The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Der f 26.0101

Sequence AIO08852

Full FASTA alignment

Sequence name:
Query sequence:
MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK
NGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGT
MMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMA
GPFPEEAGKS

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Der f 26.0101AIO08852Go!160197.91.1e-52
2Der p 26.0101QAT18638Go!121136.82.2e-34
3Pro c 5.0101J7HCX7Go!15399.44.9e-23
4Scy p 3.0101A0A514C9K9Go!15399.44.9e-23
5Art fr 5.0101A7L499Go!14491.69.9e-21
6Bos d 13.0201P85100Go!19978.11.7e-16
7Gal d 7.0101P02604Go!19275.68.9e-16
8Bos d 13.0101A0JNJ5Go!19271.41.6e-14
9Amb a 10.0101Q2KN25Go!16042.85.5e-06
10Tyr p 34.0101D2DGW3Go!15342.18.8e-06
11Tyr p 24.0101ACL36923Go!15342.18.8e-06
12Der f 39.0101QBF67841Go!15340.82.0e-05
13Pen m 6.0101ADV17344Go!15040.62.3e-05
14Der p 39.0101QXY82447Go!15340.32.9e-05
15Bla g 6.0101ABB89296Go!15140.13.3e-05
16Ole e 8Q9M7R0Go!17139.75.1e-05
17Ole e 8AAF31152Go!17139.75.1e-05
18Bla g 6.0201ABB89297Go!15138.97.7e-05
19Jun o 4O64943Go!16538.31.3e-04
20Bla g 6.0301ABB89298Go!15437.52.0e-04
21Hom a 6.0101P29291Go!15037.32.3e-04
22Cup a 4.0101ABP87672Go!17737.42.5e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Der f 26.0101, Sequence: AIO08852
Sequence identity: 100.00 (160/160)
Sequence 1 MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK
           MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK
Sequence 2 MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK

Sequence 1 NGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGT
           NGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGT
Sequence 2 NGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGT

Sequence 1 MMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMA
           MMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMA
Sequence 2 MMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMA

Sequence 1 GPFPEEAGKS
           GPFPEEAGKS
Sequence 2 GPFPEEAGKS



Alignment 2
Sequence 1:
Sequence 2: Allergen Der p 26.0101, Sequence: QAT18638
Sequence identity: 67.50 (108/160)
Sequence 1 MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK
           MADLRPPEVEKARLHFDIYDF-GQ-KVDYH-LGDLLRSLDLRPTQ--VAK
Sequence 2 MADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAK

Sequence 1 NGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGT
           NGWEKKKGQK-MTFEEFLPIYSQVKKDKDCGA-EDLVEGLKVYDKAENGT
Sequence 2 NGWEKKKGQKYMTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGT

Sequence 1 MMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMA
           MMEAELAHVLLSLGE-----------------------------------
Sequence 2 MMEAELAHVLLSLGENWMIRK-----------------------------

Sequence 1 GPFPEEAGKS
           ----------
Sequence 2 ----------



Alignment 3
Sequence 1:
Sequence 2: Allergen Pro c 5.0101, Sequence: J7HCX7
Sequence identity: 46.25 (74/160)
Sequence 1 -MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVA
           --ADL----VE-----F-IYDF-G----D--Y-GD-LR-L-L-PT-----
Sequence 2 MAADLSARDVERVKFAFSIYDFEGNGTMDAFYIGDCLRALNLNPTLAIIE

Sequence 1 KNGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENG
           K-G---K---K----EEF-PI--QVKKDKD-G--ED--E-LK-YDK-ENG
Sequence 2 KVGGKEKRKEKIIKLEEFIPIFAQVKKDKDAGSYEDFMEVLKLYDKSENG

Sequence 1 TMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVM
           TMM-AEL-H-LLSLGE-L---E-E---K-C----D--GF--YE-F-K---
Sequence 2 TMMYAELEHILLSLGERLEKSELEPVLKECCNEEDEDGFIPYEPFLKKMT

Sequence 1 AGPFPEEAGKS
           -----------
Sequence 2 QLL--------



Alignment 4
Sequence 1:
Sequence 2: Allergen Scy p 3.0101, Sequence: A0A514C9K9
Sequence identity: 46.88 (75/160)
Sequence 1 -MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVA
           --ADL----VE-A---F-IYDF-G----D--Y-GD-LR-L-L-PT-----
Sequence 2 MAADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIE

Sequence 1 KNGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENG
           K-G---KK--K------FLPI--QVKKDKD-G-FED--E-LK-YDK-ENG
Sequence 2 KVGGKTKKKEKMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENG

Sequence 1 TMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVM
           TM--AEL-H-LLSLGE-L---E-E---K-C----D--GF--YE-F-K---
Sequence 2 TMLYAELEHILLSLGERLEKSELEPVLKDCCDEEDEDGFIPYEPFLKKLT

Sequence 1 AGPFPEEAGKS
           -----------
Sequence 2 QLL--------



Alignment 5
Sequence 1:
Sequence 2: Allergen Art fr 5.0101, Sequence: A7L499
Sequence identity: 44.38 (71/160)
Sequence 1 MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK
           ---------------F--------------YLGD-LR-L-L-PT-----K
Sequence 2 -------------MAFSFTILMETRQLMAFYLGDCLRALNLNPTLAQIEK

Sequence 1 NGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGT
           -G--KKK--K----EEFLPI-SQVKK-KD-G--ED--E--K-YDK-ENGT
Sequence 2 LGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTLEDFIECMKLYDKSENGT

Sequence 1 MMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMA
           MM-AEL-H-LL-LGEKL-D--V--I-K-C----DDEG---Y--F-K---A
Sequence 2 MMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLLA

Sequence 1 GPFPEEAGKS
           GP-P------
Sequence 2 GPYPDAQ---



Alignment 6
Sequence 1:
Sequence 2: Allergen Bos d 13.0201, Sequence: P85100
Sequence identity: 40.62 (65/160)
Sequence 1 ----------------------------------------------MADL
           --------------------------------------------------
Sequence 2 MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEF

Sequence 1 RPPEVEKARLHFDIYDFDGQS--KVDYHYLGDLLRSLDLRPTQDSVAKN-
           -P---E-----F---D-------K--Y---GD-LR-L---PTQ--V----
Sequence 2 TPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVL

Sequence 1 GWEKKK--GQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENG
           G--K------K-M-F--FLP------K-KD-G--ED-VEGL-V-DK--NG
Sequence 2 GKPKQEELNSKMMDFDTFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNG

Sequence 1 TMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVM
           T-M-AEL-HVL--LGEKLT--EVE-------G--D--G---YE-F-K--M
Sequence 2 TVMGAELRHVLATLGEKLTEDEVEKLM---AGQEDSNGCINYEAFVKHIM

Sequence 1 AGPFPEEAGKS
           AG---------
Sequence 2 AG---------



Alignment 7
Sequence 1:
Sequence 2: Allergen Gal d 7.0101, Sequence: P02604
Sequence identity: 38.12 (61/160)
Sequence 1 -----------------------------------------MADLRPPEV
           --------------------------------------------------
Sequence 2 MAPKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEPAIDLKSIKIEFSKEQQ

Sequence 1 EKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK---NGWEKK
           ------F---D--G--K------GD--R-L---PT-----K---N-----
Sequence 2 DDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEE

Sequence 1 KGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAEL
           ---K--TFEEFLP--------KD-G-FED-VEGL-V-DK--NGT-M-AEL
Sequence 2 MNAKKITFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAEL

Sequence 1 AHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAGPFPEE
           -HVL--LGEK-T--EVEE--K---G--D--G---YE-F-K--M-------
Sequence 2 RHVLATLGEKMTEEEVEELMK---GQEDSNGCINYEAFVKHIMSV-----

Sequence 1 AGKS
           ----
Sequence 2 ----



Alignment 8
Sequence 1:
Sequence 2: Allergen Bos d 13.0101, Sequence: A0JNJ5
Sequence identity: 35.62 (57/160)
Sequence 1 -----------------------------------------MADLRPPEV
           --------------------------------------------------
Sequence 2 MAPKKDVKKPAAAAAPAPAPAPAPAPAPAPPKEEKIDLSAIKIEFSKQQQ

Sequence 1 EKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK---NGWEKK
           ------F---D--G--K------GD-LR-L---PT---V-K---N-----
Sequence 2 DEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEE

Sequence 1 KGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAEL
           ---K---FE-FLP--------KD-G--ED-VEGL-V-DK--NGT-M-AEL
Sequence 2 MNAKKIEFEQFLPMLQAISNNKDQGTYEDFVEGLRVFDKEGNGTVMGAEL

Sequence 1 AHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAGPFPEE
           -HVL--LGEK----EVE-------G--D--G---YE-F-K--M-------
Sequence 2 RHVLATLGEKMKEEEVEALM---AGQEDSNGCINYEAFVKHIMSN-----

Sequence 1 AGKS
           ----
Sequence 2 ----



Alignment 9
Sequence 1:
Sequence 2: Allergen Amb a 10.0101, Sequence: Q2KN25
Sequence identity: 24.38 (39/160)
Sequence 1 ------MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPT
           -----------P---E-----F---D--G--------L---L-SL-----
Sequence 2 MAPENNKHSIFPTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTS

Sequence 1 QDSVAKNGWE-KKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVY
           -D-V-----E----G--F----EF-----------D-----DL-E--K-Y
Sequence 2 PDEVKRVMAEIDADGDGFISLDEFILFCKGIESEGD--EINDLKEAFKFY

Sequence 1 DKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYET
           D---NG-----EL---L--LGE----------IK------D--GF---E-
Sequence 2 DQNNNGVISANELHQILGRLGENYSVESCADMIKSVDS--DGDGFVDFEE

Sequence 1 FIKNVMAGPFPEEAGKS
           F-K--------------
Sequence 2 FRKMMSRKGGDGAM---



Alignment 10
Sequence 1:
Sequence 2: Allergen Tyr p 34.0101, Sequence: D2DGW3
Sequence identity: 25.00 (40/160)
Sequence 1 --MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSV
           -----L----V---R--FD--D-D-------------LR-L---------
Sequence 2 MSVEELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDL

Sequence 1 AKNGWE-KKKGQKFMTFEEFLPIYSQVKKDKDCGAF-EDLVEGLKVYDKA
           -----E----G-----F-EFL----------D--A--E-L-E----YDK-
Sequence 2 QQLIIEIDADGSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKE

Sequence 1 ENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIK
           -NG------L---L--L--KLT--E--E-I-------D--G------F--
Sequence 2 GNGYIPTSALREILRALDDKLTEDELDEMIAEID--TDGSGTVDFDEFME

Sequence 1 NVMAGPFPEEAGKS
           --M-G---------
Sequence 2 -MMTGD--------



Alignment 11
Sequence 1:
Sequence 2: Allergen Tyr p 24.0101, Sequence: ACL36923
Sequence identity: 25.00 (40/160)
Sequence 1 --MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSV
           -----L----V---R--FD--D-D-------------LR-L---------
Sequence 2 MSVEELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDL

Sequence 1 AKNGWE-KKKGQKFMTFEEFLPIYSQVKKDKDCGAF-EDLVEGLKVYDKA
           -----E----G-----F-EFL----------D--A--E-L-E----YDK-
Sequence 2 QQLIIEIDADGSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKE

Sequence 1 ENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIK
           -NG------L---L--L--KLT--E--E-I-------D--G------F--
Sequence 2 GNGYIPTSALREILRALDDKLTEDELDEMIAEID--TDGSGTVDFDEFME

Sequence 1 NVMAGPFPEEAGKS
           --M-G---------
Sequence 2 -MMTGD--------



Alignment 12
Sequence 1:
Sequence 2: Allergen Der f 39.0101, Sequence: QBF67841
Sequence identity: 24.38 (39/160)
Sequence 1 --MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSV
           -----L----V---R--FD--D---------------LR-L---------
Sequence 2 MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDL

Sequence 1 AKNGWE-KKKGQKFMTFEEFLPIYSQVKKDKDCGAF-EDLVEGLKVYDKA
           -----E----G-----F-EFL----------D--A--E-L-E----YDK-
Sequence 2 QQLITEIDADGSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKE

Sequence 1 ENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIK
           -NG------L---L--L--KLT--E--E-I-------D--G------F--
Sequence 2 GNGYIPTSALREILRALDDKLTNDELDEMIAEID--TDGSGTVDFDEFME

Sequence 1 NVMAGPFPEEAGKS
           --M-G---------
Sequence 2 -MMTGD--------



Alignment 13
Sequence 1:
Sequence 2: Allergen Pen m 6.0101, Sequence: ADV17344
Sequence identity: 23.75 (38/160)
Sequence 1 MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK
           M--L-----E--R--F---D--G---------G--LR-------------
Sequence 2 MDSLDEEQIETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQE

Sequence 1 NGWEK-KKGQKFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAEN
           ---E----G-----FEEF-----------D--A----L-E----YDK---
Sequence 2 VIAETDEDGSGMLEFEEFAELAAKFLIEEDEEALKAELREAFRIYDKDCQ

Sequence 1 GTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNV
           G------L---L--L--KLT----E-II-------D--G------F----
Sequence 2 GYITTDILKEILVELDPKLTPTDLEGIIEEVDE--DGSGTLDFDEFME-M

Sequence 1 MAGPFPEEAGKS
           M-G---------
Sequence 2 MSG---------



Alignment 14
Sequence 1:
Sequence 2: Allergen Der p 39.0101, Sequence: QXY82447
Sequence identity: 24.38 (39/160)
Sequence 1 --MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSV
           -----L----V---R--FD--D---------------LR-L---------
Sequence 2 MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDL

Sequence 1 AKNGWE-KKKGQKFMTFEEFLPIYSQVKKDKDCGAF-EDLVEGLKVYDKA
           -----E----G-----F-EFL----------D--A--E-L-E----YDK-
Sequence 2 QTLITEIDADGSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKE

Sequence 1 ENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIK
           -NG------L---L--L--KLT--E--E-I-------D--G------F--
Sequence 2 GNGYIPTSALREILRALDDKLTNDELDEMIAEID--TDGSGTVDFDEFME

Sequence 1 NVMAGPFPEEAGKS
           --M-G---------
Sequence 2 -MMTGD--------



Alignment 15
Sequence 1:
Sequence 2: Allergen Bla g 6.0101, Sequence: ABB89296
Sequence identity: 24.38 (39/160)
Sequence 1 MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK
           M--L-P---------FD--D------------G--L--L--R---D----
Sequence 2 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE

Sequence 1 NGWE-KKKGQKFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAEN
           ---E----G-----FEEF----S------D--A----L-E----YDK--N
Sequence 2 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN

Sequence 1 GTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNV
           G------L---L--L--K-T-------I-------D--G------F---V
Sequence 2 GYITTNVLREILKELDDKITAEDLDMMIEEIDS--DGSGTVDFDEFME-V

Sequence 1 MAGPFPEEAGKS
           M-G---------
Sequence 2 MTGE--------



Alignment 16
Sequence 1:
Sequence 2: Allergen Ole e 8, Sequence: Q9M7R0
Sequence identity: 21.88 (35/160)
Sequence 1 ------------MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRS
           -----------------P-EV------F---D--G--K-----L---L--
Sequence 2 MAANTDRNSKPSVYLQEPNEVQGV---FNRFDANGDGKISGDELAGVLKA

Sequence 1 LDLRPTQDSVAKNGWEKKKGQK-FMTFEEFLP-IYSQVKKDKDCGAFEDL
           L--------------E-------F----EF--------------G----L
Sequence 2 LGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENEL

Sequence 1 VEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDE
           -E----YD---NG-----EL---L--LGE--------E-IK------D--
Sequence 2 KEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDS--DGD

Sequence 1 GFMKYETFIKNVMAGPFPEEAGKS--
           G----E-F-K----------------
Sequence 2 GYVSFEEFKKMMTNKSGNNSQAEPPK



Alignment 17
Sequence 1:
Sequence 2: Allergen Ole e 8, Sequence: AAF31152
Sequence identity: 22.50 (36/160)
Sequence 1 ------------MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRS
           -----------------P-EV------F---D--G--K-----L---L--
Sequence 2 MAANTDRNSKPSVYLQEPNEVQGV---FNRFDANGDGKISGDELACALKA

Sequence 1 LDLRPTQDSVAKNGWEKKKGQK-FMTFEEFLP-IYSQVKKDKDCGAFEDL
           L---------A----E-------F----EF--------------G----L
Sequence 2 LGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENEL

Sequence 1 VEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDE
           -E----YD---NG-----EL---L--LGE--------E-IK------D--
Sequence 2 KEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDS--DGD

Sequence 1 GFMKYETFIKNVMAGPFPEEAGKS--
           G----E-F-K----------------
Sequence 2 GYVSFEEFKKMMTNKSGNNSQAEPPK



Alignment 18
Sequence 1:
Sequence 2: Allergen Bla g 6.0201, Sequence: ABB89297
Sequence identity: 25.00 (40/160)
Sequence 1 MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK
           M-------V------FD--D------------G--L--L--R--QD----
Sequence 2 MDEIPAEQVVLLKKAFDAFDREKKGCISTEMVGTILEMLGTRLDQDMLDE

Sequence 1 NGWE-KKKGQKFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAEN
           ---E----G-----FEEF----S------D--A----L-E----YDK--N
Sequence 2 IIAEVDADGSGELEFEEFCTLASRFLVEEDAEAMQHELREAFRLYDKEGN

Sequence 1 GTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNV
           G----A-L---L--L--K-T-------I-------D--G------F---V
Sequence 2 GYITTAVLREILKELDDKITAEDLDMMIEEIDS--DGSGTVDFDEFME-V

Sequence 1 MAGPFPEEAGKS
           M-G---------
Sequence 2 MTGE--------



Alignment 19
Sequence 1:
Sequence 2: Allergen Jun o 4, Sequence: O64943
Sequence identity: 25.62 (41/160)
Sequence 1 ---------------MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDL
           -----------------------V------F---D--G--K-----L-D-
Sequence 2 MDEVPSSDGSKSACSGEVVMEQSVHELEEVFKKFDANGDGKISGSELADI

Sequence 1 LRSLDLRPTQDSVAKNGWEKKK--GQKFMTFEEFLPIYSQVKKDKDCGA-
           LRSL----------K---E-----G-------EF-------------GA-
Sequence 2 LRSLG-SDVGEAEVKAMMEEADADGDGYVSLQEFVDLNNK-------GAS

Sequence 1 FEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGG
           --DL----KV-D---NG----AEL-H-L-S-GE--T--E---II------
Sequence 2 VKDLKNAFKVFDRDCNGSISAAELCHTLESVGEPCTIEESKNIIHNVDKN

Sequence 1 CDDEGFMKYETFIKNVMAGPFPEEAGKS
           -D--G----E-F----------------
Sequence 2 GD--GLISVEEFQTMMTSEMTDKSK---



Alignment 20
Sequence 1:
Sequence 2: Allergen Bla g 6.0301, Sequence: ABB89298
Sequence identity: 26.25 (42/160)
Sequence 1 MADLR---PPE-VEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDL---RP
           MAD-----PPE-----R--FD--D---------------LR-------R-
Sequence 2 MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRR

Sequence 1 TQDSVAKNGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKV
           T-----------K-G-----F-EF-----------D--A-E--L-E----
Sequence 2 TLEELIDEVDADKSGR--LEFDEFVTLAAKFIIEEDSEAMEKELREAFRL

Sequence 1 YDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYE
           YDK--NG------L---L--L-E-LT--E----I-------D--G-----
Sequence 2 YDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDA--DGSGTVDFD

Sequence 1 TFIKNVMAGPFPEEAGKS
           -F----M-G---------
Sequence 2 EFME-MMTG---------



Alignment 21
Sequence 1:
Sequence 2: Allergen Hom a 6.0101, Sequence: P29291
Sequence identity: 22.50 (36/160)
Sequence 1 MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK
           M--L-----------FD--D-D----------G--LR-------------
Sequence 2 MDSLDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQE

Sequence 1 NGWEK-KKGQKFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAEN
           ---E----G-----FEEF-----------D--A----L-E---VYD---N
Sequence 2 VISETDEDGSGELEFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGN

Sequence 1 GTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNV
           G------L---L--L---LT------II-------D--G------F----
Sequence 2 GYITTDVLKEILRELDNRLTEEDLDSIIEEVDE--DGSGTLDFNEFMQ-M

Sequence 1 MAGPFPEEAGKS
           M-G---------
Sequence 2 MNG---------



Alignment 22
Sequence 1:
Sequence 2: Allergen Cup a 4.0101, Sequence: ABP87672
Sequence identity: 25.62 (41/160)
Sequence 1 ---------------------------MADLRPPEVEKARLHFDIYDFDG
           -----------------------------------V------F---D--G
Sequence 2 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG

Sequence 1 QSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKK-GQKFMTFEEFLPIYS
           --K-----L-D-LRS---------V-----E----G-------EF-----
Sequence 2 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDL--

Sequence 1 QVKKDKDCGA-FEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAE
           --K-----GA---DL----KV-D---NGT---AEL---L-S-GE--T--E
Sequence 2 NIK-----GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEE

Sequence 1 VEEIIKTCGGGCDDEGFMKYETFIKNVMAGPFPEEAGKS
           ---II-------D--G----E-F----------------
Sequence 2 SKNIIHNVDKNGD--GLISVEEFQTMMTSEMTDKSK---


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.