The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Asp f 22.0101

Sequence 13925873

Full FASTA alignment

Sequence name:
Query sequence:
MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ
IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Asp f 22.0101AAK49451Go!438595.51.8e-171
2Pen c 22.0101AAK51201Go!438562.71.3e-161
3Alt a 5Q9HDT3Go!438530.75.5e-152
4Cla h 6P42040Go!440518.52.7e-148
5Cla h 6CAA55070Go!440513.58.5e-147
6Cur l 2.0101AAK67491Go!440486.98.5e-139
7Rho m 1.0101Q870B9Go!439449.31.7e-127
8Cyp c 2.0101A0A2U9IY94Go!433385.62.6e-108
9Pan h 2.0101XP_034156632Go!434385.04.0e-108
10Sal s 2.0101B5DGQ7Go!434383.11.5e-107
11Gal d 9.0101P07322Go!434369.22.3e-103
12Hev b 9Q9LEJ0Go!445354.56.3e-99
13Hev b 9Q9LEI9Go!445354.37.3e-99
14Amb a 12.0102A0A1B2H9Q5Go!445352.42.7e-98
15Amb a 12.0101A0A1B2H9Q1Go!431333.71.1e-92

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Asp f 22.0101, Sequence: AAK49451
Sequence identity: 100.00 (438/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
Sequence 2 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
Sequence 2 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
Sequence 2 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
           QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
Sequence 2 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK

Sequence 1 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
           YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
Sequence 2 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS

Sequence 1 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
           EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
Sequence 2 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF

Sequence 1 AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ
           AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ
Sequence 2 AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ

Sequence 1 IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
           IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
Sequence 2 IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG

Sequence 1 APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
Sequence 2 APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL



Alignment 2
Sequence 1:
Sequence 2: Allergen Pen c 22.0101, Sequence: AAK51201
Sequence identity: 93.84 (411/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           MPI-K-HARSVY-SRGNPTVEVDV-TETGLHRAIVPSGASTGQHEA-ELR
Sequence 2 MPIAKVHARSVYVSRGNPTVEVDVVTETGLHRAIVPSGASTGQHEAVELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDK--WGGKGVLKAVKNVNETIGPALIKENIDVKDQ-KVDEFLNKLDGT
Sequence 2 DGDKAKWGGKGVLKAVKNVNETIGPALIKENIDVKDQAKVDEFLNKLDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           ANK-NLGANAILGVSLA-AKA-AAEKGVPLY-HISDLAGTKKPYVLPVPF
Sequence 2 ANKGNLGANAILGVSLAIAKAAAAEKGVPLYVHISDLAGTKKPYVLPVPF

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
           QNVLNGGSHAGGRLAFQEFMIVPD-A-SFSE-LRQGAEVYQKLKALAKKK
Sequence 2 QNVLNGGSHAGGRLAFQEFMIVPDTAESFSEGLRQGAEVYQKLKALAKKK

Sequence 1 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
           YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKI-IAMDVASS
Sequence 2 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKISIAMDVASS

Sequence 1 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
           EFYK-D-KKYDLDFKNP-SDP-KWLTYEQLADLYKSLAAKYPIVSIEDPF
Sequence 2 EFYKTDAKKYDLDFKNPDSDPTKWLTYEQLADLYKSLAAKYPIVSIEDPF

Sequence 1 AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ
           AEDDWEAWSYFYKTSDFQIVGDDLTVTNP-RIKKAIELKSCNALLLKVNQ
Sequence 2 AEDDWEAWSYFYKTSDFQIVGDDLTVTNPLRIKKAIELKSCNALLLKVNQ

Sequence 1 IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
           IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
Sequence 2 IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG

Sequence 1 APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           AP-RSERLAKLNQILRIEEELGEN--YAG--FRT-VNL
Sequence 2 APARSERLAKLNQILRIEEELGENAIYAGKNFRTSVNL



Alignment 3
Sequence 1:
Sequence 2: Allergen Alt a 5, Sequence: Q9HDT3
Sequence identity: 88.13 (386/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           M-I-KIHARSVYDSRGNPTVEVD--TETGLHRAIVPSGASTG-HEA-ELR
Sequence 2 MTITKIHARSVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDK--WGGKGV-KAV-NVN-TI-PALIKE--DVKDQS-VD-FLNKLDGT
Sequence 2 DGDKSKWGGKGVTKAVANVNDTIAPALIKEKLDVKDQSAVDAFLNKLDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           -NK-NLGANAILGVS-A-AKA-AAEKGVPLYAHISDLAGTKKPYVLPVPF
Sequence 2 TNKTNLGANAILGVSMAIAKAAAAEKGVPLYAHISDLAGTKKPYVLPVPF

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
           QNVLNGGSHAGGRLAFQEFMIVP--AP-FSEA-RQGAEVYQKLKALAKK-
Sequence 2 QNVLNGGSHAGGRLAFQEFMIVPCEAPTFSEAMRQGAEVYQKLKALAKKT

Sequence 1 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
           YGQSAGNVGDEGGVAPDIQTAEEALDLIT-AIE-AGYTGKIKIAMDVASS
Sequence 2 YGQSAGNVGDEGGVAPDIQTAEEALDLITKAIEEAGYTGKIKIAMDVASS

Sequence 1 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
           EFYKAD-KKYDLDFKNP-SD-SKWLTYEQLA--YKSLA-KYPIVSIEDPF
Sequence 2 EFYKADEKKYDLDFKNPDSDKSKWLTYEQLAEMYKSLAEKYPIVSIEDPF

Sequence 1 AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ
           AEDDWEAWSYF-KT-D-QIVGDDLTVTNP--IKKAIELKSCNALLLKVNQ
Sequence 2 AEDDWEAWSYFFKTYDGQIVGDDLTVTNPEFIKKAIELKSCNALLLKVNQ

Sequence 1 IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
           IGT-TE-IQAAKD-----WGVMVSHRSGETEDVTIADI-VGLRSGQIKTG
Sequence 2 IGTITEAIQAAKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIKTG

Sequence 1 APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           AP-RSERLAKLNQILRIEEELG-N-VYAG--FRTAVNL
Sequence 2 APARSERLAKLNQILRIEEELGDNAVYAGNNFRTAVNL



Alignment 4
Sequence 1:
Sequence 2: Allergen Cla h 6, Sequence: P42040
Sequence identity: 85.62 (375/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           MPISKIH-R-VYDSRGNPTVEVD--TETGLHRAIVPSGASTG-HEA-ELR
Sequence 2 MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDK--W-GKGV-KAV-NVNE-I-PALIKEN-DVKDQ--VD-FLNKLDGT
Sequence 2 DGDKSKWAGKGVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           -NK---GANAILGVS-AVAKA-AAEK-VPLYAHISDL-GTKKP-VLPVPF
Sequence 2 TNKTKIGANAILGVSMAVAKAAAAEKRVPLYAHISDLSGTKKPFVLPVPF

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
           -NV-NGGSHAGGRLAFQEFMIVP--APSF-EA-RQGAEVYQKLK-L-KK-
Sequence 2 MNVVNGGSHAGGRLAFQEFMIVPSGAPSFTEAMRQGAEVYQKLKSLTKKR

Sequence 1 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
           YGQSAGNVGDEGGVAPDIQTAEEALDLIT-AIE-AGYTG-IKIAMDVASS
Sequence 2 YGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQIKIAMDVASS

Sequence 1 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
           EFYKAD-KKYDLDFKNP-SD-SKW-TYEQLAD-YK-LAAKYPIVSIEDPF
Sequence 2 EFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYKQLAAKYPIVSIEDPF

Sequence 1 AEDDWEAWSYFYKT--SDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKV
           AEDDWEAWSYFYKT--SDFQIVGDDLTVTNP--IKKAIE-K-CNALLLKV
Sequence 2 AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKV

Sequence 1 NQIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIK
           NQIGT-TE-I-AAKDS-A--WGVMVSHRSGETEDVTIADI-VGLR-GQIK
Sequence 2 NQIGTITEAINAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIK

Sequence 1 TGAPCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           TGAP-RSERLAKLNQILRIEEELG---VYAG--FRTA-NL
Sequence 2 TGAPARSERLAKLNQILRIEEELGDKAVYAGDNFRTAINL



Alignment 5
Sequence 1:
Sequence 2: Allergen Cla h 6, Sequence: CAA55070
Sequence identity: 84.93 (372/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           MPISKIH-R-VYDSRGNPTVEVD--TETGLHRAIVPS-ASTG-HEA-ELR
Sequence 2 MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDK--W-GKGV-KAV-NVNE-I-PALIKEN-DVKDQ--VD-FLNKLDGT
Sequence 2 DGDKSKWAGKGVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           -NK---GANAILGVS-AVAKA-AAEK-VPLYAHISDL-GTKKP-VLPVPF
Sequence 2 TNKTKIGANAILGVSMAVAKAAAAEKRVPLYAHISDLSGTKKPFVLPVPF

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
           -NV-NGGSHAGGRLAFQEFMIVP--APSF-EA-RQGAEVYQKLK-L-KK-
Sequence 2 MNVVNGGSHAGGRLAFQEFMIVPSGAPSFTEAMRQGAEVYQKLKSLTKKR

Sequence 1 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
           YGQSAGNVGDEGGVAPDIQTAEEALDLIT-AIE-AGYTG-IKIAMDVASS
Sequence 2 YGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTGQIKIAMDVASS

Sequence 1 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
           EFYKAD-KKYDLDFKNP-SD-SKW-TYEQLAD-Y--LAAKYPIVSIEDPF
Sequence 2 EFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDPF

Sequence 1 AEDDWEAWSYFYKT--SDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKV
           AEDDWEAWSYFYKT--SDFQIVGDDLTVTNP--IKKAIE-K-CNALLLKV
Sequence 2 AEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKV

Sequence 1 NQIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIK
           NQIGT-TE-I-AAKDS-A--WGVMVSHRSGETEDVTIADI-VGLR-GQIK
Sequence 2 NQIGTITEAINAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIK

Sequence 1 TGAPCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           TGAP-RSERLAKLNQILRIEEELG----YAG--FRTA-NL
Sequence 2 TGAPARSERLAKLNQILRIEEELGDKRLYAGDNFRTAINL



Alignment 6
Sequence 1:
Sequence 2: Allergen Cur l 2.0101, Sequence: AAK67491
Sequence identity: 81.74 (358/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           M-I-KIHARSVYDSRGNPTVEVD--TETGLHRAIVPSGASTG-HEA-ELR
Sequence 2 MAITKIHARSVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDKT-WGGKGV-KAV-NVN--I-PALIKE--DVKDQS-VD-FLNKLDGT
Sequence 2 DGDKTKWGGKGVTKAVANVNDIIAPALIKEKLDVKDQSAVDAFLNKLDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           -NK--LGANAILGVS-A-AKA-AAEKGVPLYAHISDLAGTKKPYV-----
Sequence 2 ENKTKLGANAILGVSMAIAKAAAAEKGVPLYAHISDLAGTKKPYVFRFLS

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALR--QGAEVYQKLKALAK
           -NVLNGGSHAGG-L-FQEFMI-P--A--F-EALR--QGAEVYQKLKAL-K
Sequence 2 KNVLNGGSHAGGFLLFQEFMIAP--AKTFAEALRIRQGAEVYQKLKALTK

Sequence 1 KKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVA
           K-YGQSAGN-GDEGGVAPDIQTAEEALDLI--AIE-AG-TG-IKIAMDVA
Sequence 2 KTYGQSAGNYGDEGGVAPDIQTAEEALDLIVDAIEAAGHTGQIKIAMDVA

Sequence 1 SSEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIED
           SSEF-K-D-KKYDLDFKNP-SD-SKWLTY-QLA--YKSLA-KYPIVSIED
Sequence 2 SSEFFKDDEKKYDLDFKNPDSDKSKWLTYPQLAEMYKSLAEKYPIVSIED

Sequence 1 PFAEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKV
           PFAEDDWEAWS-FYK--DFQIVGDDLTVTNP--IK-AIELKSCNALLLKV
Sequence 2 PFAEDDWEAWSHFYKDGDFQIVGDDLTVTNPEFIKTAIELKSCNALLLKV

Sequence 1 NQIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIK
           NQIGT--E-I-AAKD-----WGVMVSHRSGETEDVTIADI-VGLRSGQIK
Sequence 2 NQIGTISEAINAAKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIK

Sequence 1 TGAPCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL--
           T-AP-RSERLAK-NQILRIEEELG-----AG-KF-TA-NL--
Sequence 2 TNAPARSERLAKYNQILRIEEELGDKRLFAGNKFHTAINLYL



Alignment 7
Sequence 1:
Sequence 2: Allergen Rho m 1.0101, Sequence: Q870B9
Sequence identity: 76.03 (333/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           M-ISKIH-R-VYDSRGNPTVEV---TE-G--R-IVPSGASTG-HEA-ELR
Sequence 2 MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDK--W-GKGVLKAV-NVN-TI-PALI--NIDV-DQ-K-DEFL-KLDGT
Sequence 2 DGDKSKWLGKGVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKK-PYVLPVP
           -NK--LGANAILGVSLA-AKAGAA-K-VPLY-HI-D----K----VLPVP
Sequence 2 PNKAKLGANAILGVSLAAAKAGAAQKDVPLYKHIADISKAKEGKFVLPVP

Sequence 1 FQNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKK
           FQNVLNGGSHAGG-LAFQEFMIVP--APSFSE-LR-G-EVY--LK-L-KK
Sequence 2 FQNVLNGGSHAGGDLAFQEFMIVPSGAPSFSEGLRIGSEVYHHLKSLTKK

Sequence 1 KYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVAS
           KYGQSAGNVGDEGGVAPDI-TA-EALDLI--AIE-AGYTG---IAMDVAS
Sequence 2 KYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTGQVDIAMDVAS

Sequence 1 SEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDP
           SEFYK-----YDLDFKNP-SD-SKW-T--QLA-LY--L---YPIVSIEDP
Sequence 2 SEFYKDGL--YDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDP

Sequence 1 FAEDDWEAWSYFYKTSD--FQIVGDDLTVTNPGRIKKAIELKSCNALLLK
           FAEDDWEAWS-F--------QIVGDDLTVTNP-RIKKAIE-K---ALLLK
Sequence 2 FAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLK

Sequence 1 VNQIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQI
           VNQIGTLTESIQAA-DSYA--WGVMVSHRSGETED--IAD--VG-RSGQ-
Sequence 2 VNQIGTLTESIQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQT

Sequence 1 KTGAPCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           KTGAP-RSERLAKLNQILRIEEELG----YAG--F--A--L
Sequence 2 KTGAPARSERLAKLNQILRIEEELGDKAIYAGKDFHKAHSL



Alignment 8
Sequence 1:
Sequence 2: Allergen Cyp c 2.0101, Sequence: A0A2U9IY94
Sequence identity: 64.61 (283/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           M-ISKIHAR---DSRGNPTVEVD--T--G--RA-VPSGASTG-HEA-ELR
Sequence 2 MSISKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDKT---GKG--KAV--VN--I-P-LI-----V--Q-K-D-F---LDGT
Sequence 2 DGDKTRYLGKGTQKAVDHVNKEIAPKLIEKKFSVVEQEKIDKFMLELDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           -NKS--GANAILGVSLAV-KAGAAEKGVPLY-HI-DLAG-K----LPVP-
Sequence 2 ENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNKD-VILPVPA

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
           -NV-NGGSHAG--LA-QEFMI-P--A--F-EA-R-GAEVY--LK---K-K
Sequence 2 FNVINGGSHAGNKLAMQEFMILPVGAKNFHEAMRIGAEVYHNLKNVIKAK

Sequence 1 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
           YG--A-NVGDEGG-AP-I----EAL-L---AIE-AGY--KI-I-MDVA-S
Sequence 2 YGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYPDKIIIGMDVAAS

Sequence 1 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
           EF-K----KYDLDFK-P--DP----T--QL-DLYKS----YP--SIEDPF
Sequence 2 EFFKNG--KYDLDFKSPD-DPKRHITGDQLGDLYKSFIKNYPVQSIEDPF

Sequence 1 AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ
           --DDWE-WS-F----D-Q-VGDDLTVTNP-RI--A-E-K-CN-LLLKVNQ
Sequence 2 DQDDWENWSKFTGSVDIQVVGDDLTVTNPKRIQQACEKKACNCLLLKVNQ

Sequence 1 IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
           IG--TESIQA-K------WGVMVSHRSGETED--IAD--VGL--GQIKTG
Sequence 2 IGSVTESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTG

Sequence 1 APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           APCRSERLAK-NQ--RIEEELG-----AG--FR-----
Sequence 2 APCRSERLAKYNQLMRIEEELGDKAKFAGKDFRHPKL-



Alignment 9
Sequence 1:
Sequence 2: Allergen Pan h 2.0101, Sequence: XP_034156632
Sequence identity: 63.93 (280/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           M-I-KIHAR---DSRGNPTVEVD--TE-G--RA-VPSGASTG-HEA-ELR
Sequence 2 MSIVKIHAREILDSRGNPTVEVDLYTEKGRFRAAVPSGASTGVHEALELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDKT---GKGV-KAV--VN--I-P-L------V-DQ-K-D-----LD-T
Sequence 2 DGDKTRFLGKGVTKAVDHVNKDIAPKLLEKKLSVVDQEKIDKLMLELDAT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           -NKS--GANAILGVSLAV-KAGAAEKGVPL--HI-DLAG------LPVP-
Sequence 2 ENKSKFGANAILGVSLAVCKAGAAEKGVPLFRHIADLAG-HADVILPVPA

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
           -NV-NGGSHAG--LA-QEFMI-P--A--F-EA-R-GAEVY--LK---K-K
Sequence 2 FNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKGVIKGK

Sequence 1 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
           YG--A-NVGDEGG-AP-I----EAL-L---AIE-AGY--KI-I-MDVA-S
Sequence 2 YGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYADKIVIGMDVAAS

Sequence 1 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
           EFY-----KYDLDFK-P--DP----T--QLADLYKS----YP--SIEDPF
Sequence 2 EFYRSG--KYDLDFKSPD-DPKRHITGDQLADLYKSFIKNYPVLSIEDPF

Sequence 1 AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ
           --DDWE-W--F----D-QIVGDDLTVTNP-RI--A-E-K-CN-LLLKVNQ
Sequence 2 DQDDWENWTKFTSSVDIQIVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQ

Sequence 1 IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
           IG--TESIQA-K------WGVMVSHRSGETED--IAD--VGL--GQIKTG
Sequence 2 IGSVTESIQACKLAQKNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTG

Sequence 1 APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           APCRSERLAK-NQ--RIEE-LG-----AG--FR-----
Sequence 2 APCRSERLAKYNQLMRIEEQLGDKAKFAGKDFRHPKVN



Alignment 10
Sequence 1:
Sequence 2: Allergen Sal s 2.0101, Sequence: B5DGQ7
Sequence identity: 63.70 (279/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           M-I-KIHAR---DSRGNPTVEVD--T--G--RA-VPSGASTG-HEA-ELR
Sequence 2 MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDK----GKG--KAV--VN--I---LI-----V-DQ-K-D-F---LDGT
Sequence 2 DGDKSRYLGKGTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           -NKS--GANAILGVSLAV-KAGAAEKGVPLY-HI-DLAG--K---LP-P-
Sequence 2 ENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAG-HKDVILPCPA

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
           -NV-NGGSHAG--LA-QEFMI-P--A--F-EA-R-GAEVY--LK---K-K
Sequence 2 FNVINGGSHAGNKLAMQEFMILPIGASNFHEAMRIGAEVYHNLKNVIKAK

Sequence 1 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
           YG--A-NVGDEGG-AP-I----EAL-L---AIE-AGY--KI-I-MDVA-S
Sequence 2 YGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPDKIIIGMDVAAS

Sequence 1 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
           EFYKA---KYDLDFK-P--DP----T--QL-DLYKS----YP--SIEDPF
Sequence 2 EFYKAG--KYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPF

Sequence 1 AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ
           --DDW-AW--F----D-Q-VGDDLTVTNP-RI--A-E-K-CN-LLLKVNQ
Sequence 2 DQDDWAAWTKFTAAVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQ

Sequence 1 IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
           IG--TESI-A-K------WGVMVSHRSGETED--IAD--VGL--GQIKTG
Sequence 2 IGSVTESIKACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTG

Sequence 1 APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           APCRSERLAK-NQ--RIEEELG-----AG---R-----
Sequence 2 APCRSERLAKYNQLMRIEEELGAKAKFAGKDYRHPKIN



Alignment 11
Sequence 1:
Sequence 2: Allergen Gal d 9.0101, Sequence: P07322
Sequence identity: 61.64 (270/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELR
           M-I-KIHAR---DSRG-PTVEVD--T--G--RA-VPSGASTG-HEA-E-R
Sequence 2 MSIQKIHAREILDSRGEPTVEVDLHTAKGHFRAAVPSGASTGIHEALEPR

Sequence 1 DGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGT
           DGDK----GKGVLKAV---N-TIGPALI---I-V--Q-K-D------DGT
Sequence 2 DGDKKRFLGKGVLKAVEHINKTIGPALIEKKISVVEQEKIDKVMIEMDGT

Sequence 1 ANKSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPF
           -NKS--GANAILGVSLAV-KAGAAEKGVPLY-HI-DLAG------LPVP-
Sequence 2 ENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNTE-LILPVPA

Sequence 1 QNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKLKALAKKK
           -NV-NGGSHAG--LA-QEFM--P--A-SF--A-R-GAEVY--LK---K-K
Sequence 2 FNVINGGSHAGNKLAMQEFMVLPVGAASFHDAMRVGAEVYHSLKGVIKAK

Sequence 1 YGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKIAMDVASS
           YG--A-NVG-EGG-AP-I----EAL-L---AI-QAGYT-K--I-MDVA-S
Sequence 2 YGKDATNVGGEGGFAPNILDNHEALELLKAAIAQAGYTDKVVIGMDVAAS

Sequence 1 EFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDPF
           EF-------Y-LDFK-P--------T-EQL---Y------YP-VSIEDPF
Sequence 2 EFCRDG--RYHLDFKSPPHT-KRYITGEQLGEIYRGFIKDYPVVSIEDPF

Sequence 1 AEDDWEAWSYFYKTSDFQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQ
           --DDWEAW--F----D-Q-VGDDLTVTNP-RI----E---CN-LLLKVNQ
Sequence 2 DQDDWEAWKRFVFHVDIQVVGDDLTVTNPKRIAHGAEQHACNCLLLKVNQ

Sequence 1 IGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTG
           IG--TESIQA-K------WGVMVSHRSGETED--IAD--VGL--GQIKTG
Sequence 2 IGSVTESIQACKLAQSHGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTG

Sequence 1 APCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL
           APCRSERLAK-NQ--RIEE-LG-----AG-KFR-----
Sequence 2 APCRSERLAKYNQLMRIEEALGDKAKFAGRKFRNPKAK



Alignment 12
Sequence 1:
Sequence 2: Allergen Hev b 9, Sequence: Q9LEJ0
Sequence identity: 62.33 (273/438)
Sequence 1 --MPISKIHARSVYDSRGNPTVEVDVATETG-LHRAIVPSGASTGQHEAH
           ----I----AR---DSRGNPTVE-DV----G-L-RA-VPSGASTG--EA-
Sequence 2 MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPSGASTGIYEAL

Sequence 1 ELRDGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFL-NK
           ELRDG------GKGV-KAV-NVN--IGPAL-----D--DQ---D-F----
Sequence 2 ELRDGG-SDYLGKGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQ

Sequence 1 LDGTAN-----KSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTK
           LDGT-N-----K--LGANAIL-VSLAV-KAGA--KG-PLY-HI--LAG-K
Sequence 2 LDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKGIPLYEHIANLAGNK

Sequence 1 KPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQ
           ---VLPVP--NV-NGGSHAG--LA-QEFMI-P--A-SF-EA---GAEVY-
Sequence 2 N-LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGAEVYH

Sequence 1 KLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKI
           -LK---KKKYGQ-A-NVGDEGG-AP-IQ---E-L-L---AI--AGYTGK-
Sequence 2 HLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTGKV

Sequence 1 KIAMDVASSEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKY
           -I-MDVA-SEFY--D---YDL-FK------S-----E-L-DLYKS--A-Y
Sequence 2 VIGMDVAASEFYGSD-QTYDLNFKEENNNGSQKISGEALKDLYKSFVAEY

Sequence 1 PIVSIEDPFAEDDWEAWSYFYKT--SDFQIVGDDLTVTNPGRIKKAIELK
           PIVSIEDPF--DDW--------------QIVGDDL-VTNP-R--KAI--K
Sequence 2 PIVSIEDPFDQDDWAHYAKLTSEIGEKVQIVGDDLLVTNPKRVEKAIKEK

Sequence 1 SCNALLLKVNQIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIA
           -CNALLLKVNQIG--TESI-A-K-S----WGVM-SHRSGETED--IAD--
Sequence 2 ACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLS

Sequence 1 VGLRSGQIKTGAPCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL-
           VGL--GQIKTGAPCRSERLAK-NQ-LRIEEELG---VYAG--FR--V---
Sequence 2 VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY



Alignment 13
Sequence 1:
Sequence 2: Allergen Hev b 9, Sequence: Q9LEI9
Sequence identity: 62.56 (274/438)
Sequence 1 --MPISKIHARSVYDSRGNPTVEVDVATETG-LHRAIVPSGASTGQHEAH
           ----I----AR---DSRGNPTVE-DV----G-L-RA-VP-GASTG--EA-
Sequence 2 MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEAL

Sequence 1 ELRDGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFL-NK
           ELRDG------GKGV-KAV-NVN--IGPAL-----D--DQ---D-F----
Sequence 2 ELRDGG-SDYLGKGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQ

Sequence 1 LDGTAN-----KSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTK
           LDGT-N-----K--LGANAIL-VSLAV-KAGA--KG-PLY-H---LAG-K
Sequence 2 LDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKGIPLYKHVANLAGNK

Sequence 1 KPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQ
           ---VLPVP--NV-NGGSHAG--LA-QEFMI-P--A-SF-EA---GAEVY-
Sequence 2 N-LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGAEVYH

Sequence 1 KLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKI
           -LK---KKKYGQ-A-NVGDEGG-AP-IQ---E-L-L---AI--AGYTGK-
Sequence 2 HLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTGKV

Sequence 1 KIAMDVASSEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKY
           -I-MDVA-SEFY--D-K-YDL-FK------S-------L-DLYKS----Y
Sequence 2 VIGMDVAASEFYGSD-KTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEY

Sequence 1 PIVSIEDPFAEDDWEAWSYFYKTSDF----QIVGDDLTVTNPGRIKKAIE
           PIVSIEDPF--DDWE-------TS------QIVGDDL-VTNP-R--KAI-
Sequence 2 PIVSIEDPFDQDDWEHYAKL--TSEIGVKVQIVGDDLLVTNPKRVEKAIK

Sequence 1 LKSCNALLLKVNQIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIAD
           -K-CNALLLKVNQIG--TESI-A-K-S----WGVM-SHRSGETED--IAD
Sequence 2 EKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIAD

Sequence 1 IAVGLRSGQIKTGAPCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVN
           --VGL--GQIKTGAPCRSERLAK-NQ-LRIEEELG---VYAG--FRT-V-
Sequence 2 LSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVE

Sequence 1 L-
           --
Sequence 2 PY



Alignment 14
Sequence 1:
Sequence 2: Allergen Amb a 12.0102, Sequence: A0A1B2H9Q5
Sequence identity: 61.64 (270/438)
Sequence 1 -MPISKIHARSVYDSRGNPTVEVDVATETG-LHRAIVPSGASTGQHEAHE
           ---I----AR---DSRGNPTVEVD-----G-L-RA-VPSGASTG--EA-E
Sequence 2 MATIKAVKARQIFDSRGNPTVEVDITLSDGTLARAAVPSGASTGIYEALE

Sequence 1 LRDGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFL-NKL
           LRDG------GKGV-KAV-NVN--IGPAL-----D--DQ---D-F----L
Sequence 2 LRDGG-SDYLGKGVSKAVANVNTIIGPALVGK--DPTDQTGIDNFMVQQL

Sequence 1 DGTAN-----KSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKK
           DGT-N-----K--LGANAIL-VSLAV-KAGA-----PLY-HI--LAG-K-
Sequence 2 DGTQNEWGWCKQKLGANAILAVSLAVCKAGASVLKTPLYKHIANLAGNKN

Sequence 1 PYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQK
           --VLPVP--NV-NGGSHAG--LA-QEFMI-P--A-SF-EA---G-EVY--
Sequence 2 -LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHN

Sequence 1 LKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIK
           LK---KKKYGQ-A-NVGDEGG-AP-IQ---E-L-L---AI--AGYT-K--
Sequence 2 LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVV

Sequence 1 IAMDVASSEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYP
           I-MDVA-SEFY----K-YDL-FK----D-------EQL-DLYKS----YP
Sequence 2 IGMDVAASEFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYP

Sequence 1 IVSIEDPFAEDDWEAWSYFYKTS--DFQIVGDDLTVTNPGRIKKAIELKS
           IVSIEDPF--DDWE-------------QIVGDDL-VTNP-R-KKAI--K-
Sequence 2 IVSIEDPFDQDDWEHYAKMTAECGEQVQIVGDDLLVTNPTRVKKAIDEKT

Sequence 1 CNALLLKVNQIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAV
           CNALLLKVNQIG--TESI-A---S----WGVM-SHRSGETED--IAD--V
Sequence 2 CNALLLKVNQIGSVTESIEAVRMSKHAGWGVMASHRSGETEDTFIADLSV

Sequence 1 GLRSGQIKTGAPCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL-
           GL--GQIKTGAPCRSERLAK-NQ-LRIEEELG---VYAG--FR--V---
Sequence 2 GLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY



Alignment 15
Sequence 1:
Sequence 2: Allergen Amb a 12.0101, Sequence: A0A1B2H9Q1
Sequence identity: 58.68 (257/438)
Sequence 1 MPISKIHARSVYDSRGNPTVEVDVATETG-LHRAIVPSGASTGQHEAHEL
           ---------------------VD-----G-L-RA-VPSGASTG--EA-EL
Sequence 2 -------------MLFVDEIKVDITLSDGTLARAAVPSGASTGIYEALEL

Sequence 1 RDGDKTQWGGKGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFL-NKLD
           RDG------GKGV-KAV-NVN--IGPAL-----D--DQ---D-F----LD
Sequence 2 RDGG-SDYLGKGVSKAVANVNTIIGPALVGK--DPTDQTGIDNFMVQQLD

Sequence 1 GTAN-----KSNLGANAILGVSLAVAKAGAAEKGVPLYAHISDLAGTKKP
           GT-N-----K--LGANAIL-V-LAV-KAGA-----PLY-HI--LAG-K--
Sequence 2 GTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYKHIANLAGNKN-

Sequence 1 YVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDSAPSFSEALRQGAEVYQKL
           -VLPVP--NV-NGGSHAG--LA-QEFMI-P--A-SF-EA---G-EVY--L
Sequence 2 LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNL

Sequence 1 KALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTGKIKI
           K---KKKYGQ-A-NVGDEGG-AP-IQ---E-L-L---AI--AGYT-K--I
Sequence 2 KSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVI

Sequence 1 AMDVASSEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPI
           -MDVA-SEFY----K-YDL-FK----D-------EQL-DLYKS----YPI
Sequence 2 GMDVAASEFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPI

Sequence 1 VSIEDPFAEDDWEAWSYFYKT--SDFQIVGDDLTVTNPGRIKKAIELKSC
           VSIEDPF--DDWE-------------QIVGDDL-VTNP-R-KKAI--K-C
Sequence 2 VSIEDPFDQDDWEHYAKMTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTC

Sequence 1 NALLLKVNQIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVG
           NALLLKVNQIG--TESI-A---S----WGVM-SHRSGETED--IAD--VG
Sequence 2 NALLLKVNQIGSVTESIEAVRMSKHAGWGVMASHRSGETEDTFIADLSVG

Sequence 1 LRSGQIKTGAPCRSERLAKLNQILRIEEELGENTVYAGSKFRTAVNL-
           L--GQIKTGAPCRSERLAK-NQ-LRIEEELG---VYAG--FR--V---
Sequence 2 LATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.