQSVHSKNTQERMELRKRSSDLPVSNEVFAGLKHTYELS

Sequence 1 GMKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPWGL
           G-KGYSGHFDDET-EAIRNHPDVDYIERDSEV--LG-DEPE-E-NSPWGL
Sequence 2 GLKGYSGHFDDETLEAIRNHPDVDYIERDSEVRILGGDEPETENNSPWGL

Sequence 1 ARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWG
           ARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTN--HVDFEGRAKWG
Sequence 2 ARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNVDHVDFEGRAKWG

Sequence 1 KTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTM
           KTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTM
Sequence 2 KTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTM

Sequence 1 SDVVKGVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLDLAV
           SDVVKGVE-AAK-HS--V-AAK-GKKKGFKGS-ANMSLGGGKSTTLD-AV
Sequence 2 SDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAV

Sequence 1 NAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNY
           NAAVDAG-HFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNY
Sequence 2 NAAVDAGLHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNY

Sequence 1 GKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSLQPA
           GKCNDIFAPGLNILSTWIGS-HATNTISGTSMASPHIAGLLAYMLSLQPA
Sequence 2 GKCNDIFAPGLNILSTWIGSKHATNTISGTSMASPHIAGLLAYMLSLQPA

Sequence 1 KDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNYT
           KDSAYAVADITPKKLKANLI---TVGALSDVP-NT-N-LAWNGGGSSNYT
Sequence 2 KDSAYAVADITPKKLKANLIAIGTVGALSDVPSNTANVLAWNGGGSSNYT

Sequence 1 EIVEKGGYTVKKAAEKNEE-ESEFRITIPSLSEIEDDFEKAKESAGRNAH
           -I-EKGGYTVKKAA-K-EE-ESEFRITIPSLSE-EDDFEKAKESAGR-AH
Sequence 2 DIIEKGGYTVKKAASKEEEKESEFRITIPSLSELEDDFEKAKESAGRKAH

Sequence 1 RVGGKLQHLEAEIEDFIAEEMESMFEKVKERVASQKL
           -VGGKL-------------------------------
Sequence 2 HVGGKL-------------------------------



Alignment 3
Sequence 1:
Sequence 2: Allergen Cla h 9.0101, Sequence: AAX14379
Sequence identity: 69.23 (351/507)
Sequence 1 -----------------------------PQRQMDSAKEVPNSYMVVFKK
           -----------------------------P------AKE----YM--FK-
Sequence 2 MRGALAGLSLATLATASPVLVNSIHNDAAPIISASNAKEIADNYMIKFKD

Sequence 1 HVKD--ASKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYE
           HV----A--HH-WVQ--H-K------ELRKRS-Q-P-----F-GLKH-Y-
Sequence 2 HVTQNLAAEHHGWVQDLHEKTQVAKTELRKRS-QSPMVDDIFNGLKHTYN

Sequence 1 MAG-MKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSP
           -AG---GY-GHFD---IE-IR-HPDV---ERD-EVH-LG--E-E-EKN-P
Sequence 2 IAGGLMGYAGHFDEDVIEQIRRHPDVELVERDQEVHVLG-SESEVEKNAP

Sequence 1 WGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRA
           WGLARISHRDSLSFGT-NKYLY--DGGEGVDVYV-DTGTN--HVDFEGRA
Sequence 2 WGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRA

Sequence 1 KWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGS
           -WGKTIP-GDADEDGNGHGTHCSGTVAGKKYGVAKKAHV-AVKVLRSNGS
Sequence 2 SWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGS

Sequence 1 GTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLD
           G-MSDVVKGVEYAA--H---V---K-GK-KGFKGS-ANMSLGGGKS--LD
Sequence 2 GSMSDVVKGVEYAAESHLEQVSITKKGKRKGFKGSTANMSLGGGKSPILD

Sequence 1 LAVNAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYF
           -AVNAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTL-DERAYF
Sequence 2 KAVNAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLADERAYF

Sequence 1 SNYGKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSL
           SNYGKCNDIFAPGLNI-STWIGS--A-NTISGTSMASPH-AGLLAY-LSL
Sequence 2 SNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSMASPHVAGLLAYLLSL

Sequence 1 QPAKDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSS
           QPAKDSA-AVADI-PKKLKANLIS-ATVGAL-DVP-NT-NILAWNGGG-S
Sequence 2 QPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWNGGGES

Sequence 1 NYTEIVEKGGYTVKKAAEKNEEESEFRITIPS-LSEIEDDFEKAKESAGR
           NY--IVEKGGY---KA--------------P--L-EIE-----A------
Sequence 2 NYSAIVEKGGY---KATHR-----------PTMLEEIESEAKVASKKVYS

Sequence 1 NAHRVGGKLQHLEAEIEDFIAEEMESMFEKVKERVASQKL
           -------K---L----ED-IA-E---MF---K--------
Sequence 2 EGDELAHKVAELTEKVEDLIAGELKDMFRELKRE------



Alignment 4
Sequence 1:
Sequence 2: Allergen Pen o 18, Sequence: AAG44478
Sequence identity: 65.48 (332/507)
Sequence 1 -----------------------------PQRQMDSAKEVPNSYMVVFKK
           -----------------------------P-----SAKE-P-SY-VVFKK
Sequence 2 MKGLLSLTLLPLLAAASPTWSETIHNGAAPLISSTSAKEIPDSYIVVFKK

Sequence 1 HV--KDASKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYE
           HV----AS-HH-WVQ--HS-N---RMEL-KRS--F----E---G-KH---
Sequence 2 HVGASAASAHHSWVQDIHSDNV--RMELKKRS-LFGFESEPYLGVKHTFH

Sequence 1 MAG-MKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSP
           -AG---GY-GHF----IE--R-HPDV-YIE-DSEVH------P-IEKN-P
Sequence 2 VAGSLMGYAGHFHEDVIEQVRRHPDVEYIEKDSEVHHF--EDPAIEKNAP

Sequence 1 WGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRA
           WGLARISHRDSLSFG--NKYLYA-DGGEGVD-YVIDTGTN--HVDFEGRA
Sequence 2 WGLARISHRDSLSFGSFNKYLYAEDGGEGVDAYVIDTGTNVDHVDFEGRA

Sequence 1 KWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGS
           -WGKTIP-GD-D-DGNGHGTHCSGT-AGKKYGVAKKA-VYAVKVLRSNGS
Sequence 2 SWGKTIPQGDQDVDGNGHGTHCSGTIAGKKYGVAKKANVYAVKVLRSNGS

Sequence 1 GTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLD
           GTMSDVVKGVE-AA-AH-----AAKDGK-KGFKGS-ANMSLGGG-S-TLD
Sequence 2 GTMSDVVKGVEWAAEAHIKKSKAAKDGKAKGFKGSVANMSLGGGSSRTLD

Sequence 1 LAVNAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYF
           LAVNAAVDAG-HFAVAAGNDNAD-CNYSPAAAE-AVTVGASTL-DERAYF
Sequence 2 LAVNAAVDAGMHFAVAAGNDNADACNYSPAAAEKAVTVGASTLADERAYF

Sequence 1 SNYGKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSL
           SNYGKC-DIFAPGLNILSTWIGS--A-NTISGTSMASPHIAGLLAY--SL
Sequence 2 SNYGKCTDIFAPGLNILSTWIGSKYAVNTISGTSMASPHIAGLLAYYVSL

Sequence 1 QPAKDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSS
           QPA-DSAYAV--ITPKKLK--LI--AT-GALSD-P--T-N-LAWNGGGSS
Sequence 2 QPASDSAYAVEEITPKKLKDALITIATSGALSDIPSDTPNLLAWNGGGSS

Sequence 1 NYTEIVEKGGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRN
           NYTEIV-KGGY-------------E-----------E---------A---
Sequence 2 NYTEIVSKGGYKAGASESMKKHLDELVGKVEEVIAKEQKVLSHELGAIYS

Sequence 1 AHRVGGKLQHLEAEIEDFIAEEMESMFEKVKERVASQKL
           ---------------------------------------
Sequence 2 EIKDAVSA-------------------------------



Alignment 5
Sequence 1:
Sequence 2: Allergen Asp f 18.0101, Sequence: Y13338
Sequence identity: 62.13 (315/507)
Sequence 1 -----------------------------PQRQMDSAKEVPNSYMVVFKK
           -----------------------------P------AKEVP-SY-VVFKK
Sequence 2 MKGYLSLSILPLLVAASPVVVDSIHNGAAPILSSMNAKEVPDSYIVVFKK

Sequence 1 HV--KDASKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYE
           HV----A--HH-WVQ--HS--NE-R-ELRKRS--F----E---GLK----
Sequence 2 HVNAESAAAHHSWVQDIHSAQNE-RVELRKRS-LFGFGEEAYLGLKNTFD

Sequence 1 MAG-MKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSP
           -AG---GYSGHF----IE--R-HPDV-YIE-DSEVHT-----P--EK--P
Sequence 2 IAGSLVGYSGHFHEDVIEQVRKHPDVEYIEKDSEVHTM--EDPTVEKSAP

Sequence 1 WGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRA
           WGLARISHRDSLSFGT-NKYLYA--GGEGVD-Y-IDTG-N--HVDFEGRA
Sequence 2 WGLARISHRDSLSFGTFNKYLYASEGGEGVDAYTIDTGINVDHVDFEGRA

Sequence 1 KWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGS
           -WGKTIP--D-D-DGNGHGTHCSGT-AG-KYGVAKKA--YAVKVLRS-GS
Sequence 2 QWGKTIPTDDEDADGNGHGTHCSGTIAGRKYGVAKKANLYAVKVLRSSGS

Sequence 1 GTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLD
           GTMSDVV-GVE-A-K-H---V--AKDGK-KGFKGS-ANMSLGGGKS-TL-
Sequence 2 GTMSDVVAGVEWAVKSHLKKVKDAKDGKIKGFKGSVANMSLGGGKSRTLE

Sequence 1 LAVNAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYF
           -AVNA-V-AG-HFAVAAGNDNAD-CNYSPAAAEN--TVGASTL-DERAYF
Sequence 2 AAVNAGVEAGLHFAVAAGNDNADACNYSPAAAENPITVGASTLQDERAYF

Sequence 1 SNYGKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSL
           SNYGKC-DIFAPGLNILSTWIGS-HA-NTISGTSMASPHIAGLLAY--SL
Sequence 2 SNYGKCTDIFAPGLNILSTWIGSKHAVNTISGTSMASPHIAGLLAYFVSL

Sequence 1 QPAKDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSS
           QP-KDSA-AV---TPKKLK---I--AT-GAL-D-P--T-N-LAWNGGGSS
Sequence 2 QPSKDSAFAVDELTPKKLKKDIIAIATQGALTDIPSDTPNLLAWNGGGSS

Sequence 1 NYTEIVEKGGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRN
           NYT-I---GGY-V--------E------------E-----------A---
Sequence 2 NYTDIIASGGYKVNASVKDRFEGLVHKAEKLLTEELGAIYSEIHDAAVA-

Sequence 1 AHRVGGKLQHLEAEIEDFIAEEMESMFEKVKERVASQKL
           ---------------------------------------
Sequence 2 ---------------------------------------



Alignment 6
Sequence 1:
Sequence 2: Allergen Pen ch 18, Sequence: AAF71379
Sequence identity: 65.09 (330/507)
Sequence 1 -----------------------------PQRQMDSAKEVPNSYMVVFKK
           -----------------------------P-------K--P-SY-VVFKK
Sequence 2 MKGFLSLTLLPLLVAASPVAVNSIHNDAAPILSSMTSKDIPDSYIVVFKK

Sequence 1 HV--KDASKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYE
           HV----AS-H--W-Q-VH------RMEL-KRS--F----E-F-GLKH---
Sequence 2 HVDPSSASAHQSWLQEVHTAHTG-RMELKKRS-LFGFDFEAFMGLKHTFH

Sequence 1 MAG-MKGYSGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSP
           -AG---GY-GHF----IE-IR-HPDVDYIE-DSEV-T----E---EKN-P
Sequence 2 IAGSLLGYAGHFHEDVIEQIRRHPDVDYIEKDSEVRTMS--EGSVEKNAP

Sequence 1 WGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRA
           WGLARISHR-SLSFG--NKYLYA--GGEGVD-YVIDTG-N-KHVDFEGRA
Sequence 2 WGLARISHRESLSFGNFNKYLYAEEGGEGVDAYVIDTGANVKHVDFEGRA

Sequence 1 KWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGS
           -WGKTIP-GDADEDGNGHGTHCSGT-AGKK-GVAKKA-VYAVKVLRSNGS
Sequence 2 NWGKTIPQGDADEDGNGHGTHCSGTIAGKKFGVAKKANVYAVKVLRSNGS

Sequence 1 GTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLD
           GTMSDVVKGVE-AA-AH-------K-G-KK-FKGS-ANMSLGGG-S-TLD
Sequence 2 GTMSDVVKGVEWAAEAH---IKKSKKGDKK-FKGSVANMSLGGGSSRTLD

Sequence 1 LAVNAAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYF
           LAVNAAVDAGIHFAVAAGNDNAD-CNYSPAAAE-A-TVGASTL-DERAYF
Sequence 2 LAVNAAVDAGIHFAVAAGNDNADACNYSPAAAEKAITVGASTLADERAYF

Sequence 1 SNYGKCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSL
           SNYGKC-DIFAPGLNILSTW-GS-HATNTISGTSMASPHIAGLLAY--SL
Sequence 2 SNYGKCTDIFAPGLNILSTWVGSDHATNTISGTSMASPHIAGLLAYYVSL

Sequence 1 QPAKDSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSS
           -PAKDSAYAVAD-TPK-LKA-LISVAT-G-L-D-P--T-N-LAWNGGGS-
Sequence 2 APAKDSAYAVADVTPKQLKAALISVATEGTLTDIPSDTPNLLAWNGGGSA

Sequence 1 NYTEIVEKGGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRN
           NYT-I---GGY----A----E---E-RI-I-----I-D--EKA-------
Sequence 2 NYTKILADGGYKAHNA----ETTVEDRIGI-----IIDSAEKAFHKELGA

Sequence 1 AHRVGGKLQHLEAEIEDFIAEEMESMFEKVKERVASQKL
           ---------------------------------------
Sequence 2 IYSEIKDAVSV----------------------------



Alignment 7
Sequence 1:
Sequence 2: Allergen Cla c 9.0101, Sequence: ABQ59329
Sequence identity: 59.57 (302/507)
Sequence 1 PQRQMDSAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKNNEERMELRKR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SSQFPVTTEVFDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERD
           -------------------------------------------------D
Sequence 2 -------------------------------------------------D

Sequence 1 SEVHTLGHDEPEIEKNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDV
           -EVH-L---E-E-EKN-PWGLARISHRDSLSFGT-NKYLY--DGGEGVDV
Sequence 2 QEVHVL-KSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDV

Sequence 1 YVIDTGTNTKHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYG
           YV-DTGTN--HVDFEGRA-WGKTIP-GDADEDGNGHGTHCSGTVAGKKYG
Sequence 2 YVVDTGTNVDHVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYG

Sequence 1 VAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGF
           VAKKAHV-AVKVLRSNGSG-MSDVVKGVEYAA--H---V--AK-GK-KGF
Sequence 2 VAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAESHLEQVSIAKKGKRKGF

Sequence 1 KGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAA
           KGS-ANMSLGGGKS--LD-AVNAAVDAGIHFAVAAGNDNADSCNYSPAAA
Sequence 2 KGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSCNYSPAAA

Sequence 1 ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISG
           ENAVTVGASTL-DERAYFSNYGKCNDIFAPGLNI-STWIGS--A-NTISG
Sequence 2 ENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISG

Sequence 1 TSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGALS
           TSMASPH-AGLLAY-LSLQPAKDSA-AVADI-PKKLKANLIS-ATVGAL-
Sequence 2 TSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT

Sequence 1 DVPRNTKNILAWNGGGSSNYTEIVEKGGYTVKKAAEKNEEESEFRITIPS
           DVP-NT-NILAWNGGG-SNY--IVEKGGY---KAA---------R-T---
Sequence 2 DVPSNTANILAWNGGGESNYSAIVEKGGY---KAA--------VRPTM--

Sequence 1 LSEIEDDFEKAKESAGRNAHRVGGKLQHLEAEIEDFIAEEMESMFEKVKE
           L-EIE-----A-------------K---L---IED-I------MF---K-
Sequence 2 LEEIESEAKVASKKVYSEGDELAKKVAELTEKIEDLISGDLKDMFRDLKR

Sequence 1 RVASQKL
           -------
Sequence 2 E------



Alignment 8
Sequence 1:
Sequence 2: Allergen Fus p 9.0101, Sequence: A0A0U1Y1N5
Sequence identity: 52.66 (267/507)
Sequence 1 PQRQMDSAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKNNEERMELRKR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SSQFPVTTEVFDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SEVHTLGHDEPEIEKNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDV
           -----------E-E---PWGLARISHR--L-FGT-NKYLY--DGGEGVD-
Sequence 2 ------DKCDGETERQAPWGLARISHRNTLNFGTFNKYLYSSDGGEGVDA

Sequence 1 YVIDTGTNTKHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYG
           Y--DTGTN--HVDFEGRA-WGKTIP-GDADEDGNGHGTHCSGTVAGKKYG
Sequence 2 YIVDTGTNVDHVDFEGRAHWGKTIPSGDADEDGNGHGTHCSGTVAGKKYG

Sequence 1 VAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGF
           VAKKA-VYAVKVLRSNGSG-MSDVVKGVE-AA--H------AKDGK-KGF
Sequence 2 VAKKANVYAVKVLRSNGSGSMSDVVKGVEFAATSHLEQKKKAKDGKRKGF

Sequence 1 KGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAA
           KGS-ANMSLGGGK---LD-AVNAAV--GIHFAVAAGNDNAD-CNYSPAAA
Sequence 2 KGSVANMSLGGGKTQALDAAVNAAVRTGIHFAVAAGNDNADACNYSPAAA

Sequence 1 ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISG
           ---VTVGAS-L-D-RAYFSNYGKC-DIFAPGLNI-STWIGS--A-NTISG
Sequence 2 SEPVTVGASALDDSRAYFSNYGKCTDIFAPGLNIQSTWIGSKYAVNTISG

Sequence 1 TSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGALS
           TSMASPHIAGLLAY-LSLQPA-DS-YA-A-ITPKKLK-NLISVAT--ALS
Sequence 2 TSMASPHIAGLLAYYLSLQPAEDSEYALASITPKKLKENLISVATEDALS

Sequence 1 DVPRNTKNILAWNGGGSSNYTEIVEKGGYTVKKAAEKNEEESEFRITIPS
           D-P--T-N-LAWNGGG-S-Y--IVE-G-Y-VK-A-----EE---------
Sequence 2 DIPSDTPNLLAWNGGGCSDYKKIVEAGSYKVKAAPSSRVEEIKHAV----

Sequence 1 LSEIEDDFEKAKESAGRNAHRVGGKLQHLEAEIEDFIAEEMESMFEKVKE
           --E-E------K---G--A---G-K-------I-----EE-E--------
Sequence 2 --EQEVNLVSGKLTTG--AKELGSKAEKFSKKIHELVDEELEEFLKELNL

Sequence 1 RVASQKL
           -------
Sequence 2 -------



Alignment 9
Sequence 1:
Sequence 2: Allergen Rho m 2.0101, Sequence: Q32ZM1
Sequence identity: 42.80 (217/507)
Sequence 1 PQRQMDSAKEVPNSYMVVFKKHVKDASKHHDWVQSVHSKNNEERMELRKR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SSQFPVTTEVFDGLKHVYEMAGMKGYSGHFDDETIEAIRNHPDVDYIERD
           ----------------------------------IE--R--P-V--IE--
Sequence 2 --------------------------TMELLEDLIEQVRQLPMVNFIEKN

Sequence 1 SEVHTLGHDEPEIEKNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDV
           S-VH-----E----K--PWGLARISHRD-LS-G----YLY---GG-GV--
Sequence 2 SLVHA---NEFTVAKGAPWGLARISHRDPLSLGSFDQYLYDSNGGTGVTS

Sequence 1 YVIDTGTNTKHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYG
           YVIDTG-N--H--FEGRAKWGKTIP-GD-DEDGNGHGTHC-GT-----YG
Sequence 2 YVIDTGVNVHHEQFEGRAKWGKTIPQGDEDEDGNGHGTHCAGTIGSNAYG

Sequence 1 VAKKAHVYAVKVLRSNGSGTMSDVVKGVEYAAKAHSDTVQAAKDGKKKGF
           VAK-A---AVKVLRSNGSG-MSDV-KGVE-A-K-H-D-V---K------F
Sequence 2 VAKNAEIVAVKVLRSNGSGSMSDVIKGVEFAVKSHQDSVKKGKNS----F

Sequence 1 KGSAANMSLGGGKSTTLDLAVNAAVDAGIHFAVAAGNDNADSCNYSPAAA
           --S-ANMSLGGGKS--LDLAVNAAV-AG-HFAVAAGN-N-D-CN-SPA-A
Sequence 2 --STANMSLGGGKSPALDLAVNAAVKAGLHFAVAAGNENQDACNTSPASA

Sequence 1 ENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWIGSEHATNTISG
           ENA-TVGAST--D-RAYFSNYGKC-DIFAPGLNILST-IGS--AT---SG
Sequence 2 ENAITVGASTISDARAYFSNYGKCVDIFAPGLNILSTYIGSDAATAYLSG

Sequence 1 TSMASPHIAGLLAYMLSLQPAKDSAYAVA--DITPKKLKANLISVATVGA
           TSMASPHIAGLL-Y-LSLQP--DS--------ITP--LK-NLI---T---
Sequence 2 TSMASPHIAGLLTYYLSLQPSSDSEFFIGAEGITPAQLKKNLIAFGTPDV

Sequence 1 LSDVPRNTKNILAWNGGGSSNYTEIVEKGGYTVKKAAEKNEEESEFRITI
           L-D-P--T-NILA-NG-G--------------------------------
Sequence 2 LADIPADTPNILAFNGAGQNLTKFWGH-----------------------

Sequence 1 PSLSEIEDDFEKAKESAGRNAHRVGGKLQHLEAEIEDFIAEEMESMFEKV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KERVASQKL
           ---------
Sequence 2 ---------



Alignment 10
Sequence 1:
Sequence 2: Allergen Tri r 2.0101, Sequence: AAD52013
Sequence identity: 33.33 (169/507)
Sequence 1 ----------------------PQRQMDSAKEVPNSYMVVFKKHVKDAS-
           -----------------------------A---PN-Y-VV-K--V-D---
Sequence 2 MGFITKAIPIVLAALSTVNGARILEAGPHAEAIPNKYIVVMKREVSDEAF

Sequence 1 -KHHDWV-QSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYEMAGM-K
           --H--W--QS--S---------R---S--P-------G----Y---G---
Sequence 2 NAHTTWLSQSLNSRI------MRRAGSSKPMA-----GMQDKYSLGGIFR

Sequence 1 GYSGHFDDETIEAIRNHPDVDYIERDSEVHTL--GHDEPEIEKNSPWGLA
           -YSG-FDD--I--I--H-DVD-IE-D--V-T---G-----------WGLA
Sequence 2 AYSGEFDDAMIKDISSHDDVDFIEPDFVVRTTTNGTNLTHQDNVPSWGLA

Sequence 1 RISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGK
           R---------GT---Y-Y----G-GV--Y-IDTG----H-DF-GRAKWG-
Sequence 2 RVGSKKPG--GT--TYYYDPSAGKGVTAYIIDTGIDIDHEDFQGRAKWGE

Sequence 1 TIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMS
           ---------D-NGHGTH--GTV-G-KYG-AK-----AVKVL---GSG--S
Sequence 2 NFVD-QQNTDCNGHGTHVAGTVGGTKYGLAKGVSLVAVKVLDCDGSGSNS

Sequence 1 DVVKGVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLDLAVN
           -V-KG-E-A----S--------G--K----S--NMSLGG--S-----A--
Sequence 2 GVIKGMEWAMRQAS----GGGNGTAKAAGKSVMNMSLGGPRSEASNQAAK

Sequence 1 AAVDAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYG
           A--DAGI--AVAAGN-N-D----SPA------TV-AST--D--A-FSNYG
Sequence 2 AISDAGIFMAVAAGNENMDAQHSSPASEPSVCTVAASTKDDGKADFSNYG

Sequence 1 KCNDIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSLQPAK
           ---D--APG--I-S---G----T-T-SGTSMASPH--GL-AY---L---K
Sequence 2 AVVDVYAPGKDITSLKPGG--STDTLSGTSMASPHVCGLGAYLIGL--GK

Sequence 1 DSAYAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNYTE
           -------D-T-KK-----I-----G--------T---L--NG-G------
Sequence 2 QGGPGLCD-TIKKMANDVIQSPGEG--------TTGKLIYNGSGK-----

Sequence 1 IVEKGGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRNAHRV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GGKLQHLEAEIEDFIAEEMESMFEKVKERVASQKL
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 11
Sequence 1:
Sequence 2: Allergen Pen ch 13, Sequence: AAF23726
Sequence identity: 32.54 (165/507)
Sequence 1 ---------------------PQRQMDSAKEVPNSYMVVFKKHVKDA--S
           --------------------------------P-SY-VV----V--A--S
Sequence 2 MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFS

Sequence 1 KHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYEMAGMKGYS
           -H--W---VH------R---RK-----P-------G-KH--E--G-KGY-
Sequence 2 THREWATNVHA-----RLSRRKNGETGP-------G-KH-FEINGLKGYT

Sequence 1 GHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSP-WGLARISH
           --FD--T---I-N-P-V-YIE-D--V------------N-P-WGLARIS-
Sequence 2 ASFDENTAKDIANDPAVKYIEPDMIVNATAN---VVQSNVPSWGLARISS

Sequence 1 RDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPN
           ------GT---Y-Y----GEGV--Y--DTG----H-DF-GRAKWG-----
Sequence 2 KRT---GT-TSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVD

Sequence 1 GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVK
           -D---DGNGHGTH---T-AG-KYGVAKKA---AVKVL---GSGT-S-V--
Sequence 2 ND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVIS

Sequence 1 GVEYAAKAHSDTVQAAKDGKKKGFKGS-AANMSLGGGKSTTLDLAVNAAV
           G---A-K----------D-K--G--G----N-SLGG--S-----A----V
Sequence 2 GMDWAVK----------DAKSRGANGKYVMNTSLGGEFSKAVNDAAANVV

Sequence 1 DAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCN
           --GI---VAAGN------N-SPA-A--A-T--AST--D--A-F-N-G---
Sequence 2 KSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVV

Sequence 1 DIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSLQPAKDSA
           D--APG--I-----G------T-SGTSMA-PH-AG--AY---L-------
Sequence 2 DLYAPGQSITAAYPGG--GSKTLSGTSMAAPHVAGVAAYLMALEGVS-AG

Sequence 1 YAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNYTEIVE
           -A-A-I----L----IS-A--G--S----N--N-----------------
Sequence 2 NACARIV--QLATSSISRAPSGTTSKLLYNGINV----------------

Sequence 1 KGGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRNAHRVGGK
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LQHLEAEIEDFIAEEMESMFEKVKERVASQKL
           --------------------------------
Sequence 2 --------------------------------



Alignment 12
Sequence 1:
Sequence 2: Allergen Asp v 13.0101, Sequence: ADE74975
Sequence identity: 33.53 (170/507)
Sequence 1 ----------------------PQRQMDSAKEVPNSYMVVFKK--HVKDA
           --------------------------------VP--Y-V-FK--------
Sequence 2 MYSIKRTILLLGALLPAVFGAPILEARRQTEKVPGKYIVTFKSGLQAEQI

Sequence 1 SKHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYEMAGMKGY
           --H--W---VH-K-N-ER--L--R------------G------------Y
Sequence 2 DAHTTWASNVH-KRNLERRDLTDR--------DLYPGIEKNFKIHKFAAY

Sequence 1 SGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPWGLARISH
           -G-FDD-TIE-IRNH-DV---E-D--V--L--D--------PWGL--ISH
Sequence 2 VGSFDDATIEEIRNHKDVAHVEED-QVWYL--DALTTQSDAPWGLGAISH

Sequence 1 RDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPN
           ----S------Y-Y----G-----YV-DTG-N--H--F-GRA--------
Sequence 2 QGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYNAAG

Sequence 1 GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVK
           G----D--GHGTH--GT--GK--GV-KKA----VKV-----S-T-S----
Sequence 2 GQ-HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGESSST-SIILD

Sequence 1 GVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLDLAVNAAVD
           G---AA----D-V-----GK------SA-N-SLGGG-S-----AV--A-D
Sequence 2 GYNWAA---NDIVSKSRTGK------SAINLSLGGGYSYAFSNAVESAFD

Sequence 1 AGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCND
           -G----VAAGN-N-D--N-SPA-A-NA-TV-AST----RA-FSNYG---D
Sequence 2 EGVLSVVAAGNENVDASNTSPASAPNALTVAASTERNARASFSNYGEVVD

Sequence 1 IFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAY
           IFAPG--ILS-WIG---ATNTISGTSMA-PHI-GL--Y---L--------
Sequence 2 IFAPGEDILSAWIGGNSATNTISGTSMATPHIVGLSLYLIALEGLS----

Sequence 1 AVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNYTEIVEK
           ------P----------AT-GALS-V-----N-LA-NG------------
Sequence 2 -----SPGDVTSRIKELATQGALSGVS-GSPNALAYNGAE----------

Sequence 1 GGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRNAHRVGGKL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QHLEAEIEDFIAEEMESMFEKVKERVASQKL
           -------------------------------
Sequence 2 -------------------------------



Alignment 13
Sequence 1:
Sequence 2: Allergen Asp f 13, Sequence: P28296
Sequence identity: 33.53 (170/507)
Sequence 1 ----------------------PQRQMDSAKEVPNSYMVVFKKHVKDAS-
           -----------------------Q-----A---P--Y-V-FK-----A--
Sequence 2 MLSIKRTLLLLGAVLPAVFGAPVQETRRAAQKIPGKYIVTFKPGTDTATI

Sequence 1 -KHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYEMAGMKGY
           --H--W----H--N-E-R------S---PV------G----Y-------Y
Sequence 2 ESHTLWATDLHKRNLERR---DTTSGEPPV------GIEKSYKIKDFAAY

Sequence 1 SGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPWGLARISH
           -G-FDD-TIE-IR---DV---E-D-----L--D-----K--PWGL--ISH
Sequence 2 AGSFDDATIEEIRKRGDVAHVEED-QIWYL--DALTTQKGAPWGLGSISH

Sequence 1 RDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPN
           ----S------Y-Y----G-G---YV-D-G-N--HV-FE-RA--------
Sequence 2 KGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAYNAAG

Sequence 1 GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVK
           G----D--GHGTH--GT--GK-YGVAKK-----VKV-----S-T-S----
Sequence 2 G-SHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGESSST-SIILD

Sequence 1 GVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLDLAVNAAVD
           G---A-----D-V------K-------A-NMSLGGG-S-----AV--A-D
Sequence 2 GFNWAV---NDIVSKGRTKK------AAINMSLGGGYSYAFNNAVENAFD

Sequence 1 AGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCND
           -G----VAAGN-N-D--N-SPA-A-NA-TV-A------RA-FSNYG---D
Sequence 2 EGVLSVVAAGNENSDASNTSPASAPNALTVAAINKSNARASFSNYGSVVD

Sequence 1 IFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAY
           IFAPG--ILS-WIGS--ATNTISGTSMA-PHI-GL--Y---L------A-
Sequence 2 IFAPGQDILSAWIGSTTATNTISGTSMATPHIVGLSVYLMGLENLSGPAA

Sequence 1 AVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNYTEIVEK
           --A-I--K-L-------AT-G----V-----N-LA-NG------------
Sequence 2 VTARI--KEL-------ATNGVVTNV-KGSPNKLAYNGNA----------

Sequence 1 GGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRNAHRVGGKL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QHLEAEIEDFIAEEMESMFEKVKERVASQKL
           -------------------------------
Sequence 2 -------------------------------



Alignment 14
Sequence 1:
Sequence 2: Allergen Asp o 13, Sequence: CAA35594
Sequence identity: 33.33 (169/507)
Sequence 1 ----------------------PQRQMDSAKEVPNSYMVVFKKHVKDAS-
           -----------------------Q-----A---P--Y-V-FK-----A--
Sequence 2 MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKI

Sequence 1 -KHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYEMAGMKGY
           --H--W----H----E-R----------PV------G----Y-------Y
Sequence 2 QEHTTWATNIHQRSLERRGAT---GGDLPV------GIERNYKINKFAAY

Sequence 1 SGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPWGLARISH
           -G-FDD-TIE-IR---DV-Y-E-D-----L--D-----K--PWGL--ISH
Sequence 2 AGSFDDATIEEIRKNEDVAYVEED-QIYYL--DGLTTQKSAPWGLGSISH

Sequence 1 RDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPN
           ----S------Y-Y----GEG---YV-D-G-N--H--FEGRA--------
Sequence 2 KGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAG

Sequence 1 GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVK
           G----D--GHGTH-SGT-AGK-YG-AKKA----VKV-----S-T-S----
Sequence 2 GQ-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSST-SVILD

Sequence 1 GVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLDLAVNAAVD
           G---AA----D-V------K-------A-NMSLGGG-S-----AV--A--
Sequence 2 GFNWAA---NDIVSKKRTSK------AAINMSLGGGYSKAFNDAVENAFE

Sequence 1 AGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCND
           -G----VAAGN-N-D----SPA-A--A-TV-A------RA-FSN-GK--D
Sequence 2 QGVLSVVAAGNENSDAGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVD

Sequence 1 IFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAY
           -FAPG--ILS-WIGS--ATNTISGTSMA-PHI-GL--Y---L----D---
Sequence 2 VFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSLYLAALENL-DGPA

Sequence 1 AVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNYTEIVEK
           AV-----K--K------AT-----DV-----N-LA-NG------------
Sequence 2 AVT----KRIKE----LATKDVVKDV-KGSPNLLAYNGNA----------

Sequence 1 GGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRNAHRVGGKL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QHLEAEIEDFIAEEMESMFEKVKERVASQKL
           -------------------------------
Sequence 2 -------------------------------



Alignment 15
Sequence 1:
Sequence 2: Allergen Asp fl protease, Sequence: AAD47202
Sequence identity: 33.14 (168/507)
Sequence 1 ----------------------PQRQMDSAKEVPNSYMVVFKKHVKDAS-
           -----------------------Q-----A---P--Y-V-FK-----A--
Sequence 2 MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKI

Sequence 1 -KHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYEMAGMKGY
           --H--W----H----E-R----------PV------G----Y-------Y
Sequence 2 QEHTTWATNIHQRSLERRGAT---GGDLPV------GIERNYKINKFAAY

Sequence 1 SGHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSPWGLARISH
           -G-FDD-TIE-IR---DV-Y-E-D-----L--D-----K--PWGL--ISH
Sequence 2 AGSFDDATIEEIRKNEDVAYVEED-QIYYL--DGLTTQKSAPWGLGSISH

Sequence 1 RDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPN
           ----S------Y-Y----GEG---YV-D-G-N--H--FEGRA--------
Sequence 2 KGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYNAAG

Sequence 1 GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVK
           G----D--GHGTH-SGT-AGK-YG-AKKA----VKV-----S-T-S----
Sequence 2 GQ-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSST-SVILD

Sequence 1 GVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLDLAVNAAVD
           G---AA----D-V------K-------A-NMSLGGG-S-----AV--A--
Sequence 2 GFNWAA---NDIVSKKRTSK------AAINMSLGGGYSKAFNDAVENAFE

Sequence 1 AGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCND
           -G----VAAGN-N-D----SPA-A--A-TV-A------RA-FSN-GK--D
Sequence 2 QGVLSVVAAGNENSDAGQTSPASAPDAITVAAIQKSNNRASFSNFGKVVD

Sequence 1 IFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAY
           -FAPG--ILS-WIGS--ATNTISGTSMA-PHI-GL--Y---L----D---
Sequence 2 VFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSLYLAALENL-DGPA

Sequence 1 AVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNYTEIVEK
           AV-----K---------AT-----DV-----N-LA-NG------------
Sequence 2 AVT----KRIEE----LATKDVVKDV-KGSPNLLAYNGNA----------

Sequence 1 GGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRNAHRVGGKL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QHLEAEIEDFIAEEMESMFEKVKERVASQKL
           -------------------------------
Sequence 2 -------------------------------



Alignment 16
Sequence 1:
Sequence 2: Allergen Pen c 13.0101, Sequence: AAD25926
Sequence identity: 32.35 (164/507)
Sequence 1 ---------------------PQRQMDSAKEVPNSYMVVFKKHVKDA--S
           --------------------------------P-SY-VV----V--A---
Sequence 2 MGFLKVLATSLATLAVVDAGTLLTASNTDAVIPSSYIVVMNDDVSTAEFN

Sequence 1 KHHDWVQSVHSKNNEERMELRKRSSQFPVTTEVFDGLKHVYEMAGMKGYS
           -H--W---VH------R---RK-----P-------G-KH--E--G-KGY-
Sequence 2 THREWATNVHA-----RLSRRKNGETGP-------G-KH-FEINGLKGYT

Sequence 1 GHFDDETIEAIRNHPDVDYIERDSEVHTLGHDEPEIEKNSP-WGLARISH
           --FD--T---I-N-P-V-YIE-D--V------------N-P-WGLARIS-
Sequence 2 ASFDESTAKDIANDPAVKYIEPDMIVNATAN---VVQSNVPSWGLARISS

Sequence 1 RDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNTKHVDFEGRAKWGKTIPN
           ------GT---Y-Y----GEGV--Y--DTG----H-DF-GRAKWG-----
Sequence 2 KRT---GT-TSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVD

Sequence 1 GDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSGTMSDVVK
           -D---DGNGHGTH---T-AG-KYGVAKKA---AVKVL---GSGT-S-V--
Sequence 2 ND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVIS

Sequence 1 GVEYAAKAHSDTVQAAKDGKKKGFKGS-AANMSLGGGKSTTLDLAVNAAV
           G---A-K----------D-K--G--G----NMSLGG--S-----A----V
Sequence 2 GMDWAVK----------DAKSRGANGKYVMNMSLGGEFSKAVNDAAANVV

Sequence 1 DAGIHFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCN
           --GI---VAAGN------N-SPA-A----T--AST--D--A-F-N-G---
Sequence 2 KSGIFLSVAAGNEAENASNSSPASAAEVCTIAASTSTDGSASFTNFGSVV

Sequence 1 DIFAPGLNILSTWIGSEHATNTISGTSMASPHIAGLLAYMLSLQPAKDSA
           D--APG--I-----G------T-SGTSMA-PH-AG--AY---L-------
Sequence 2 DLYAPGQSITAAYPGG--GSKTLSGTSMAAPHVAGVAAYLMALEGVS-AG

Sequence 1 YAVADITPKKLKANLISVATVGALSDVPRNTKNILAWNGGGSSNYTEIVE
           -A-A-I----L----IS-A--G--S----N--N-----------------
Sequence 2 NACARIV--QLATSSISRAPSGTTSKLLYNGINV----------------

Sequence 1 KGGYTVKKAAEKNEEESEFRITIPSLSEIEDDFEKAKESAGRNAHRVGGK
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LQHLEAEIEDFIAEEMESMFEKVKERVASQKL
           --------------------------------
Sequence 2 --------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.