The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Art f 1.0101

Sequence AHF71024

Full FASTA alignment

Sequence name:
Query sequence:
AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG
SPPPPSAH

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Art f 1.0101AHF71024Go!108142.52.5e-36
2Art t 1.0101AHF71026Go!108142.52.5e-36
3Art c 1.0101AHF71023Go!108141.74.3e-36
4Art ca 1.0101ANC85010Go!132141.84.9e-36
5Art an 1.0102ANC85006Go!132141.84.9e-36
6Art ab 1.0101AHF71021Go!108139.81.6e-35
7Art l 1.0101AHF71025Go!108139.61.8e-35
8Art si 1.0102ANC85016Go!132139.22.8e-35
9Art si 1.0101ANC85015Go!132139.22.8e-35
10Art la 1.0102ANC85014Go!132138.35.5e-35
11Art ar 1.0102ANC85009Go!132138.35.5e-35
12Art gm 1.0101ANC85011Go!132138.16.1e-35
13Art ar 1.0101ANC85008Go!132137.21.2e-34
14Art la 1.0101ANC85013Go!132137.21.2e-34
15Art v 1.0101AF493943Go!132136.42.0e-34
16Amb a 4.0101CBK52317Go!16480.31.9e-17
17Par h 1.0101A0A0X9C7K4Go!15678.46.9e-17
18Api g 7.0101QUJ17885Go!9352.13.4e-09
19Aes h 1.0101Q7M1F3Go!5048.52.3e-08

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Art f 1.0101, Sequence: AHF71024
Sequence identity: 100.00 (108/108)
Sequence 1 AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
           AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
Sequence 2 AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY

Sequence 1 FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG
           FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG
Sequence 2 FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG

Sequence 1 SPPPPSAH
           SPPPPSAH
Sequence 2 SPPPPSAH



Alignment 2
Sequence 1:
Sequence 2: Allergen Art t 1.0101, Sequence: AHF71026
Sequence identity: 100.00 (108/108)
Sequence 1 AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
           AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
Sequence 2 AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY

Sequence 1 FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG
           FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG
Sequence 2 FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG

Sequence 1 SPPPPSAH
           SPPPPSAH
Sequence 2 SPPPPSAH



Alignment 3
Sequence 1:
Sequence 2: Allergen Art c 1.0101, Sequence: AHF71023
Sequence identity: 99.07 (107/108)
Sequence 1 AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
           AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
Sequence 2 AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY

Sequence 1 FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG
           FDCSKSPPGATPAPPGAAPPPAAGGSPPPP-DGGSPPPPADGGSPPADGG
Sequence 2 FDCSKSPPGATPAPPGAAPPPAAGGSPPPPADGGSPPPPADGGSPPADGG

Sequence 1 SPPPPSAH
           SPPPPSAH
Sequence 2 SPPPPSAH



Alignment 4
Sequence 1:
Sequence 2: Allergen Art ca 1.0101, Sequence: ANC85010
Sequence identity: 99.07 (107/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           PPPP-DGGSPPPPADGGSPPADGGSPPPPSAH
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSAH



Alignment 5
Sequence 1:
Sequence 2: Allergen Art an 1.0102, Sequence: ANC85006
Sequence identity: 99.07 (107/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFVLAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           PPPP-DGGSPPPPADGGSPPADGGSPPPPSAH
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSAH



Alignment 6
Sequence 1:
Sequence 2: Allergen Art ab 1.0101, Sequence: AHF71021
Sequence identity: 96.30 (104/108)
Sequence 1 AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
           AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
Sequence 2 AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY

Sequence 1 FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG
           FDCSKSPPGATPAPPGA-PPPAAGGSPPPP-DGG-PPPPADGGSPPADGG
Sequence 2 FDCSKSPPGATPAPPGASPPPAAGGSPPPPADGGTPPPPADGGSPPADGG

Sequence 1 SPPPPSAH
           SPPPPS-H
Sequence 2 SPPPPSTH



Alignment 7
Sequence 1:
Sequence 2: Allergen Art l 1.0101, Sequence: AHF71025
Sequence identity: 98.15 (106/108)
Sequence 1 AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
           AGSKLCEKTSKT-SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY
Sequence 2 AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCY

Sequence 1 FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG
           FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG
Sequence 2 FDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGG

Sequence 1 SPPPPSAH
           SPPPPS-H
Sequence 2 SPPPPSTH



Alignment 8
Sequence 1:
Sequence 2: Allergen Art si 1.0102, Sequence: ANC85016
Sequence identity: 97.22 (105/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFVLAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           P-PP-DGGSPPPPADGGSPPADGGSPPPPS-H
Sequence 2 PSPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 9
Sequence 1:
Sequence 2: Allergen Art si 1.0101, Sequence: ANC85015
Sequence identity: 97.22 (105/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           P-PP-DGGSPPPPADGGSPPADGGSPPPPS-H
Sequence 2 PSPPADGGSPPPPADGGSPPADGGSPPPPSGH



Alignment 10
Sequence 1:
Sequence 2: Allergen Art la 1.0102, Sequence: ANC85014
Sequence identity: 96.30 (104/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGA-PPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGASPPPAAGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           PPPP-DGGSPPPPADGGSPPADGGSPPPPS-H
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 11
Sequence 1:
Sequence 2: Allergen Art ar 1.0102, Sequence: ANC85009
Sequence identity: 96.30 (104/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGA-PPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGASPPPAAGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           PPPP-DGGSPPPPADGGSPPADGGSPPPPS-H
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 12
Sequence 1:
Sequence 2: Allergen Art gm 1.0101, Sequence: ANC85011
Sequence identity: 96.30 (104/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFLLAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPA-GGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPATGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           PPPP-DGGSPPPPADGGSPPADGGSPPPPS-H
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 13
Sequence 1:
Sequence 2: Allergen Art ar 1.0101, Sequence: ANC85008
Sequence identity: 96.30 (104/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           P-PP-DGGSPPPPADGGSPPADGGSPPPPS-H
Sequence 2 PSPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 14
Sequence 1:
Sequence 2: Allergen Art la 1.0101, Sequence: ANC85013
Sequence identity: 96.30 (104/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           P-PP-DGGSPPPPADGGSPPADGGSPPPPS-H
Sequence 2 PSPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 15
Sequence 1:
Sequence 2: Allergen Art v 1.0101, Sequence: AF493943
Sequence identity: 95.37 (103/108)
Sequence 1 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           P-PP-DGGSPPPPADGGSPP-DGGSPPPPS-H
Sequence 2 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH



Alignment 16
Sequence 1:
Sequence 2: Allergen Amb a 4.0101, Sequence: CBK52317
Sequence identity: 58.33 (63/108)
Sequence 1 -----------------AGSKLCEKTSKTWSGKCDNK---KCDKKCIEWE
           --------------------KLCEK-S-TWSGKC--K---KCDK-CIEWE
Sequence 2 MAAGLLVFVLAISEIASVKGKLCEKPSVTWSGKCKVKQTDKCDKRCIEWE

Sequence 1 KAQHGACHKREAGKESCFCYFDCSKSP-PGATP-APPGAAP---PPAAGG
           -A-HGACHKR---K--CFCYFDC-----PG--P-AP-G-AP---PP--GG
Sequence 2 GAKHGACHKRDS-KATCFCYFDCDPTKNPGPPPGAPKGKAPAPSPPSGGG

Sequence 1 SPPPPT-DGGSPPPPADGGSPPADGGSPPPPSAH----------------
           -PPP----GG--PPP--GG----DGG------------------------
Sequence 2 APPPSGGEGGDGPPPPEGGEGGGDGGGEGGGEGGGDGGGEGGGEGGGDGG

Sequence 1 ---------------
           ---------------
Sequence 2 GDGGGEGGGEGGGER



Alignment 17
Sequence 1:
Sequence 2: Allergen Par h 1.0101, Sequence: A0A0X9C7K4
Sequence identity: 52.78 (57/108)
Sequence 1 -------------------------AGSKLCEKTSKTWSGKC-DNKKCDK
           ----------------------------K-CEK-SKTW-G-C-D--KCDK
Sequence 2 MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDK

Sequence 1 KCIEWEKAQHGACHKREAGKESCFCYFDC----SKSPPGATPAPPGAAPP
           -C-EWE-A-HGACH-RE--K--CFCYFDC-------PP---P--PG--P-
Sequence 2 RCMEWEGAKHGACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPA

Sequence 1 PAAGGSPPPPTDGGSPPPPA---DGGSPPADGGSPPPPSAH---------
           P--GG----P--GG-PPP------GG-----GG-PPP-------------
Sequence 2 PPGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPPAGGEGGGGGGDGG

Sequence 1 -------
           -------
Sequence 2 GGAPPAA



Alignment 18
Sequence 1:
Sequence 2: Allergen Api g 7.0101, Sequence: QUJ17885
Sequence identity: 32.41 (35/108)
Sequence 1 ---------------------------------------AGSKLCEKTSK
           -------------------------------------------LCEK-S-
Sequence 2 MAPKASSLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQ

Sequence 1 TWSGKCDN-KKCDKKCIEWEKAQHGACHKREAGKESCFCYFD-CSKSPPG
           TW-GKC-N-K-CD--CI-WE-A-HGACHKR--GK--CFCYFD-C------
Sequence 2 TWTGKCGNTKNCDNQCIQWETARHGACHKR-GGKWMCFCYFDRC------

Sequence 1 ATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSAH
           -------------------------------------------------
Sequence 2 -------------------------------------------------



Alignment 19
Sequence 1:
Sequence 2: Allergen Aes h 1.0101, Sequence: Q7M1F3
Sequence identity: 29.63 (32/108)
Sequence 1 AGSKLC-EKTSKTWSGKCDNK-KCDKKCIEWEKAQHGACHKREAGKESCF
           ----LC-E--S-TWSG-C-N---CDK-C--WEKA-HGACHKRE-----CF
Sequence 2 ----LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRE-NHWKCF

Sequence 1 CYFDCSKSPPGATPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPAD
           CYF-C---------------------------------------------
Sequence 2 CYFNC---------------------------------------------

Sequence 1 GGSPPPPSAH
           ----------
Sequence 2 ----------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.