The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Can s 5.0101

Sequence AFN42528

Full FASTA alignment

Sequence name:
Query sequence:
MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
AYLKDHPEAYN

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Can s 5.0101AFN42528Go!161215.46.2e-58
2Pru p 1.0101Q2I6V8Go!160152.64.9e-39
3Pru av 1O24248Go!160151.61.0e-38
4Fra a 1Q3T923Go!160146.53.4e-37
5Fra a 1Q256S7Go!160146.14.5e-37
6Jug r 5.0101APD76154Go!160145.56.8e-37
7Mal d 1CAA96537Go!160144.31.6e-36
8Fra a 1Q256S6Go!160144.31.6e-36
9Fra a 1Q256S2Go!160143.62.4e-36
10Pyr c 1O65200Go!159143.42.8e-36
11Mal d 1CAA58646Go!159143.42.8e-36
12Mal d 1CAA96536Go!160143.23.2e-36
13Pru ar 1O50001Go!160143.03.7e-36
14Fra a 1Q256S4Go!159142.84.3e-36
15Mal d 1CAA96535Go!160142.84.3e-36
16Mal d 1AAD26553Go!159142.64.9e-36
17Mal d 1AAD26552Go!159142.64.9e-36
18Mal d 1AAD26554Go!159142.64.9e-36
19Mal d 1P43211Go!158142.07.5e-36
20Mal d 1AAD26546Go!159142.07.5e-36
21Mal d 1AAD26559Go!159141.41.1e-35
22Mal d 1AAD26555Go!159140.81.7e-35
23Mal d 1AAD26548Go!159140.62.0e-35
24Mal d 1CAA96534Go!159140.42.3e-35
25Mal d 1AAD26547Go!159140.22.7e-35
26Mal d 1CAA88833Go!159139.83.5e-35
27Mal d 1AAD26558Go!159139.83.5e-35
28Cas s 1CAD10374Go!160139.25.4e-35
29Fag s 1.0101ACJ23864Go!160138.01.3e-34
30Cor a 1.0301CAA96549Go!160137.71.4e-34
31Que a 1.0301ABZ81046Go!160137.71.4e-34
32Pru du 1.0101B6CQS9Go!160136.14.5e-34
33Que m 1.0101AUH28179Go!160132.55.6e-33
34Bet v 1.1301CAA54696Go!160132.17.5e-33
35Bet v 1.1801CAA96540Go!160131.98.6e-33
36Que a 1.0401ABZ81047Go!160131.98.6e-33
37Cor a 1.0201CAA96548Go!160131.01.5e-32
38Cor a 1.0401AAD48405Go!161131.01.5e-32
39Cor a 1.0404AAG40331Go!161131.01.5e-32
40Bet v 1.2901CAB02160Go!160130.81.7e-32
41Bet v 1.1401CAA57497Go!160130.81.7e-32
42Bet v 1CAA05188Go!160130.62.0e-32
43Bet v 1.2001CAA96543Go!160130.22.7e-32
44Bet v 1.at10CAA07319Go!160130.03.1e-32
45Bet v 1.1701CAA96539Go!160130.03.1e-32
46Bet v 1.2801CAB02159Go!160129.83.5e-32
47Que a 1.0201ABZ81045Go!159129.64.0e-32
48Bet v 1.2301CAA96545Go!160129.64.0e-32
49Bet v 1CAA05190Go!160129.64.0e-32
50Bet v 1CAA05189Go!160129.64.0e-32
51Bet v 1.1401P43186Go!159129.44.6e-32
52Bet v 1.1901CAA96542Go!160129.44.7e-32
53Bet v 1.0101CAA33887Go!160129.44.7e-32
54Bet v 1.1501CAA96538Go!160129.25.4e-32
55Bet v 1.2501CAB02156Go!160129.25.4e-32
56Bet v 1.1501Q42499Go!160129.25.4e-32
57Cor a 1.0402AAG40329Go!161129.25.4e-32
58Bet v 1.0501CAA54483Go!160129.06.2e-32
59Bet v 1.3001CAB02161Go!160129.06.2e-32
60Bet v 1.at50CAA07326Go!160128.87.1e-32
61Car b 1.0302CAB02217Go!161128.87.1e-32
62Cor a 1.0103CAA50325Go!160128.68.2e-32
63Cor a 1.0403AAG40330Go!161128.68.2e-32
64Bet v 1.0301CAA54481Go!160128.49.4e-32
65Bet v 1.at59CAA07327Go!160128.49.4e-32
66Bet v 1CAA05186Go!160128.49.4e-32
67Bet v 1.0901CAA54488Go!160128.21.1e-31
68Bet v 1.0801CAA54487Go!160128.21.1e-31
69Bet v 1.2101CAA96544Go!160128.21.1e-31
70Bet v 1.0101P15494Go!159128.01.2e-31
71Bet v 1.at45CAA07325Go!160128.01.2e-31
72Aln g 1AAB24432Go!160128.01.2e-31
73Bet v 1.at7CAA07330Go!160127.81.4e-31
74Bet v 1.at37CAA07323Go!160127.81.4e-31
75Bet v 1P43178Go!159127.61.6e-31
76Bet v 1.at5CAA07329Go!160127.61.7e-31
77Bet v 1.0701CAA54485Go!160127.61.7e-31
78Bet v 1.2401CAB02155Go!160127.61.7e-31
79Bet v 1.0201CAA54421Go!160127.61.7e-31
80Bet v 1.0401CAA54482Go!160127.41.9e-31
81Bet v 1.2701CAB02158Go!160127.41.9e-31
82Car b 1.0113ABZ81044Go!160127.41.9e-31
83Bet v 1.2601CAB02157Go!160127.41.9e-31
84Bet v 1.at42CAA07324Go!160127.41.9e-31
85Bet v 1.0601CAA54484Go!160127.22.2e-31
86Bet v 1P43176Go!159127.02.5e-31
87Car b 1.0103CAB02206Go!160127.02.5e-31
88Bet v 1P43183Go!159126.82.9e-31
89Bet v 1P43184Go!159126.82.9e-31
90Aln g 1P38948Go!159126.63.3e-31
91Bet v 1.at8CAA07318Go!160126.63.3e-31
92Car b 1.0111ABZ81042Go!160126.43.9e-31
93Bet v 1.1601CAA96546Go!160126.43.9e-31
94Bet v 1.1001CAA54489Go!160126.43.9e-31
95Car b 1.0301CAB02216Go!161126.43.9e-31
96Bet v 1P43180Go!159126.24.4e-31
97Bet v 1P45431Go!159126.24.4e-31
98Cor a 1.0101CAA50327Go!160126.24.4e-31
99Bet v 1.2201CAA96547Go!160126.24.4e-31
100Ost c 1.0101ADK39021Go!160126.24.4e-31
101Bet v 1.0401P43177Go!159126.05.1e-31
102Bet v 1.0601P43179Go!159125.85.9e-31
103Que i 1.0101QGS84240Go!159125.85.9e-31
104Car b 1P38950Go!159125.66.7e-31
105Car b 1.0110ABZ81041Go!160125.66.8e-31
106Car b 1.0104CAB02207Go!160125.66.8e-31
107Car b 1.0112ABZ81043Go!160125.47.8e-31
108Bet v 1.1201CAA54695Go!159125.18.9e-31
109Bet v 1P43185Go!159124.91.0e-30
110Bet v 1.1101CAA54694Go!160124.91.0e-30
111Car b 1.0109ABZ81040Go!160124.91.0e-30
112Cor a 1Q08407Go!159124.71.2e-30
113Car b 1.0105CAB02208Go!160124.51.4e-30
114Car b 1P38949Go!159122.94.2e-30
115Car b 1.0106CAB02209Go!160122.94.2e-30
116Que ac 1.0101QOL10866Go!159122.74.8e-30
117Cor a 1.0102CAA50328Go!160122.74.9e-30
118Car b 1.0102CAA47357Go!159121.79.8e-30
119Cor a 1.0104CAA50326Go!160120.52.3e-29
120Car b 1.0107CAB02213Go!160118.97.1e-29
121Act c 8.0101CAM31908Go!159118.01.2e-28
122Rub i 1.0101Q0Z8U9Go!137117.31.8e-28
123Car b 1.0108CAB02215Go!160116.82.9e-28
124Act d 8.0101CAM31909Go!157114.41.6e-27
125Sola l 4.0201NP_001275580Go!160111.51.1e-26
126Gly m 4CAA42646Go!158108.78.0e-26
127Sola l 4.0101AHC08073Go!160108.78.1e-26
128Bet v 1.at87CAA07328Go!120106.03.9e-25
129Bet v 1.at14CAA07320Go!120105.84.4e-25
130Pha v 1CAA43637Go!156104.02.0e-24
131Pha v 1P25985Go!155102.65.5e-24
132Pha v 1CAA43636Go!155102.46.3e-24
133Lyc e 4.0101CAA75803Go!178100.62.4e-23
134Tar o RAPAAB92255Go!15798.96.9e-23
135Vig r 1.0101Q2VU97Go!15598.77.9e-23
136Pet c PR10CAA67246Go!15598.11.2e-22
137Ara h 8.0101AAQ91847Go!15797.12.5e-22
138Ara h 8.0201EF436550Go!15391.89.5e-21
139Api g 1P49372Go!15491.21.5e-20
140Dau c 1.0201AAL76932Go!15489.15.9e-20
141Api g 1.0201P92918Go!15988.21.2e-19
142Dau c 1.0105CAB06416Go!15486.73.2e-19
143Dau c 1.0104CAB03716Go!15486.34.3e-19
144Dau c 1.0102BAA13604Go!15484.51.5e-18
145Dau c 1.0103CAB03715Go!15484.12.0e-18
146Dau c 1.0101AAB01092Go!16884.12.1e-18
147Fra a 1.0101Q5ULZ4Go!10062.63.8e-12
148Que a 1.0101P85126Go!5052.91.6e-09
149Vig r 6.0101Q9ZWP8Go!15542.66.1e-06
150Cas s 1Q9S8Q4Go!2430.15.4e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Can s 5.0101, Sequence: AFN42528
Sequence identity: 100.00 (161/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
Sequence 2 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
Sequence 2 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
Sequence 2 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE

Sequence 1 AYLKDHPEAYN
           AYLKDHPEAYN
Sequence 2 AYLKDHPEAYN



Alignment 2
Sequence 1:
Sequence 2: Allergen Pru p 1.0101, Sequence: Q2I6V8
Sequence identity: 65.22 (105/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFTYESEFTS-I-P-RLFKAFVLD-DNLVPKIAPQA----EILEG-GG
Sequence 2 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI--IDKE---YSY--IEGDAL-G--LEKI
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDAL-GDNLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVAS--GG--IK--S-Y---GD----EE-VK-G---A----K--E
Sequence 2 SYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLK-HP-AYN
Sequence 2 TYLKGHPDAYN



Alignment 3
Sequence 1:
Sequence 2: Allergen Pru av 1, Sequence: O24248
Sequence identity: 64.60 (104/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFTYESEFTS-I-P-RLFKAFVLD-DNLVPKIAPQA----EILEG-GG
Sequence 2 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI--IDKE---YSY--IEGDAL-G--LEKI
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLIEGDAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVAS--GG--IK--S-Y---G-----EE-VK-G---A----K--E
Sequence 2 SYETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLK-HP-AYN
Sequence 2 TYLKGHPDAYN



Alignment 4
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q3T923
Sequence identity: 63.98 (103/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-TYE-EFTS-I----LFKAFVLD-DNL-PKIAPQAV---EILEG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI--IDKE--TYSYS-IEGDAL--N--EKI
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDN-IEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLV----GG-VIKT-SKY---GD----EE-VK-G---A----K--E
Sequence 2 DYETKLVSAPHGGTVIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP--YN
Sequence 2 GYLKDHPSEYN



Alignment 5
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S7
Sequence identity: 62.73 (101/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-TYE-EFTS-I----LFKAFVLD-DNL-PKIAPQA----EILEG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI--IDKE--TYSYS-IEGDAL--N--EKI
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDN-IEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLV----GG--IKT-SKY---GD----EE-VK-G---A----K--E
Sequence 2 DYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP--YN
Sequence 2 GYLKDHPSEYN



Alignment 6
Sequence 1:
Sequence 2: Allergen Jug r 5.0101, Sequence: APD76154
Sequence identity: 60.25 (97/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFTYE-E-TS-I-PARLFKAFVLD-DNL-PK--PQAV---EI-EGNGG
Sequence 2 MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-FG-G---KYVKH---AID----TY-YS-IEGDAL-----EKI
Sequence 2 PGTIKKINFGEGSQYKYVKHRTDAIDEANFTYAYSVIEGDAL-ADKIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VAS--GG---K--S-Y-S-GD----EE-VK-G---A----K-VE
Sequence 2 SYETKIVASHEGGSILKSISHYHSKGDHEIKEEDVKDGKEKASGLFKAVE

Sequence 1 AYLKDHPEAYN
           -YL--HP-AYN
Sequence 2 GYLLAHPDAYN



Alignment 7
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96537
Sequence identity: 60.25 (97/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-EFTS-I---RLFKAF-LDGDNL-PKIAPQA----EI-EG-GG
Sequence 2 MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGTIKK-TFG-G----YVK-----IDK---TYSYS-IEGD-L----LEKI
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTL-SDKLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T-E-KL-AS-DGG--IKT-S-Y---GD----EE-VK-G---A----K--E
Sequence 2 TYETKLIASPDGGSIIKTTSHYRAKGDVEIKEEHVKAGKEKASGLFKLLE

Sequence 1 AYLKDHPEAYN
           AYL--H--AYN
Sequence 2 AYLLAHSDAYN



Alignment 8
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S6
Sequence identity: 62.11 (100/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MG--TYE-EFTS-I----LFKAFVLD-DNL-PKIAPQA----EILEG-GG
Sequence 2 MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI--IDKE--TYSYS-IEGDAL--N--EKI
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDN-IEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLV----GG--IKT-SKY---GD----EE-VK-G---A----K--E
Sequence 2 DYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP--YN
Sequence 2 GYLKDHPSEYN



Alignment 9
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S2
Sequence identity: 62.73 (101/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-TYE-EFTS-I----LFKAFVLD-DNL-PKIAPQAV---EILEG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI--IDK---TYSYS-IEGDAL--N--EKI
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSEN-IEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLV----GG--IKT-SKY---GD----EE-VK-G---A----K--E
Sequence 2 DYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP--YN
Sequence 2 GYLKDHPSEYN



Alignment 10
Sequence 1:
Sequence 2: Allergen Pyr c 1, Sequence: O65200
Sequence identity: 59.63 (96/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MG--T-E-EFTS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEGNGG
Sequence 2 MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKH----ID--S--Y-Y--IEGDAL-----EKI
Sequence 2 PGTIKKITFGEGSQYGYVKHRVDSIDEASYSYAYTLIEGDALT-DTIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVASG-G---IK--S-Y---GD----EE-VK-G---A----K--E
Sequence 2 SYEAKLVASGSG-STIKSISHYHTKGDIEIKEEHVKAGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP-AYN
Sequence 2 SYLKDHPDAYN



Alignment 11
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA58646
Sequence identity: 60.25 (97/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-EFTS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKH-I--ID--S--YSY--IEGDAL-----EKI
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA-G-G---IK--S-Y---G-----EE-VK-G---A----K--E
Sequence 2 SYETKLVACGSG-STIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP-AYN
Sequence 2 SYLKDHPDAYN



Alignment 12
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96536
Sequence identity: 59.63 (96/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-EFTS-I---RLFKAF-LDGDNL-PKIAPQA-----I-EG-GG
Sequence 2 MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGTIKK-TFG-G----YVK-----IDK---TYSYS-IEGD-L----LEKI
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTL-SDKLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T-E-KL-AS-DGG--IKT-S-Y---GD----EE-VK-G---A----K--E
Sequence 2 TYETKLIASPDGGSIIKTNSHYHAKGDVEIKEEHVKAGKEKASGLFKLLE

Sequence 1 AYLKDHPEAYN
           AYL--H--AYN
Sequence 2 AYLLAHSDAYN



Alignment 13
Sequence 1:
Sequence 2: Allergen Pru ar 1, Sequence: O50001
Sequence identity: 59.01 (95/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFTYE-EFTS-I-P--LFKAF-LD-DNL-PK-AP-AV---EILEG-GG
Sequence 2 MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGTIKK-TFG-G----YVKH----IDK--L-YSY--IEGDAL-----E-I
Sequence 2 VGTIKKVTFGEGSQYAYVKHRVDGIDKDNLSYSYTLIEGDAL-SDVIENI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ----KLVAS-DGG---KT-S-Y---GD----EE-VK-G---A----K-VE
Sequence 2 AYDIKLVASPDGGSIVKTTSHYHTKGDVEIKEEQVKAGKEKAAGLFKLVE

Sequence 1 AYLKDHPEAYN
           AYL---P-AYN
Sequence 2 AYLLANPDAYN



Alignment 14
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S4
Sequence identity: 63.35 (102/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-TYE-EFTS-I----LFKAFVLD-DNL-PKIAPQAV---EILEG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI--IDKE--TYSYS-IEGDAL--N--EKI
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDN-IEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLV-S---G--IKT-SKY---GD----EE-VK-G---A----K--E
Sequence 2 DYETKLV-SAPHGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP--YN
Sequence 2 GYLKDHPSEYN



Alignment 15
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96535
Sequence identity: 59.63 (96/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I---RLFKAF-LDGDNL-PKIAPQA----EI-EG-GG
Sequence 2 MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGTIKK-TFG-G----YVK-----IDK---TYSYS-IEGD-L----LEKI
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTL-SDKLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T-E-KL-AS-DGG--IKT-S-Y---GD----EE-VK-G---A----K--E
Sequence 2 TYETKLIASPDGGSIIKTTSHYHAKGDVEIKEEHVKAGKEKASGLFKLLE

Sequence 1 AYLKDHPEAYN
           AYL--H--AYN
Sequence 2 AYLLAHSDAYN



Alignment 16
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26553
Sequence identity: 60.25 (97/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-EFTS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEGNGG
Sequence 2 MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKH-I--ID--S--YSY--IEGDAL-----EKI
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA-G-G---IK--S-Y---G-----EE-VK-G---A----K--E
Sequence 2 SYETKLVACGSG-STIKSISHYHTKGNIEIKEEHVKAGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP-AYN
Sequence 2 SYLKDHPDAYN



Alignment 17
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26552
Sequence identity: 59.63 (96/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-E-TS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEGNGG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKH-I--ID--S--YSY--IEGDAL-----EKI
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA-G-G---IK--S-Y---G-----EE-VK-G---A----K--E
Sequence 2 SYETKLVACGSG-STIKSISHYHTKGNIEIKEEHVKAGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP-AYN
Sequence 2 SYLKDHPDAYN



Alignment 18
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26554
Sequence identity: 59.63 (96/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-EFTS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKH-I--ID--S--YSY--IEGDAL-----E-I
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIENI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA-G-G---IK--S-Y---G-----EE-VK-G---A----K--E
Sequence 2 SYETKLVACGSG-STIKSISHYHTKGNIEIKEEHVKAGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP-AYN
Sequence 2 SYLKDHPDAYN



Alignment 19
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: P43211
Sequence identity: 59.63 (96/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GV-T-E-EFTS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEGNGG
Sequence 2 -GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKH-I--ID--S--YSY--IEGDAL-----EKI
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA-G-G---IK--S-Y---G-----EE-VK-G---A----K--E
Sequence 2 SYETKLVACGSG-STIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP-AYN
Sequence 2 SYLKDHPDAYN



Alignment 20
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26546
Sequence identity: 59.63 (96/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-EFTS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKH-I--ID--S--YSY--IEGDAL-----EKI
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA-G-G---IK--S-Y---G-----EE-VK-G---A----K--E
Sequence 2 SYETKLVACGSG-STIKSISHYHTKGNIEIKEEHVKAGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLK-HP-AYN
Sequence 2 SYLKGHPDAYN



Alignment 21
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26559
Sequence identity: 57.76 (93/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-E-TS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI---D-----Y-Y--IEGDAL-----EK-
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALT-DTIEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVASG-G---IK--S-Y---GD----EE-VK-G---A----K--E
Sequence 2 SYETKLVASGSG-SIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLK-HP-AYN
Sequence 2 SYLKGHPDAYN



Alignment 22
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26555
Sequence identity: 59.01 (95/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-E-TS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEGNGG
Sequence 2 MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKH-I--ID--S--YSY--IEGDAL-----EKI
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA-G-G---IK--S-Y---G-----EE-VK-G---A----K--E
Sequence 2 SYETKLVACGSG-STIKSISHYHTKGNIEIKEEHVKAGKAKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLK-HP-AYN
Sequence 2 SYLKGHPDAYN



Alignment 23
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26548
Sequence identity: 57.14 (92/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-E-TS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI---D-----Y-Y--IEGDAL-----EK-
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALT-DTIEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KL-ASG-G---IK--S-Y---GD----EE-VK-G---A----K--E
Sequence 2 SYETKLMASGSG-SIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLK-HP-AYN
Sequence 2 SYLKGHPDAYN



Alignment 24
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96534
Sequence identity: 59.63 (96/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-EFTS-I-PARLF-AFVLD-DNL-PKIAPQAV---EILEG-GG
Sequence 2 MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGTIKKI-FG-G----YVKH-I---DKE---Y-YS-IEGDA------EKI
Sequence 2 VGTIKKINFGEGSTYSYVKHRIDGVDKENFVYKYSVIEGDAI-SETIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVASG-G--VIK--S-Y----D----EE-VK-G---A----K--E
Sequence 2 SYETKLVASGSG-SVIKSTSHYHTKSDVEIKEEHVKAGKEKASHLFKLIE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 NYLLAHSDAYN



Alignment 25
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26547
Sequence identity: 57.14 (92/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-E-TS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI---D-----Y-Y--IEGDAL-----EK-
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALT-DTIEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVASG-G---IK--S-Y---GD----EE-VK-G---A----K--E
Sequence 2 SYETKLVASGSG-SIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           --LK-HP-AYN
Sequence 2 SHLKGHPDAYN



Alignment 26
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA88833
Sequence identity: 59.01 (95/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-EFTS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKH-I--ID--S--YSY--IEGDAL-----EKI
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA-G-G---IK--S-Y---G-----EE-VK-G--------K--E
Sequence 2 SYETKLVACGSGAT-IKSISHYHPKGNIEIKEEHVKVGKEKGHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLK-HP-AYN
Sequence 2 SYLKGHPDAYN



Alignment 27
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26558
Sequence identity: 57.14 (92/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-E-TS-I-P-RLFKAFVLD-DNL-PKIAPQA----EILEG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G----YVKHKI---D-----Y-Y--IEGDAL-----EK-
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALT-DTIEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVASG-G---IK--S-Y---GD----EE-V--G---A----K--E
Sequence 2 SYETKLVASGSG-SIIKSISHYHTKGDVEIKEEHVMAGKEKAHGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLK-HP-AYN
Sequence 2 SYLKGHPDAYN



Alignment 28
Sequence 1:
Sequence 2: Allergen Cas s 1, Sequence: CAD10374
Sequence identity: 59.01 (95/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFT-E-E-TS-I-P-RLFKAFVLD-DNL-PK-AP-A----EI-EGNGG
Sequence 2 MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G--FKYVKH-I--ID----TY-YS-IEGD------LEKI
Sequence 2 PGTIKKITFGEGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVN-ELLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VAS-DGG---K--SKY---G-----EEKV--G---A----K-VE
Sequence 2 SYEIKIVASPDGGSILKNTSKYHTKGEQEIKEEKVMAGKEKAAGLFKAVE

Sequence 1 AYLKDHPEAYN
           AYL--H--AYN
Sequence 2 AYLLAHSDAYN



Alignment 29
Sequence 1:
Sequence 2: Allergen Fag s 1.0101, Sequence: ACJ23864
Sequence identity: 58.39 (94/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFTYESE-T--I-PARLFKAFVLD-DNL-PK-APQA----EI-EG-GG
Sequence 2 MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G--F-YVKH-I--ID----TY----IEGDA-----LEKI
Sequence 2 PGTIKKITFGEGSQFNYVKHRIDEIDNANFTYACTLIEGDAI-SETLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVAS-DGG---K--SKY---GD----E---K-G---A----K-VE
Sequence 2 AYEIKLVASPDGGSILKSTSKYHTKGDHEIKEDQIKAGKEEASGIFKAVE

Sequence 1 AYLKDHPEAYN
           AYL---P-AY-
Sequence 2 AYLLANPAAYH



Alignment 30
Sequence 1:
Sequence 2: Allergen Cor a 1.0301, Sequence: CAA96549
Sequence identity: 55.90 (90/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I-PARLFK-FVLD-DNL-PK-AP-A----EI-EGNGG
Sequence 2 MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PF-Y-K-K-E-ID-----Y-YS-IEGDAL----LEKI
Sequence 2 PGTIKKICFDEGSPFNYIKQKVEEIDQANFSYRYSVIEGDAL-SDKLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VAS--GG---K--SKY---GD-----E--K-G---A----K-VE
Sequence 2 NYEIKIVASPHGGSILKSISKYHTIGDHELKDEQIKAGKEKASGLFKAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 GYLLAHSDAYN



Alignment 31
Sequence 1:
Sequence 2: Allergen Que a 1.0301, Sequence: ABZ81046
Sequence identity: 57.76 (93/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFTYESE--S-I-PARLFKAFVLD-DNL-PK--PQA----EI-EGNGG
Sequence 2 MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G---K--KH-I--ID-E--TYS-S-IEGDAL----LE--
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSVIEGDALF-DKLENV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VAS-DGG---K--SKY---GD-Q---E----G---A----K-VE
Sequence 2 STETKIVASPDGGSIVKSTSKYQTKGDFQLTDELIRGGKEKASEVFKAVE

Sequence 1 AYLKDHPEAYN
           AYL--HP--Y-
Sequence 2 AYLVAHPDLYK



Alignment 32
Sequence 1:
Sequence 2: Allergen Pru du 1.0101, Sequence: B6CQS9
Sequence identity: 56.52 (91/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MG-FTY--E-TS-I-P-RLFKA-VL--D-L-PKIAPQ-V---EI-EG-GG
Sequence 2 MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGTIKKI-FG-G----YVKH-I---DK----Y-YS--EGDAL-----EKI
Sequence 2 VGTIKKISFGEGSHYSYVKHQIDGLDKDNFVYNYSLVEGDAL-SDKVEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVAS-DGG-VIK--S-Y---GD----EE-VK-G---AT---K--E
Sequence 2 SYEIKLVASADGGSVIKSTSNYHTKGDVEIKEEDVKAGKEKATGLFKLIE

Sequence 1 AYLKDHPEAYN
           -YL---P-AYN
Sequence 2 NYLVANPDAYN



Alignment 33
Sequence 1:
Sequence 2: Allergen Que m 1.0101, Sequence: AUH28179
Sequence identity: 55.28 (89/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV--YESE--S-I-PARLFKAFVLD-DNL-PK--PQA----EI-EGNGG
Sequence 2 MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G---K--KH-I--ID-E--T-S-S-IEGDAL----LE--
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTFSFSVIEGDALF-DKLENV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VAS-DGG---K---KY---GD-Q---E----G---A----K-VE
Sequence 2 STETKIVASPDGGSIVKSTCKYQTKGDFQLTDELIRGGKEKASGVFKAVE

Sequence 1 AYLKDHPEAYN
           AYL--HP--Y-
Sequence 2 AYLVAHPDGYY



Alignment 34
Sequence 1:
Sequence 2: Allergen Bet v 1.1301, Sequence: CAA54696
Sequence identity: 56.52 (91/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-IAPARLFK-FVLD-DNL-PK-AP--V---E--EGNGG
Sequence 2 MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G--FKY-KH----ID-----Y-YSIIEG--L-G--LEKI
Sequence 2 PGTIKKITFPEGSHFKYMKHRVDEIDHANFKYCYSIIEGGPL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K--SKY---GD---NEE--K-G--------K-VE
Sequence 2 SYEIKIVAAPGGGSILKITSKYHTKGDISLNEEEIKAGKEKGAGLFKAVE

Sequence 1 AYLKDHPEAYN
           -YL--HP-AYN
Sequence 2 NYLVAHPNAYN



Alignment 35
Sequence 1:
Sequence 2: Allergen Bet v 1.1801, Sequence: CAA96540
Sequence identity: 56.52 (91/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA--DGG---K---KY---GD-----E--K-----A---L--VE
Sequence 2 CNEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKAEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 36
Sequence 1:
Sequence 2: Allergen Que a 1.0401, Sequence: ABZ81047
Sequence identity: 55.90 (90/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFT-ES--TS-IAPARLFKA--LD-DNL--K--PQA----EI-EGNGG
Sequence 2 MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG-G---K--KH-I--ID-E--TYS-S-IEGDAL----LE--
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSVIEGDALF-DKLENV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VAS-DGG---K--SKY---GD-Q---E----G---A----K-VE
Sequence 2 STETKIVASPDGGSIAKSTSKYQTKGDFQLTDELIRGGKEKASGVFKAVE

Sequence 1 AYLKDHPEAYN
           AYL--HP--Y-
Sequence 2 AYLVAHPDLYK



Alignment 37
Sequence 1:
Sequence 2: Allergen Cor a 1.0201, Sequence: CAA96548
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDG-NL-PK-APQAV--VE--EGNGG
Sequence 2 MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK---E--D-----YSY--IEG----G---EKI
Sequence 2 PGTIKKITFSEGSPFKYVKERVEEVDHTNFKYSYTVIEGGPV-GDKVEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E--K-G----------VE
Sequence 2 CNEIKIVAAPDGGSILKISNKYHTKGDHEVDAEHIKGGKEKVEGLFRAVE

Sequence 1 AYLKDHPEAYN
           AYL--H--AYN
Sequence 2 AYLLAHSDAYN



Alignment 38
Sequence 1:
Sequence 2: Allergen Cor a 1.0401, Sequence: AAD48405
Sequence identity: 57.76 (93/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I-PARLFK-FVLD-DNL-PK-APQ-----E-LEGNGG
Sequence 2 MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G--FKY-KHK-E-ID-----Y-YSIIEG--L-G--LEKI
Sequence 2 PGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPL-GHTLEKI

Sequence 1 THESKLVASGDGG-NVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTV
           --E-K--A---GG----K--SKY---G-A--NEE--K-G---A----K-V
Sequence 2 SYEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAV

Sequence 1 EAYLKDHPEAYN
           EAYL--HP-AY-
Sequence 2 EAYLLAHPDAYC



Alignment 39
Sequence 1:
Sequence 2: Allergen Cor a 1.0404, Sequence: AAG40331
Sequence identity: 57.76 (93/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I-PARLFK-FVLD-DNL-PK-APQ-----E-LEGNGG
Sequence 2 MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G--FKY-KHK-E-ID-----Y-YSIIEG--L-G--LEKI
Sequence 2 PGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPL-GHTLEKI

Sequence 1 THESKLVASGDGG-NVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTV
           --E-K--A---GG----K--SKY---G-A--NEE--K-G---A----K-V
Sequence 2 PYEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAV

Sequence 1 EAYLKDHPEAYN
           EAYL--HP-AY-
Sequence 2 EAYLLAHPDAYC



Alignment 40
Sequence 1:
Sequence 2: Allergen Bet v 1.2901, Sequence: CAB02160
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNLVPK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPM-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 41
Sequence 1:
Sequence 2: Allergen Bet v 1.1401, Sequence: CAA57497
Sequence identity: 55.90 (90/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YESE-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 42
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05188
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNLVPK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 43
Sequence 1:
Sequence 2: Allergen Bet v 1.2001, Sequence: CAA96543
Sequence identity: 55.28 (89/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 44
Sequence 1:
Sequence 2: Allergen Bet v 1.at10, Sequence: CAA07319
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNLVPK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 GYLLAHSDAYN



Alignment 45
Sequence 1:
Sequence 2: Allergen Bet v 1.1701, Sequence: CAA96539
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----YSYS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGIPFKYVKDRVDEVDHANFKYSYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E--K---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQIKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 RYLLAHSDAYN



Alignment 46
Sequence 1:
Sequence 2: Allergen Bet v 1.2801, Sequence: CAB02159
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 47
Sequence 1:
Sequence 2: Allergen Que a 1.0201, Sequence: ABZ81045
Sequence identity: 55.90 (90/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFT-ES--TS-IAPARLFKA--LD-DNL--K--PQA----EI-EGNGG
Sequence 2 MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG----FKY-KH-I-A-D-E--TYS-S-IEGDAL-----E--
Sequence 2 PGTIKKITFGEASKFKYAKHRIDALDPENCTYSFSVIEGDAL--TVMESV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VAS-DGG---K---KY---GD-Q--EE--------A---LK-VE
Sequence 2 STEIKCVASPDGGSIMKSTTKYQTKGDFQLKEEQIQAAIEKAAGLLKAVE

Sequence 1 AYLKDHPEAYN
           AYL--HP--Y-
Sequence 2 AYLVAHPDLYK



Alignment 48
Sequence 1:
Sequence 2: Allergen Bet v 1.2301, Sequence: CAA96545
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFFLDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PF-YVK------D-----YSYS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFRYVKDRVDEVDHTNFKYSYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V-EE--K---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKEEQIKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 49
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05190
Sequence identity: 55.28 (89/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNLVPK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 50
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05189
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPM-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 51
Sequence 1:
Sequence 2: Allergen Bet v 1.1401, Sequence: P43186
Sequence identity: 55.28 (89/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YESE-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 52
Sequence 1:
Sequence 2: Allergen Bet v 1.1901, Sequence: CAA96542
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----Y-YS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYAYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 53
Sequence 1:
Sequence 2: Allergen Bet v 1.0101, Sequence: CAA33887
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 54
Sequence 1:
Sequence 2: Allergen Bet v 1.1501, Sequence: CAA96538
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 55
Sequence 1:
Sequence 2: Allergen Bet v 1.2501, Sequence: CAB02156
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 56
Sequence 1:
Sequence 2: Allergen Bet v 1.1501, Sequence: Q42499
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 57
Sequence 1:
Sequence 2: Allergen Cor a 1.0402, Sequence: AAG40329
Sequence identity: 56.52 (91/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I-PARLFK-FVLD-DNL-PK-APQ-----E-LEGNGG
Sequence 2 MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G--FKY-KHK-E-ID-----Y-YSIIEG--L-G--LEKI
Sequence 2 PGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPL-GHTLEKI

Sequence 1 THESKLVASGDGG-NVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTV
           --E-K--A---GG----K--SKY---G-A---EE--K-G---A----K-V
Sequence 2 SYEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAV

Sequence 1 EAYLKDHPEAYN
           EAYL--HP--Y-
Sequence 2 EAYLLAHPDTYC



Alignment 58
Sequence 1:
Sequence 2: Allergen Bet v 1.0501, Sequence: CAA54483
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----YSYS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K---KY---GD--V--E--K---------L--VE
Sequence 2 SNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 59
Sequence 1:
Sequence 2: Allergen Bet v 1.3001, Sequence: CAB02161
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 60
Sequence 1:
Sequence 2: Allergen Bet v 1.at50, Sequence: CAA07326
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLF-AF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSLIPAARLFRAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPM-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 61
Sequence 1:
Sequence 2: Allergen Car b 1.0302, Sequence: CAB02217
Sequence identity: 55.28 (89/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDG-NL-PK-APQAV--VE--EGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-P-KYVK---E--D-----YSY--IEG----G---EKI
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIEGGPV-GDKVEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K--SKY---GD--V--E--K-G-------LK-VE
Sequence 2 CNEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKGGKERVEGLLKPVE

Sequence 1 AYLKDHPEAYN-
           AYL--H---YN-
Sequence 2 AYLLAHTAEYNN



Alignment 62
Sequence 1:
Sequence 2: Allergen Cor a 1.0103, Sequence: CAA50325
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFK--VLDGD-L-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITFG-G---KYVK------D----TYSY--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD---N-E--K-----A---L--VE
Sequence 2 CHELKIVAAPGGGSILKISSKFHAKGDHEINAEEIKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 TYLLAHSAEYN



Alignment 63
Sequence 1:
Sequence 2: Allergen Cor a 1.0403, Sequence: AAG40330
Sequence identity: 56.52 (91/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I-PARLFK-FVLD-DNL-PK-APQ-----E-LEGNGG
Sequence 2 MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G--FKY-KHK-E-ID-----Y-YSIIEG--L-G--LEKI
Sequence 2 PGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPL-GHTLEKI

Sequence 1 THESKLVASGDGG-NVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTV
           --E-K--A---GG----K--SKY---G-A---EE--K-G---A----K-V
Sequence 2 SYEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAV

Sequence 1 EAYLKDHPEAYN
           EAYL--HP--Y-
Sequence 2 EAYLLAHPDTYC



Alignment 64
Sequence 1:
Sequence 2: Allergen Bet v 1.0301, Sequence: CAA54481
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YESE-TS-I--ARLFKAF-L-GD-L-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 65
Sequence 1:
Sequence 2: Allergen Bet v 1.at59, Sequence: CAA07327
Sequence identity: 55.28 (89/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-L-GD-L-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 CNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 66
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05186
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNLVPK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 67
Sequence 1:
Sequence 2: Allergen Bet v 1.0901, Sequence: CAA54488
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YESE-TS-I--ARLFKAF-L-GD-L-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 68
Sequence 1:
Sequence 2: Allergen Bet v 1.0801, Sequence: CAA54487
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----YSYS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K---KY---GD--V--E--K---------L--VE
Sequence 2 SNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 69
Sequence 1:
Sequence 2: Allergen Bet v 1.2101, Sequence: CAA96544
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKA--LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKASILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----YS-S-IEG-A--G--LEK-
Sequence 2 PGTIKKISFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAV-GDALEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---K----GD---N-E--K-----A---LK-VE
Sequence 2 CNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 70
Sequence 1:
Sequence 2: Allergen Bet v 1.0101, Sequence: P15494
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD--V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 71
Sequence 1:
Sequence 2: Allergen Bet v 1.at45, Sequence: CAA07325
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPM-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGSILKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 72
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: AAB24432
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFKAF-LDGD-L-PK-AP-AV--VE--EGNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YS-S-IEG-A--G--LEK-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAV-GDALEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---K----GD---N-E--K-----A---LK-VE
Sequence 2 CNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 73
Sequence 1:
Sequence 2: Allergen Bet v 1.at7, Sequence: CAA07330
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-L-GDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 74
Sequence 1:
Sequence 2: Allergen Bet v 1.at37, Sequence: CAA07323
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 75
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43178
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----YSYS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K---KY---GD--V--E--K---------L--VE
Sequence 2 SNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 76
Sequence 1:
Sequence 2: Allergen Bet v 1.at5, Sequence: CAA07329
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA--DGG-------KY---GD-----E--K---------L--VE
Sequence 2 SNEIKLVATPDGGSILEISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 77
Sequence 1:
Sequence 2: Allergen Bet v 1.0701, Sequence: CAA54485
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YESE-TS-I--ARLFKAF-L-GDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 78
Sequence 1:
Sequence 2: Allergen Bet v 1.2401, Sequence: CAB02155
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 79
Sequence 1:
Sequence 2: Allergen Bet v 1.0201, Sequence: CAA54421
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-L-GD-L-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 80
Sequence 1:
Sequence 2: Allergen Bet v 1.0401, Sequence: CAA54482
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNLVPK-APQA---VE--EGNGG
Sequence 2 MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 81
Sequence 1:
Sequence 2: Allergen Bet v 1.2701, Sequence: CAB02158
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPGGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 82
Sequence 1:
Sequence 2: Allergen Car b 1.0113, Sequence: ABZ81044
Sequence identity: 51.55 (83/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----YSY--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGIPFKFVKERVDEVDNANFKYSYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD--VN-E--K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 83
Sequence 1:
Sequence 2: Allergen Bet v 1.2601, Sequence: CAB02157
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDILEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 84
Sequence 1:
Sequence 2: Allergen Bet v 1.at42, Sequence: CAA07324
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 SNEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 85
Sequence 1:
Sequence 2: Allergen Bet v 1.0601, Sequence: CAA54484
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----YSYS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K---KY---GD--V--E--K---------L--VE
Sequence 2 SNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 86
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43176
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YESE-TS-I--ARLFKAF-L-GD-L-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 87
Sequence 1:
Sequence 2: Allergen Car b 1.0103, Sequence: CAB02206
Sequence identity: 51.55 (83/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD--VN-EK-K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTDEYN



Alignment 88
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43183
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----YSYS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K---KY---GD--V--E--K---------L--VE
Sequence 2 SNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 89
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43184
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YESE-TS-I--ARLFKAF-L-GD-L-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 90
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: P38948
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E--S-I--ARLFKAF-LDGD-L-PK-AP-AV--VE--EGNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YS-S-IEG-A--G--LEK-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAV-GDALEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---K----GD---N-E--K-----A---LK-VE
Sequence 2 CNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 91
Sequence 1:
Sequence 2: Allergen Bet v 1.at8, Sequence: CAA07318
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-V---DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVTTPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 92
Sequence 1:
Sequence 2: Allergen Car b 1.0111, Sequence: ABZ81042
Sequence identity: 51.55 (83/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD--VN-EK-K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 93
Sequence 1:
Sequence 2: Allergen Bet v 1.1601, Sequence: CAA96546
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFKAF-LDGD-L-PK-AP-AV--VE--EGNGG
Sequence 2 MGVFNYETETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YS-S-IEG-A--G--LEK-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAV-GDALEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---K----GD---N-E--K-----A---LK-VE
Sequence 2 CNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAEGLLKAVE

Sequence 1 AYLKDHPEAYN
           -Y---H--AYN
Sequence 2 SYHLAHSDAYN



Alignment 94
Sequence 1:
Sequence 2: Allergen Bet v 1.1001, Sequence: CAA54489
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--AR-FKAF-LDGD-LVPK-APQA---VE--EGNGG
Sequence 2 MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 95
Sequence 1:
Sequence 2: Allergen Car b 1.0301, Sequence: CAB02216
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDG--L-PK--PQAV--VE--EGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-P-KYVK---E--D-----YSY--IEG----G---EKI
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIEG-GFVGDKVEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K--SKY---GD--V--E--K-G-------LK-VE
Sequence 2 CNEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKGGKERVEGLLKPVE

Sequence 1 AYLKDHPEAYN-
           AYL--H---YN-
Sequence 2 AYLLAHTAEYNN



Alignment 96
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43180
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YESE-TS-I--ARLFKAF-L-GDNL-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 97
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P45431
Sequence identity: 53.42 (86/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E-TS-I--ARLFKAF-L-GD-L-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-AL-G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGAL-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---KY---GD-----E--K---------L--VE
Sequence 2 CNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 98
Sequence 1:
Sequence 2: Allergen Cor a 1.0101, Sequence: CAA50327
Sequence identity: 52.17 (84/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITFG-G---KYVK------D----TYSY--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD---N-E--K-----A---L--VE
Sequence 2 CHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 TYLLAHSAEYN



Alignment 99
Sequence 1:
Sequence 2: Allergen Bet v 1.2201, Sequence: CAA96547
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------------YSYS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DG----K---KY---GD--V--E--K---------L--VE
Sequence 2 SNEIKIVATPDGRSILKISNKYHTKGDHEVKAEQIKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 100
Sequence 1:
Sequence 2: Allergen Ost c 1.0101, Sequence: ADK39021
Sequence identity: 51.55 (83/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA--KVE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD--VN-E--K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 101
Sequence 1:
Sequence 2: Allergen Bet v 1.0401, Sequence: P43177
Sequence identity: 54.04 (87/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E-TS-I--ARLFKAF-LDGDNLVPK-APQA---VE--EGNGG
Sequence 2 -GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 102
Sequence 1:
Sequence 2: Allergen Bet v 1.0601, Sequence: P43179
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----YSYS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K---KY---GD--V--E--K---------L--VE
Sequence 2 SNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 103
Sequence 1:
Sequence 2: Allergen Que i 1.0101, Sequence: QGS84240
Sequence identity: 54.66 (88/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-ES--TS-I-PARLFKAFVLD-DNL-PK--PQA----E--EGNGG
Sequence 2 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITFG----FKY-KH-I-A-D-E--TYS-S-IEGDAL--------
Sequence 2 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDAL--TDMVSV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VAS-DGG---K---KY---GD-Q--EE---------T---K-VE
Sequence 2 STEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVE

Sequence 1 AYLKDHPEAYN
           AYL--HP--Y-
Sequence 2 AYLLAHPDLYT



Alignment 104
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38950
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E-TS-I--ARLFKAF-LDG--L-PK--PQAV--VE--EGNGG
Sequence 2 -GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-P-KYVK---E-ID-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----G---VN-E--K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 105
Sequence 1:
Sequence 2: Allergen Car b 1.0110, Sequence: ABZ81041
Sequence identity: 51.55 (83/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG-V-K--SK----GD--VN-E--K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSVVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 106
Sequence 1:
Sequence 2: Allergen Car b 1.0104, Sequence: CAB02207
Sequence identity: 50.93 (82/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDNLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD--VN-E--K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTDEYN



Alignment 107
Sequence 1:
Sequence 2: Allergen Car b 1.0112, Sequence: ABZ81043
Sequence identity: 50.93 (82/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD--VN-E--K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 108
Sequence 1:
Sequence 2: Allergen Bet v 1.1201, Sequence: CAA54695
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQAV--VE--EGNGG
Sequence 2 -GVFDYEGETTSVIPAARLFKAFILDGDNLIPKVAPQAVSCVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-A--G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSYSVIEGGAV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-V----GG---K---KY---G------E--K-----A------VE
Sequence 2 CNEIKIVPAPGGGSILKISNKYHTKGNHEMKAEQIKASKEKAEALFRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 109
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43185
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E-TS-I--AR-FKAF-LDGD-LVPK-APQA---VE--EGNGG
Sequence 2 -GVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG-V-K---KY---G---V--E-VK---------L--VE
Sequence 2 SNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 110
Sequence 1:
Sequence 2: Allergen Bet v 1.1101, Sequence: CAA54694
Sequence identity: 52.80 (85/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQ-V--VE--EGNGG
Sequence 2 MGVFDYEGETTSVIPAARLFKAFILDGDNLIPKVAPQTVSCVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF--G-PFKYVK------D-----YSYS-IEG-A--G--LEKI
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHVNFKYSYSVIEGGAV-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-V----GG---K---KY---G------E--K-----A------VE
Sequence 2 CNEIKIVPAPGGGSILKISNKYHTKGNHEMKAEQIKASKEKAEALFRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H--AYN
Sequence 2 SYLLAHSDAYN



Alignment 111
Sequence 1:
Sequence 2: Allergen Car b 1.0109, Sequence: ABZ81040
Sequence identity: 50.93 (82/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD--VN-E--K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 112
Sequence 1:
Sequence 2: Allergen Cor a 1, Sequence: Q08407
Sequence identity: 51.55 (83/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE--EGNGG
Sequence 2 -GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITFG-G---KYVK------D----TYSY--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD---N-E--K-----A---L--VE
Sequence 2 CHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 TYLLAHSAEYN



Alignment 113
Sequence 1:
Sequence 2: Allergen Car b 1.0105, Sequence: CAB02208
Sequence identity: 50.93 (82/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLD-D-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD--VN-EK-K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTDEYN



Alignment 114
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38949
Sequence identity: 49.69 (80/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQ----VE---GNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----G---VN-EK-K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 115
Sequence 1:
Sequence 2: Allergen Car b 1.0106, Sequence: CAB02209
Sequence identity: 50.31 (81/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLD-D-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----GD--VN-E--K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 116
Sequence 1:
Sequence 2: Allergen Que ac 1.0101, Sequence: QOL10866
Sequence identity: 52.17 (84/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV--YES--TS-I-PARLFKAFVLD-DNL--K--P-AV---EI-EGNGG
Sequence 2 MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKK-TFG-----KY-KH-I---D-E---YS-S-IEG-AL-------I
Sequence 2 PGTIKKFTFGEASKVKYAKHRIDTLDPENCSYSFSVIEGEAL--TDIASI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VAS-DGG---K---KY---G--Q--EE---------T---K-VE
Sequence 2 STEVKFVASPDGGSIMKSTTKYQTKGGFQLKEEQIQAAVEKGTGLFKAVE

Sequence 1 AYLKDHPEAYN
           AYL--HP--YN
Sequence 2 AYLLAHPDLYN



Alignment 117
Sequence 1:
Sequence 2: Allergen Cor a 1.0102, Sequence: CAA50328
Sequence identity: 50.93 (82/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITFG-G---KYVK------D-----YSY--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K--SK----GD---N-E--K-----A---L--VE
Sequence 2 CSELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 TYLLAHSAEYN



Alignment 118
Sequence 1:
Sequence 2: Allergen Car b 1.0102, Sequence: CAA47357
Sequence identity: 49.69 (80/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE---GNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D-----Y-Y--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -HE-K-VA---GG---K--SK----G---VN-E--K-----A---L--VE
Sequence 2 SHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 119
Sequence 1:
Sequence 2: Allergen Cor a 1.0104, Sequence: CAA50326
Sequence identity: 50.31 (81/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLDGD-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITFG-G---KYVK------D-----YSY--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K--SK----GD---N-E--K-----A---L--VE
Sequence 2 CSELKIVAAPGGGSTLKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 TYLLAHSAEYN



Alignment 120
Sequence 1:
Sequence 2: Allergen Car b 1.0107, Sequence: CAB02213
Sequence identity: 49.07 (79/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S-I--ARLFK--VLD-D-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D------SY--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA---GG---K---K----GD--VN-E--K-----A---L--VE
Sequence 2 SLELKIVAAPGGGSILKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 121
Sequence 1:
Sequence 2: Allergen Act c 8.0101, Sequence: CAM31908
Sequence identity: 49.07 (79/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-TY--E--S---P--L-KAF-LDGD-LVPK--P-A---V-ILEG-G-
Sequence 2 MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGC

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK--TFG-G---K-VK----AIDK--LTYSY-IIEGD-L-----E-I
Sequence 2 AGTIKEVTFGEGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVL-AEKFESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ----K-VA--DGG---K--S-Y---GD--V-EE--K-G---A----K--E
Sequence 2 SYHIKIVACPDGGSICKNRSIYTTKGDCKVSEEEIKLGKEKAAEIFKALE

Sequence 1 AYLKDHPEAYN
           AYL---P----
Sequence 2 AYLLANPDYC-



Alignment 122
Sequence 1:
Sequence 2: Allergen Rub i 1.0101, Sequence: Q0Z8U9
Sequence identity: 50.93 (82/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           ----------TS-I-P--LFKAFVLD-DNL-PKIAPQAV--VEI-EG-GG
Sequence 2 ---------YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGT-KKI--G-G----YVKHKI---DK----YSYSI-EGDAL-G---EKI
Sequence 2 VGTVKKIHLGEGTEHSYVKHKIDGLDKVNFVYSYSITEGDAL-GDKIEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLVASG-G---IKT-S-Y---G-A---EE-VK-G---A----K---
Sequence 2 SYEIKLVASGRG-SIIKTTSHYHCKGGAEIKEEQVKDGKERAAGLFKI--

Sequence 1 AYLKDHPEAYN
           -----------
Sequence 2 -----------



Alignment 123
Sequence 1:
Sequence 2: Allergen Car b 1.0108, Sequence: CAB02215
Sequence identity: 47.83 (77/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E--S----ARLFK--VLD-D-L-PK-APQA---VE---GNGG
Sequence 2 MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIK-ITF--G-PFK-VK------D------SY--IEGD-L-G--LEK-
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTVIEGDVL-GDKLEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E---VA---GG---K---K----GD--VN-E--K-----A---L--VE
Sequence 2 SLELTIVAAPGGGSILKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAVE

Sequence 1 AYLKDHPEAYN
           -YL--H---YN
Sequence 2 SYLLAHTAEYN



Alignment 124
Sequence 1:
Sequence 2: Allergen Act d 8.0101, Sequence: CAM31909
Sequence identity: 50.93 (82/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MG--TY--E--SSI-----FKAFVLDGD---PK--P-A---V--LEG-GG
Sequence 2 MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGTIK--TFG-G---K-VKH-I---DKE--TYSYSIIEG-AL-----E-I
Sequence 2 VGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALD--VFESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ----K-VA--DGG---K--S-Y----DAQV-EE--K-G---A----K-VE
Sequence 2 SYHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVE

Sequence 1 AYLKDHPEAYN
           AYL---P----
Sequence 2 AYLLANPDC--



Alignment 125
Sequence 1:
Sequence 2: Allergen Sola l 4.0201, Sequence: NP_001275580
Sequence identity: 48.45 (78/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T---E-T--IAP-RLFK--VLD-D-LVPK-----V---EI-EG-GG
Sequence 2 MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -G-IK---F--G-P-KY-KHKI--ID---L---YS-IEGD-L-G--LE-I
Sequence 2 AGSIKQMNFVEGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVL-GDKLESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ----K--A-GDGG-V-KT---Y---GD--V-EE----G---A----K--E
Sequence 2 AYDVKFEAAGDGGCVCKTTTEYHTKGDHVVSEEEHNVGKGKAIDLFKAIE

Sequence 1 AYLKDHPEAYN
           AYL---P--Y-
Sequence 2 AYLLANPSVYA



Alignment 126
Sequence 1:
Sequence 2: Allergen Gly m 4, Sequence: CAA42646
Sequence identity: 50.93 (82/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFT-E-E--S--APA-L-KA-V-D-DN--PK-A------VE--EGNGG
Sequence 2 MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKITF------K-V-HKIE-ID---L-YSYS---G-AL-----EKI
Sequence 2 PGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALP-DTAEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T--SKLVA---GG---K---KY---GDA--N----K-G---A----K--E
Sequence 2 TFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIE

Sequence 1 AYLKDHPEAYN
           AYL--HP--YN
Sequence 2 AYLLAHPD-YN



Alignment 127
Sequence 1:
Sequence 2: Allergen Sola l 4.0101, Sequence: AHC08073
Sequence identity: 49.69 (80/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-TY--E-T--I-P-RLFKA-VLD-DNLVPK---Q-V---E--EG-GG
Sequence 2 MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VG-IK---F--G-P-KY-KHKI--ID---L---YS-IEGD-L-G--LE-I
Sequence 2 VGSIKQMNFVEGGPIKYLKHKIHVIDDKNLETKYSLIEGDIL-GEKLESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T---K--A---GG-V-KT---Y---GD--V-EE----G--------K-VE
Sequence 2 TYDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNVGRERIMNISKAVE

Sequence 1 AYLKDHPEAYN
           AYL---P--Y-
Sequence 2 AYLLANPSVYA



Alignment 128
Sequence 1:
Sequence 2: Allergen Bet v 1.at87, Sequence: CAA07328
Sequence identity: 43.48 (70/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPM-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---------------------------------
Sequence 2 SNEIKIVATPDGGSILKISNN-----------------------------

Sequence 1 AYLKDHPEAYN
           -----------
Sequence 2 -----------



Alignment 129
Sequence 1:
Sequence 2: Allergen Bet v 1.at14, Sequence: CAA07320
Sequence identity: 43.48 (70/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVF-YE-E-TS-I--ARLFKAF-LDGDNL-PK-APQA---VE--EGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F--G-PFKYVK------D-----Y-YS-IEG----G--LEKI
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-K-VA--DGG---K---------------------------------
Sequence 2 SNEIKIVATPDGGSILKISNN-----------------------------

Sequence 1 AYLKDHPEAYN
           -----------
Sequence 2 -----------



Alignment 130
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43637
Sequence identity: 48.45 (78/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFT-E---TS--APA-L-KA---D-D---PK--P-----VEI-EGNGG
Sequence 2 MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F------K-V-HKIE-ID---L-YSYSI--G-AL-----EKI
Sequence 2 PGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALP-ETAEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T--SKL-----GG--IK----Y-S-GDA--NE---K-G--------K-VE
Sequence 2 TFDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKAGKAKSDSLFKAVE

Sequence 1 AYLKDHPEAYN
           AYL---P----
Sequence 2 AYLLANP----



Alignment 131
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: P25985
Sequence identity: 47.83 (77/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVFT-E---TS--APA-L-KA---D-D---PK--P-----VEI-EGNGG
Sequence 2 -GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F------K-V-HKIE-ID---L-YSYSI--G-AL-----EKI
Sequence 2 PGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALP-ETAEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T--SKL-----GG--IK----Y-S-GDA--NE---K-G--------K-VE
Sequence 2 TFDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKAGKAKSDSLFKAVE

Sequence 1 AYLKDHPEAYN
           AYL---P----
Sequence 2 AYLLANP----



Alignment 132
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43636
Sequence identity: 48.45 (78/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           M-VFT-E---TS--APA-L-KA-V-D-D--VPK-A------VEI-EGNGG
Sequence 2 MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F------K-V-HKIE-ID---L-YSYSI--G-AL-----EKI
Sequence 2 PGTIKKISFVEDGETKFVLHKIEEIDEANLGYSYSIVGGAALP-DTAEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ---SKL-----GG-V-K---KY-S-GDA--NE---K-G--------K--E
Sequence 2 SIDSKLSDGPNGGSVVKLSIKYHSKGDAPPNEDELKAGKAKSDALFKVIE

Sequence 1 AYLKDHPEAYN
           AYL---P----
Sequence 2 AYLLANP----



Alignment 133
Sequence 1:
Sequence 2: Allergen Lyc e 4.0101, Sequence: CAA75803
Sequence identity: 44.72 (72/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-TY--E-T--I-P-RLFKA-VLD-DNLVPK---Q-V---E--EG-GG
Sequence 2 MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VG-IK---F--G-P-KY-KHKI--ID---L---YS-IEGD-L-G--LE-I
Sequence 2 VGSIKQMNFVEGGPIKYLKHKIHVIDDKNLETKYSLIEGDIL-GEKLESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T---K--A---GG-V-KT---Y---GD--V-EE----G------------
Sequence 2 TYDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNVGRRENHEYFQGCR

Sequence 1 AYLKDHPEAYN------------------
           -----------------------------
Sequence 2 SIPSRESFCLRLNIDEKESGLHVRNYACT



Alignment 134
Sequence 1:
Sequence 2: Allergen Tar o RAP, Sequence: AAB92255
Sequence identity: 44.10 (71/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           ------E-E-TSS--P---FKAFV-D-D---PK--P---------EG-GG
Sequence 2 --MAVAEFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGTIK-IT---GVPF---KHK--AID------SY-I-EGD-L-G---E--
Sequence 2 VGTIKSITYSDGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGI-IESG

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKV---KEGEKQATQMLK
           TH--K---S-DGG-V-K--------GDA----E-V---KEG-K------K
Sequence 2 THHLKFLPSADGGSVYKHSMVFKCKGDAKLTDENVSLMKEGLKKT---FK

Sequence 1 TVEAYLKDHPEAYN
           --E-Y---HPEA--
Sequence 2 AIETYVISHPEAC-



Alignment 135
Sequence 1:
Sequence 2: Allergen Vig r 1.0101, Sequence: Q2VU97
Sequence identity: 45.34 (73/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           M-VFT-----TS--APA-L--A---D-DN--PK-A------VEI-EGNGG
Sequence 2 MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKKI-F------K-V-HKIE--D---L-YSYSI--G-AL-----EKI
Sequence 2 PGTIKKISFVEDGETKFVLHKIESVDEANLGYSYSIVGGVALP-DTAEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T---K-----DGG--IK----Y---GDA--NE---K-G--------K-VE
Sequence 2 TIDTKISDGADGGSLIKLTISYHGKGDAPPNEDELKAGKAKSDALFKAVE

Sequence 1 AYLKDHPEAYN
           AYL---P----
Sequence 2 AYLLANP----



Alignment 136
Sequence 1:
Sequence 2: Allergen Pet c PR10, Sequence: CAA67246
Sequence identity: 44.10 (71/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV---E---TSS---A-LFKA--LD-D-L-P---P-A----EILEG-GG
Sequence 2 MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGT-K--T-G---P-K--K-KI-AIDKE--T-SYSII-GD-L-G-----I
Sequence 2 VGTVKLVTLGDASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLG-YIDSI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ------V---DGG------------GDA-V-EE--K----Q-----K-VE
Sequence 2 NNHLSFVPTADGGCTATSTAVFNTKGDAVVPEENIKFANDQNNLIFKAVE

Sequence 1 AYLKDHPEAYN
           AYL--------
Sequence 2 AYLLAN-----



Alignment 137
Sequence 1:
Sequence 2: Allergen Ara h 8.0101, Sequence: AAQ91847
Sequence identity: 42.86 (69/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGVFT-E-E-TS---PA-L--A---D-D---PKI----V--VEI-EGNGG
Sequence 2 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GTIKK-T-------K---HK-E-ID-----Y-YS---G-AL-----EKI
Sequence 2 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTA-EKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           T-E-KLV----GG---K---KY---GDA---EE--K-G-----------E
Sequence 2 TFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIE

Sequence 1 AYLKDHPEAYN
           -Y----P--Y-
Sequence 2 GYVLANPTQY-



Alignment 138
Sequence 1:
Sequence 2: Allergen Ara h 8.0201, Sequence: EF436550
Sequence identity: 43.48 (70/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T-E-E-TS---PA-LFKA-V-DGD-L-PK--P-A----EI-EGNGG
Sequence 2 MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GT-KK-T--------YV-HKI-AID----TY-Y-I--G-------LEK-
Sequence 2 PGTVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQ-EILEKV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQ-MLKTV
           ----KL-A--DGG--IK--------GDA----E-V----KQ--Q---K--
Sequence 2 SFKTKLEAA-DGGSKIKVSVTFHTKGDAPLPDE-VHQDVKQKSQGIFKAI

Sequence 1 EAYLKDHPEAYN
           E-Y---------
Sequence 2 EGYVLSN-----



Alignment 139
Sequence 1:
Sequence 2: Allergen Api g 1, Sequence: P49372
Sequence identity: 40.99 (66/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-T---E-TSS------F--FV-D-D---PK-AP-A---VEI--G-GG
Sequence 2 MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GT-K-IT---G-P-------I----KE-LT--YS-I-GD-L-G---E-I
Sequence 2 PGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGF-IESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           -----LV---DGG---KT-------GDA-V-EE--K----Q-T---K--E
Sequence 2 ENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALE

Sequence 1 AYLKDHPEAYN
           AYL--------
Sequence 2 AYLIAN-----



Alignment 140
Sequence 1:
Sequence 2: Allergen Dau c 1.0201, Sequence: AAL76932
Sequence identity: 38.51 (62/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV---E-E--S----------F-LD-D---PK--PQ----VEILEG-GG
Sequence 2 MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDAL-EGNQLEK
           VGT------G--------K-K---IDK--L-Y-Y--I-GD-L-EG--LE-
Sequence 2 VGTVRLVHLGEATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEG--LES

Sequence 1 ITHESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTV
           -------V---DGG---K----Y---GDA---E-KVKE---------K-V
Sequence 2 VVNQFVVVPT-DGGCIVKNTTIYNTKGDAVLPEDKVKEATEKSALAFKAV

Sequence 1 EAYLKDHPEAYN
           EAYL--------
Sequence 2 EAYLLAN-----



Alignment 141
Sequence 1:
Sequence 2: Allergen Api g 1.0201, Sequence: P92918
Sequence identity: 37.27 (60/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MGV-----E--S----------F-LD-D---PK--PQ----VEILEG-GG
Sequence 2 MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           VGT-K----G--------K-K---IDK--L-Y-Y--I-GD-L----LE--
Sequence 2 VGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILV-DVLESV

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E---V---DGG---K----Y---GDA---E-K-KE---------K-VE
Sequence 2 VNEFVVVPT-DGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVE

Sequence 1 AYLKDHPEAYN
           AYL--------
Sequence 2 AYLLANLQFLA



Alignment 142
Sequence 1:
Sequence 2: Allergen Dau c 1.0105, Sequence: CAB06416
Sequence identity: 37.27 (60/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MG------E-TSS------F---VLD-D---PK-AP-A---VE---G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GT---IT---G-P---------A--KE-LTY----I-GD-L-G---E-I
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGF-IESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ------V---DGG---KT-------GDA-V-EE--K----Q-T---K--E
Sequence 2 ETHLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIE

Sequence 1 AYLKDHPEAYN
           AYL--------
Sequence 2 AYLIAN-----



Alignment 143
Sequence 1:
Sequence 2: Allergen Dau c 1.0104, Sequence: CAB03716
Sequence identity: 36.65 (59/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MG------E-TSS------F---VLD-D---PK-AP-A---V----G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GT---IT---G-P---------A--KE-LTY----I-GD-L-G---E-I
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGF-IESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ------V---DGG---KT-------GDA-V-EE--K----Q-T---K--E
Sequence 2 ETHLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADEQNTALFKAIE

Sequence 1 AYLKDHPEAYN
           AYL--------
Sequence 2 AYLIAN-----



Alignment 144
Sequence 1:
Sequence 2: Allergen Dau c 1.0102, Sequence: BAA13604
Sequence identity: 36.02 (58/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MG------E-TSS------F---VLD-D---PK-AP-A---V----G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GT---IT---G-P---------A--KE-LTY----I-GD-L-----E-I
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILL-EFIESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ------V---DGG---KT-------GDA-V-EE--K----Q-T---K--E
Sequence 2 ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIE

Sequence 1 AYLKDHPEAYN
           AYL--------
Sequence 2 AYLIAN-----



Alignment 145
Sequence 1:
Sequence 2: Allergen Dau c 1.0103, Sequence: CAB03715
Sequence identity: 36.02 (58/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           MG------E-TSS------F---VLD-D---PK-A--A---VE---G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -GT---IT---G-P---------A--KE-L-Y----I-GD-L-G---E-I
Sequence 2 AGTVRIITLPEGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGF-IESI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           ------V---DGG---KT-------GDA-V-EE--K----Q-T---K--E
Sequence 2 ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIE

Sequence 1 AYLKDHPEAYN
           AYL--------
Sequence 2 AYLIAN-----



Alignment 146
Sequence 1:
Sequence 2: Allergen Dau c 1.0101, Sequence: AAB01092
Sequence identity: 36.02 (58/161)
Sequence 1 --------------MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAP
           --------------MG------E-TSS------F---VLD-D---PK-AP
Sequence 2 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP

Sequence 1 QAVEKVEILEGNGGVGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSI
           -A---V----G-GG-GT---IT---G-P---------A--KE-LTY----
Sequence 2 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV

Sequence 1 IEGDALEGNQLEKITHESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVK
           I-GD-L-----E-I------V---DGG---KT-------GDA-V-EE--K
Sequence 2 IDGDILL-EFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIK

Sequence 1 EGEKQATQMLKTVEAYLKDHPEAYN
           ----Q-T---K--EAYL--------
Sequence 2 FADAQNTALFKAIEAYLIAN-----



Alignment 147
Sequence 1:
Sequence 2: Allergen Fra a 1.0101, Sequence: Q5ULZ4
Sequence identity: 34.78 (56/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           ---------------------AFVLD-DNL-PK-----------------
Sequence 2 ---------------------AFVLDADNLIPK-----------------

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           -----KITFG-G----YVK------------------EGDAL----LEKI
Sequence 2 -----KITFGEGSQYGYVK-----------------VEGDAL-SDTLEKI

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --E-KLV--------IKT-SKY---GD----EE-VK-G---A----K--E
Sequence 2 DYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIE

Sequence 1 AYLKDHPEAYN
           -YLKDHP--YN
Sequence 2 GYLKDHPSEYN



Alignment 148
Sequence 1:
Sequence 2: Allergen Que a 1.0101, Sequence: P85126
Sequence identity: 20.50 (33/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVFT-ES--TS-IAPARLFKA--LD-DNL--K--PQA----EI-EGNGG
Sequence 2 -GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           --------------------------------------------------
Sequence 2 P-------------------------------------------------

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 AYLKDHPEAYN
           -----------
Sequence 2 -----------



Alignment 149
Sequence 1:
Sequence 2: Allergen Vig r 6.0101, Sequence: Q9ZWP8
Sequence identity: 27.95 (45/161)
Sequence 1 -MGVFTYESEFTSSIAP--ARLFKAFVLDGDNLVPKIAPQAVEKVEILEG
           ----F----E---------A-L-K-F-------VPK--P--V--V---EG
Sequence 2 MVKEFNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEG

Sequence 1 NGGVGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDAL-EGNQ
           -GGVGTI----F---V---Y----I---D--S-------IEG--L--G--
Sequence 2 DGGVGTILIFNFLPEVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLS

Sequence 1 LEKITHESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQM-
           --K-T---KL---------------Y----D----E--------Q-T-M-
Sequence 2 YYKTTF--KLSEIEEDKTLVNVKISYDH--DSDIEEKVTPTKTSQSTLMY

Sequence 1 LKTVEAYLKDHPEAYN
           L---E-YL--------
Sequence 2 LRRLERYLSNGSA---



Alignment 150
Sequence 1:
Sequence 2: Allergen Cas s 1, Sequence: Q9S8Q4
Sequence identity: 11.80 (19/161)
Sequence 1 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG
           -GVFT-ES--TS-I-PARLFKAFVL-------------------------
Sequence 2 -GVFTHESQETSVIPPARLFKAFVL-------------------------

Sequence 1 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 AYLKDHPEAYN
           -----------
Sequence 2 -----------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.