The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Lup an 3.0101

Sequence XP_019446786

Full FASTA alignment

Sequence name:
Query sequence:
MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
NIPYKISTSTNCASIK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Lup an 3.0101XP_019446786Go!116151.27.0e-39
2Pru av 3Q9M5X8Go!117106.42.1e-25
3Pha v 3.0101ADC80502Go!115104.95.7e-25
4Pyr c 3Q9M5X6Go!115104.76.4e-25
5Rub i 3.0101Q0Z8V0Go!117104.86.5e-25
6Mal d 3Q9M5X7Go!115100.41.3e-23
7Fra a 3.0102Q4PLT9Go!11799.72.2e-23
8Fra a 3.0101Q8VX12Go!11799.32.9e-23
9Fra a 3.0202Q4PLT6Go!11798.74.2e-23
10Pha v 3.0201ADC80503Go!11898.45.4e-23
11Fra a 3.0201Q4PLU0Go!11797.51.0e-22
12Pru d 3P82534Go!9196.31.8e-22
13Pru ar 3P81651Go!9195.72.7e-22
14Ara h 9.0101ABX56711Go!11696.02.8e-22
15Pru p 3CAB96876Go!9195.43.4e-22
16Pru p 3P81402Go!9195.04.4e-22
17Len c 3.0101A0AT29Go!11895.15.3e-22
18Hev b 12AAL25839Go!11694.01.1e-21
19Pis s 3.0101A0A161AT60Go!12093.71.5e-21
20Cor a 8AAK28533Go!11592.14.0e-21
21Pla or 3.0101ABY21307Go!11890.01.8e-20
22Pla a 3.0101CAL07989Go!11889.23.1e-20
23Pun g 1.0101A0A059STC4Go!12088.74.5e-20
24Art v 3.0202ACE07187Go!11686.52.0e-19
25Art si 3.0102ANC85027Go!11686.52.0e-19
26Art ar 3.0102ANC85020Go!11686.52.0e-19
27Pun g 1.0301A0A059ST23Go!12086.03.0e-19
28Mor n 3.0101P85894Go!9185.33.6e-19
29Pun g 1.0201A0A059SSZ0Go!12085.63.9e-19
30Art gm 3.0102ANC85023Go!11785.44.4e-19
31Art v 3.0201EU564845Go!11484.39.3e-19
32Art la 3.0101ANC85024Go!11684.39.3e-19
33Art ar 3.0101ANC85019Go!11684.39.3e-19
34Art gm 3.0101ANC85022Go!11784.39.3e-19
35Ara h 9.0201ABX75045Go!9283.91.0e-18
36Pru du 3.0101ACN11576Go!12384.01.2e-18
37Lyc e 3AAB42069Go!11483.71.4e-18
38Sola l 3.0101P93224Go!11483.71.4e-18
39Art ca 3.0102QIN55516Go!11783.81.4e-18
40Ara h 17.0101A0A510A9S3Go!9383.01.9e-18
41Art an 3.0102ANC85018Go!11783.02.3e-18
42Art la 3.0102ANC85025Go!11582.53.3e-18
43Art v 3.0301EU564847Go!11782.14.3e-18
44Art si 3.0101ANC85026Go!11681.28.0e-18
45Zea m 14.0101P19656-1Go!12080.71.2e-17
46Can s 3.0101W0U0V5Go!9180.01.4e-17
47Zea m 14.0102P19656-2Go!12880.21.7e-17
48Art ca 3.0101ANC85021Go!11779.91.9e-17
49Art an 3.0101ANC85017Go!11779.91.9e-17
50Api g 2ACV04796Go!11879.23.2e-17
51Sin a 3.0101ABU95411Go!9276.22.0e-16
52Tri tu 14.0101CAH69206Go!11570.41.4e-14
53Sola l 7.0101NP_001316123Go!11570.21.6e-14
54Hor v 1AAA32970Go!11769.33.0e-14
55Hor v 1CAA42832Go!13468.85.1e-14
56Hel a 3.0101P82007Go!11666.81.8e-13
57Tri a 14.010119846220Go!9064.56.7e-13
58Par j 2O04403Go!13346.62.3e-07
59Par j 2P55958Go!13343.22.6e-06
60Amb a 6O04004Go!11840.31.7e-05
61Par j 1Q40905Go!13840.32.0e-05
62Par j 1P43217Go!13939.04.8e-05
63Par j 1.0103CAI94601Go!13938.76.1e-05
64Par j 1O04404Go!17637.32.0e-04
65Art v 3.0101P0C088Go!3734.23.5e-04
66Par j 1.0101CAA54587Go!13334.88.7e-04
67Cas s 810998016Go!3631.72.0e-03
68Vit v 1P80274Go!3729.97.2e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 100.00 (116/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
Sequence 2 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
Sequence 2 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV

Sequence 1 NIPYKISTSTNCASIK
           NIPYKISTSTNCASIK
Sequence 2 NIPYKISTSTNCASIK



Alignment 2
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 63.79 (74/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KLA--V--CMVV-S-P---A-TCGQV--NLA-C--Y-R-GGAV
Sequence 2 MACSAMTKLALVVALCMVV-SVPIAQALTCGQVSSNLAPCIAYVRGGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           P--CCNGI-NI-NLAKTT-DR-TACNCLK---A--PG-N--NA--LPGKC
Sequence 2 PPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GVN-PYKIS-STNCA--K
Sequence 2 GVNVPYKISPSTNCATVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 62.07 (72/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           ----VK-AC-V--CMVVV-A------TCGQV--NL--C---L--GG-VPA
Sequence 2 -MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPA

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CCNG--NI-N-A--T-DRR--CNCLK-AA----GLNP-NA--LPGKCGV
Sequence 2 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV

Sequence 1 NIPYKISTSTNCASIK
           NIPYKISTSTNCASI-
Sequence 2 NIPYKISTSTNCASIN



Alignment 4
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 65.52 (76/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KLA--V--CM-V--A----AITC-QV-ANLA-C-NY-RSGGAV
Sequence 2 MASSAVIKLALVVALCMAVSVA---HAITCSQVSANLAPCINYVRSGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           P--CCNGIK-I--LAKTTPDR--ACNCLK--A----G-NP-NA-SLPGKC
Sequence 2 PPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GVN-PYKISTSTNCA--K
Sequence 2 GVNVPYKISTSTNCATVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 61.21 (71/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KLA---L-C--VV--P---AITCGQVT-N-A-C-NY---GGAV
Sequence 2 MACSAVMKLALVALLC-IVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           PA-CCNG--N----AKTT-DR---CNCLK-AA---PGLNPS-A--LPGKC
Sequence 2 PAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GV--PYKISTSTNCA--K
Sequence 2 GVSVPYKISTSTNCATVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 62.07 (72/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KLA--V--CM-V--A----AITCGQVT--LA-C--Y-RSGGAV
Sequence 2 MASSAVTKLALVVALCMAVSVA---HAITCGQVTSSLAPCIGYVRSGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           P--CCNGI--I--LA-TT-DR-TACNCLK--A----G-NP-NA--LPGKC
Sequence 2 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GVN-PYKISTSTNCA--K
Sequence 2 GVNVPYKISTSTNCATVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 56.90 (66/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KL----L-C--VV--P---AITCGQV--N---C--Y--SGGAV
Sequence 2 MASSTAMKLSLVALLC-IVVALPIAQAITCGQVASNISPCVTYVKSGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           PAPCC-GI-N----AKTT-DR---CNCLK-AA----GLNP--A--LPGKC
Sequence 2 PAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GV--PYKIST-TNCA--K
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 57.76 (67/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KL----L-C--VV--P---AITCGQV--N---CL-Y--SGGAV
Sequence 2 MASSTAMKLSLVALLC-IVVALPIAQAITCGQVASNISPCLTYVKSGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           PA-CC-GI-N----AKTT-DR--ACNCLK-AA----GLNP--A--LPGKC
Sequence 2 PAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GV--PYKIST-TNCA--K
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 57.76 (67/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KL----L-C--VV--P---AITCGQV------C-NY--SGGAV
Sequence 2 MAISTAMKLSLVALLC-IVVALPIAQAITCGQVASSISPCVNYVKSGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           PA-CCNGI------AKTT-DR-T-CNCLK-A-----GLNP--A--LPGKC
Sequence 2 PAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GVN-PYKISTSTNCA--K
Sequence 2 GVNVPYKISTSTNCAAVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 58.62 (68/116)
Sequence 1 MAGIVKLACAV-LICMVVVSAPLTKA-ITCGQVTANLAQCLNYLRSGGAV
           -------AC-V---C-VV--AP---A-I-CGQVT--LA-C---L--GG-V
Sequence 2 -MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           PA-CC-G-------AKTTPDR---CNCLK-AA---PG-N--NAG-LPGKC
Sequence 2 PASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKC

Sequence 1 GVNIPYKISTSTNCASIK-
           GV-IPYKISTSTNCA-IK-
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 11
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 56.90 (66/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KL----L-C--VV--P---AITCGQV------C-NY--SGGAV
Sequence 2 MASSTAMKLSLVALLC-IVVALPIAQAITCGQVASSISPCVNYVKSGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           PA-CCNGI------AKTT-DR---CNCLK-A-----GLNPS-A--LPGKC
Sequence 2 PAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GV--PYKISTSTNCA--K
Sequence 2 GVSVPYKISTSTNCAAVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 53.45 (62/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -------------------------ITCGQV--NLA-C-NY---GGAVP-
Sequence 2 -------------------------ITCGQVSSNLAPCINYVKGGGAVPP

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CCNGI-N--NLA-TT-DRR-ACNCLK------PG-NP-NA--LPGKCGV
Sequence 2 ACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGV

Sequence 1 NIPYKISTSTNCASIK
           N-PYKIS-STNCA--K
Sequence 2 NVPYKISASTNCATVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 54.31 (63/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -------------------------ITCGQV---LA-C--Y-R-GGAVP-
Sequence 2 -------------------------ITCGQVSSSLAPCIGYVRGGGAVPP

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CCNGI-N--NLA-TTPDRRTACNCLK-------G-NP-NA--LPGKCGV
Sequence 2 ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGV

Sequence 1 NIPYKISTSTNCASIK
           NIPYKIS-STNCA--K
Sequence 2 NIPYKISASTNCATVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 56.90 (66/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           MA---K-A---L-CM--V-AP---AI-CGQV---LA-C---L--GGA-P-
Sequence 2 MASL-KFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPP

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CC-G----L----TT-DR--ACNCLKAAA----GLN--NA--LPG-CGV
Sequence 2 ACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGV

Sequence 1 NIPYKISTSTNCASIK-
           -IPYKISTSTNCA-IK-
Sequence 2 SIPYKISTSTNCATIKF



Alignment 15
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 53.45 (62/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -------------------------ITCGQV---LA-C--Y-R-GGAVP-
Sequence 2 -------------------------ITCGQVSSSLAPCIPYVRGGGAVPP

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CCNGI-N--NLA-TTPDR--ACNCLK---A--PG-NP-NA--LPGKCGV
Sequence 2 ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGV

Sequence 1 NIPYKISTSTNCASIK
           -IPYKIS-STNCA--K
Sequence 2 SIPYKISASTNCATVK



Alignment 16
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 53.45 (62/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -------------------------ITCGQV---LA-C--Y-R-GGAVP-
Sequence 2 -------------------------ITCGQVSSALAPCIPYVRGGGAVPP

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CCNGI-N--NLA-TTPDR--ACNCLK---A--PG-NP-NA--LPGKCGV
Sequence 2 ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGV

Sequence 1 NIPYKISTSTNCASIK
           -IPYKIS-STNCA--K
Sequence 2 HIPYKISASTNCATVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 62.07 (72/116)
Sequence 1 MAGIVKLACAVL-ICMVVVSAPLTK-AITCGQVTANLAQCLNYLRSGGAV
           MA---KLAC-VL-ICMVV--AP----AI-CG-VT--L--CL-YL--GG--
Sequence 2 MARGMKLACVVLVICMVVI-APMAEGAISCGAVTSDLSPCLTYL-TGGPG

Sequence 1 PAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGK
           P-P-CC-G-K--L--A-TTPDR--ACNCLK-AA-----LN--NA--LPGK
Sequence 2 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK

Sequence 1 CGVNIPYKISTSTNCASIK-
           CGVNIPYKIST-TNC---K-
Sequence 2 CGVNIPYKISTTTNCNTVKF



Alignment 18
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 59.48 (69/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLT-KAITCGQVTANLAQCLNYLRSGGAVP
           MA---K-------CM-V--AP-T--AITCGQV---L--CL-YL---G--P
Sequence 2 MAAL-KMVSFLVLCMLV-AAPMTAQAITCGQVQSALVPCLSYLKTTGPTP

Sequence 1 -APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           -A-CCNG---I-N-AKTT-DRRTAC-CLK-AA----GLNP-----LPGKC
Sequence 2 PATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GVNIPYKIS-STNCA--K
Sequence 2 GVNIPYKISLSTNCATVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 57.76 (67/116)
Sequence 1 MAGIVKLAC-AVLICMVVVSAPLTKA-ITCGQVTANLAQCLNYLRS--GG
           MA---KLAC-A--ICMVV--AP---A---CG-V-A--A-C--YL------
Sequence 2 MARSMKLACVALVICMVVI-APMAEAALSCGTVSADMAPCVTYLQAPNNA

Sequence 1 AVPAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPG
           --P-PCC-G-K--L--A-TTPDR--ACNCLK-AA---P-LN--NA--LPG
Sequence 2 SPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPG

Sequence 1 KCGVNIPYKISTSTNCASIK-
           KCGV-IPYKISTSTNC-----
Sequence 2 KCGVSIPYKISTSTNCNTVRF



Alignment 20
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 53.45 (62/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKA-ITCGQVTANLAQCLNYLRSGGAVP
           --G--KL-CAVL-CM-V--AP---A--TC-Q---NL--C--YL--GG--P
Sequence 2 -MGSLKLVCAVLLCMMV-AAPVARASLTCPQIKGNLTPCVLYLKNGGVLP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           --CC-G---------TT-DR--ACNCLK--A----GLNP--A--LPGKCG
Sequence 2 PSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS-STNC---K
Sequence 2 VNIPYKISPSTNCNNVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 53.45 (62/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KLAC--L-CMV--------AITCG-V---L--CL-YLRSGGAV
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           ---CCNG-K---N-AKTTPDR--AC-CLK-A-----G----NA-SL-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GVN-PYKIS----C---K
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 22
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 52.59 (61/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           -------KLAC--L-CMV--------AITCG-V---L--CL--LRSGGAV
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           ---CCNG-K---N-AKTTPDR--AC-CLK-A-----G----NA-SL-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNIPYKISTSTNCASIK
           GVN-PYKIS----C---K
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 55.17 (64/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLT--KAITCGQVTANLAQCLNYLRS-G
           ----G--KLACAV------V-AP-----A-TCGQV---LA-C--Y-RS-G
Sequence 2 MTGSGLFKLACAVFA-VALVAAPIATEAAVTCGQVASSLAPCIPYARSAG

Sequence 1 GAVPAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLP
           GAVP--CC-GIK-----A-TTPDR---C-CLK-A-----G-N-----SLP
Sequence 2 GAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLP

Sequence 1 GKCGVNIPYKISTSTNCASIK
           -KCGVNIPYKIS-ST-CA--K
Sequence 2 AKCGVNIPYKISPSTDCARVK



Alignment 24
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 50.00 (58/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--CA---CMV--S-----A-TC--V------CLNYL--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVL-SSSYAEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR-TACNCLK--------L----A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 25
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 50.00 (58/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--CA---CMV--S-----A-TC--V------CLNYL--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVL-SSSYAEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR-TACNCLK--------L----A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 50.00 (58/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--CA---CMV--S-----A-TC--V------CLNYL--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVL-SSSYAEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR-TACNCLK--------L----A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 51.72 (60/116)
Sequence 1 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV
           ----G---LA--VL-CM-V-S------ITCGQV---LA-C--Y-R--GA-
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 PAP--CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPG
           P-P--CCNGI------AKTTPDR--AC-CLK--A----G-N-------PG
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG

Sequence 1 KCGVNIPYKISTSTNCASIK
           KCGV-IPYKI--STNC---K
Sequence 2 KCGVSIPYKIAPSTNCDNVK



Alignment 28
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 49.14 (57/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -------------------------ITCGQV---LA-C-NYLR-GG-VPA
Sequence 2 -------------------------ITCGQVSSSLAPCINYLRAGGVVPA

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CCNG-----N-AKTT-DR--ACNCLK-A-----GLN---A--LPGKCGV
Sequence 2 NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGV

Sequence 1 NIPYKISTSTNCASIK
           --PYKIS-ST-C-S-K
Sequence 2 SVPYKISPSTDCKSVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 50.86 (59/116)
Sequence 1 ---MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGA
           ---------L--A---CMVV-------A-TCGQVT--L--C--Y-R---A
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 VP-APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPG
           -P-A-CC-G-----N-AKTTPDR-TACNCLK--A----G-N----G-LPG
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGVNIPYKISTSTNCASIK
           KCGV-IPYKIS-ST-C---K
Sequence 2 KCGVSIPYKISPSTDCSRVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 48.28 (56/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--C----CMVV-S-----A-TC--V------CL--L--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR-TACNCLK--------L---NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 48.28 (56/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -----K--CA---CMVV-S-----A--C--V------CL-YL--GG-VPA
Sequence 2 -MKMMKFFCAMVVCMVV-SSSYAEALKCSDVSNKISACLSYLKQGGEVPA

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CC-G-K-----AKTTPDR-TACNCLK-------------A-SLP-KCGV
Sequence 2 DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGV

Sequence 1 NIPYKISTSTNCASIK
           NIPYKIS--T-C---K
Sequence 2 NIPYKISLETDCNKVK



Alignment 32
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 48.28 (56/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--CA---CMVV-S-----A--C--V------CL-YL--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVV-SSSYAEALKCSDVSNKISACLSYLKQGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR-TACNCLK-------------A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 33
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 48.28 (56/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--CA---CMVV-S-----A--C--V------CL-YL--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVV-SSSYAEALKCSDVSNKISACLSYLKQGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR-TACNCLK-------------A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 34
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 46.55 (54/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--C----CMVV-S-----A-TC--V------C---L--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR-TACNCLK------------NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 35
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 47.41 (55/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           ---------------------------CGQV---LA-C---L--GG----
Sequence 2 -------------------------LSCGQVNSALAPCITFLTKGGVPSG

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           PCC-G----L--AKTT-DR--ACNCLKAAA----GLN--NA--LPG-CGV
Sequence 2 PCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGV

Sequence 1 NIPYKISTSTNCASIK-
           -IPYKISTSTNCA-IK-
Sequence 2 SIPYKISTSTNCATIKF



Alignment 36
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 51.72 (60/116)
Sequence 1 ---MAGIVKLAC--AVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSG
           --------KL-C--AV--CM-V-------A--CGQV--NL--C-NY---G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GAVPAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAG---
           GA----CC-G------LA-TT-DR---CNCLK-A----P--N--NAG---
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTN-ANAGLAA

Sequence 1 SLPGKCGVNIPYKISTSTNCASIK
           -LPGKCGVNIPYKIS-ST-C--IK
Sequence 2 GLPGKCGVNIPYKISPSTDCKTIK



Alignment 37
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 50.86 (59/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           M----K-AC-V--CMVVV-AP------CG-VT--LA-CL-YL---G----
Sequence 2 MEMFGKIACFVVFCMVVV-APHAESLSCGEVTSGLAPCLPYLEGRGPLGG

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CC-G-K--L--AKT--DR-TAC-CLK-AA----G-----A--LPG-CGV
Sequence 2 -CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV

Sequence 1 NIPYKISTSTNCASIK
           NIPYKIS-ST-C----
Sequence 2 NIPYKISPSTDCSTVQ



Alignment 38
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 50.86 (59/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           M----K-AC-V--CMVVV-AP------CG-VT--LA-CL-YL---G----
Sequence 2 MEMFGKIACFVVFCMVVV-APHAESLSCGEVTSGLAPCLPYLEGRGPLGG

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CC-G-K--L--AKT--DR-TAC-CLK-AA----G-----A--LPG-CGV
Sequence 2 -CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV

Sequence 1 NIPYKISTSTNCASIK
           NIPYKIS-ST-C----
Sequence 2 NIPYKISPSTDCSTVQ



Alignment 39
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 46.55 (54/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--C----CMVV-S-----A-TC--V------CL--L--GG-VP
Sequence 2 MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKT-PDR--ACNCLK--------L---NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNTVK



Alignment 40
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 50.86 (59/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           ------------------------AI-C--VT---A-C--YL-SGG-V--
Sequence 2 ------------------------AIQCSFVTKSIAPCFGYLKSGGTVSG

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPG-LNPSNAGSLPGKCG
           PCC-GI-NI---AKTT-DR---CNCLK-AAA------NP-NA-SLPGKCG
Sequence 2 PCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCG

Sequence 1 VNIPYKISTSTNCASIK
           V-IPYKISTS-NC-SIK
Sequence 2 VSIPYKISTSINCSSIK



Alignment 41
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 45.69 (53/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--C----CMVV-S-----A-TC--VT-----C---L--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           --CC-G-K-----AKTTPDR--ACNCLK------------NA--LP-KCG
Sequence 2 VDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 42
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 45.69 (53/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -----K--C----CMVV-S-----A-TC--V------CL-YL--GG-VPA
Sequence 2 -MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPA

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CC-G-K------KTTPDR-TACNCLKA-------L----A--LP-KCG-
Sequence 2 DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGL

Sequence 1 NIPYKISTSTNCASIK
           N-PYK-S--T-C---K
Sequence 2 NLPYKLSLETDCNKVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 44.83 (52/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--C----CMVV-------A-TC--V------CL-YL--GG-VP
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K------KTTPDR-TACNCLKA-------L----A--LP-KCG
Sequence 2 ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           -N-PYK-S--T-C---K
Sequence 2 LNLPYKLSLETDCNKVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 46.55 (54/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--C----CMVV-S-----A-TC--V------CLNYL--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVV-SSSYAEALTCSDVSNKISPCLNYLKQGGEVP

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR-TAC-CLK--------L----A--LP-KCG
Sequence 2 ANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           V-IPYK-S--T-C---K
Sequence 2 VTIPYKLSMETDCNKVK



Alignment 45
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 48.28 (56/116)
Sequence 1 ---MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGA
           ----------A-AV--------A----AI-CGQV----A-C--Y-R--G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VP-APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPG
           -P-A-CC-G-----N-A-TT-DRR-ACNCLK-AAA---GLN--NA-S-P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISTSTNCASIK
           KCGV-IPY-ISTST-C----
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 46
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 47.41 (55/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -------------------------ITCGQV---LA-CL-YL--GGAVP-
Sequence 2 -------------------------ITCGQVASSLAPCLSYLKVGGAVPD

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CCN-IK-----AKT--DR--AC-CLK-AA----G-N---A--LPGKCGV
Sequence 2 GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPGKCGV

Sequence 1 NIPYKISTSTNCASIK
           -IPYKIS-ST-C-S-K
Sequence 2 SIPYKISPSTDCSSVK



Alignment 47
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 48.28 (56/116)
Sequence 1 ---MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGA
           ----------A-AV--------A----AI-CGQV----A-C--Y-R--G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VP-APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPG
           -P-A-CC-G-----N-A-TT-DRR-ACNCLK-AAA---GLN--NA-S-P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISTSTNCASIK--------
           KCGV-IPY-ISTST-C------------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 48
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 44.83 (52/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--C----CMVV-S-----A-TC--V------C---L--GG-V-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR--ACNCLK------------NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 49
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 44.83 (52/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           ------K--C----CMVV-S-----A-TC--V------C---L--GG-V-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           A-CC-G-K-----AKTTPDR--ACNCLK------------NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 VNIPYKISTSTNCASIK
           VNIPYKIS--T-C---K
Sequence 2 VNIPYKISLETDCNKVK



Alignment 50
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 47.41 (55/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAP-LTKAITCGQVTANLAQCLNYLRSGGAV
           -----V--A-AV----VV---P------TCGQVT--L--CL-YL--GG--
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGG-Y

Sequence 1 PAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGK
           P-P-CC-G-K----LAKT--DR--AC-CLK--A----G-N---A--LPGK
Sequence 2 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK

Sequence 1 CGVNIPYKISTSTNCASIK
           CG--IPY-IS-ST-C----
Sequence 2 CGIRIPYPISPSTDCSRVN



Alignment 51
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 42.24 (49/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           ------------------------A--CG-V--NLA-C--YL------P-
Sequence 2 ------------------------ALSCGTVNSNLAACIGYLTQNAPLPK

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CC-G--N--N-A-TTPDR--AC-CL--AA---P-LN---A--LP--CGV
Sequence 2 GCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKACGV

Sequence 1 NIPYKISTSTNCASIK
           NIPYKIS-STNC-S--
Sequence 2 NIPYKISKSTNCNSVR



Alignment 52
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 41.38 (48/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTK----AITCGQVTANLAQCLNYLRSGG
           -------A-A------VV-A-L------A--CGQV---L--C--Y-R--G
Sequence 2 ---MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNG

Sequence 1 AVP-APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLP
           A-P-A-CC-G-------A--T-D---AC-C-K-AAA---GLN---A---P
Sequence 2 ASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIP

Sequence 1 GKCGVNIPYKISTSTNCASIK
           -KCGV--PY-IS-S--C--I-
Sequence 2 TKCGVSVPYAISSSVDCSKIR



Alignment 53
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 42.24 (49/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTK--AITCGQVTANLAQCLNYLRSGGAV
           -------A--VL----V---------AITCGQV-ANLA-C---L--GG--
Sequence 2 ---MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEP

Sequence 1 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           -A-CC-G------------DRRTACNC-KAAA---P-L----A-SLP-KC
Sequence 2 GAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKC

Sequence 1 GVNIPYKISTSTNCASIK
           G------IS---NC--I-
Sequence 2 GISLTVPISRTVNCDTIS



Alignment 54
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 38.79 (45/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           -----V-L--A-L--M---------A--CGQV------CL-Y---G----
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           --CCNG-----N-A----DR-T-CNCLK--A-----LN--NA-S-P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNIPYKISTSTNCASIK
           VN-PY-IS----C--I-
Sequence 2 VNVPYTISPDIDCSRIY



Alignment 55
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 37.93 (44/116)
Sequence 1 -MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP
           -----V-L--A-L--M---------A--CGQV------CL-Y---G----
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           --CCNG-----N-A----DR-T-CNCLK--A-----LN--NA-S-P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 VNIPYKISTSTNCASIK-----------------
           VN-PY-IS----C---------------------
Sequence 2 VNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 56
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 45.69 (53/116)
Sequence 1 ----MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGG
           ------G---LA--V-----V---P---AITC--VT-NL--CL-YLRSGG
Sequence 2 MKGTSMGVAILAMIVMAQLMV--HP-SVAITCNDVTGNLTPCLPYLRSGG

Sequence 1 AVPAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLP
           --P-P-CC-G-K--L----T--DRRTAC-C-K-AA-------P--A-SLP
Sequence 2 K-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLP

Sequence 1 GKCGVNIPYKISTSTNCASIK
           GKCG------I----NC--I-
Sequence 2 GKCGISTSIPINPNVNCNTIP



Alignment 57
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 34.48 (40/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -------------------------I-CG-V------CL-Y---G-----
Sequence 2 -------------------------IDCGHVDSLVRPCLSYVQGGPGPSG

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CC-G-KN--N-A----DR--ACNCLK--A-----LN--NA-S-P-KCGV
Sequence 2 QCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGV

Sequence 1 NIPYKISTSTNCASIK
           N-PY-IS----C----
Sequence 2 NLPYTISLNIDCSRV-



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 31.03 (36/116)
Sequence 1 -----MAGIVKLACAV--LICMVVVSAPLTKAITCGQVTANLAQCLNYLR
           -----MA--V--A-A----------SAP------CG-V------CL----
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 SGGAVPAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAG
           -----P---CC-G-K------KTT---R-AC-C--AA-----G-------
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 SLPGKCGV--NIPYKISTSTNCASIK--------
           --P-KCG-----P--I-----C--I---------
Sequence 2 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 28.45 (33/116)
Sequence 1 -----MAGIVKLACAVLICMVV--VSAPLTKAITCGQVTANLAQCLNYLR
           -----MA--V--A-A-----------AP------CG-V------CL----
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 SGGAVPAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAG
           -----P---CC-G-K------KTT---R-AC-C---A-----G-------
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 SLPGKCGV--NIPYKISTSTNCASIK--------
           --P-KC------P--I-----C--I---------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 27.59 (32/116)
Sequence 1 MAGIVKLACAVLICMVVVS-AP--LTKAITCGQVTANLAQCLNYLRSGGA
           ----------V------VS--P-------TC--V---LA-C---L--G--
Sequence 2 -MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFL-TGQE

Sequence 1 VPAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGK
           ----CC-G--N--N--KT--DR---CNC-K----------P-----L--K
Sequence 2 PSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AYDPKRMPLLSTK

Sequence 1 CGVNIPYK-ISTSTNCASIK-
           CGV------------C-----
Sequence 2 CGVKPDFPAVDKNLDCSKLPV



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 28.45 (33/116)
Sequence 1 --------MAGIVKLACAVLI---CMVVVSAPLTKAI-TCGQVTANLAQC
           ------------V----AVL-------V--AP------TCG-V---L--C
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 LNYLRSGGAVPAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLN
           L---------P---CC-G-K------KT-P-R--AC-C---A--------
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 PSNAGSLPGKCGV---NIPYKISTSTNCASIK-------
           -------P--CG------P--I-----C-----------
Sequence 2 GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 21.55 (25/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           --------------------------TCG-----L--CL---------P-
Sequence 2 ------------------------QETCGTMVRALMPCLPFVQGKEKEPS

Sequence 1 P-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           --CC-G-K------KT-P-R--AC-C---A---------------P--CG
Sequence 2 KGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCG

Sequence 1 V---NIPYKISTSTNCASIK------------------------------
           ------P--I-----C----------------------------------
Sequence 2 IVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLE

Sequence 1 --------------
           --------------
Sequence 2 RPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 21.55 (25/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           --------------------------TCG-----L--CL---------P-
Sequence 2 ------------------------QETCGTMVRALMPCLPFVQGKEKEPS

Sequence 1 P-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           --CC-G-K------KT-P-R--AC-C---A---------------P--CG
Sequence 2 KGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCG

Sequence 1 V---NIPYKISTSTNCASIK------------------------------
           ------P--I-----C----------------------------------
Sequence 2 IVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLE

Sequence 1 --------------
           --------------
Sequence 2 RPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 23.28 (27/116)
Sequence 1 --------------MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLA
           ---------------------------------AP-----TCG-V---L-
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEE-TCGTVVRALM

Sequence 1 QCLNYLRSGGAVPAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPG
           -CL---------P---CC-G-K------KT---R--AC-C---A------
Sequence 2 PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD

Sequence 1 LNPSNAGSLPGKCGV---NIPYKISTSTNCASIK----------------
           ---------P--CG------P--I-----C--------------------
Sequence 2 IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGP

Sequence 1 ----------------------------
           ----------------------------
Sequence 2 VTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 14.66 (17/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           ------------------------A-TC--V------CL-YL--GG-VPA
Sequence 2 ------------------------ALTCSDVSNKISPCLSYLKQGGEVPA

Sequence 1 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV
           -CC-G-K-------------------------------------------
Sequence 2 DCCAGVKGLND---------------------------------------

Sequence 1 NIPYKISTSTNCASIK
           ----------------
Sequence 2 ----------------



Alignment 66
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 18.97 (22/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           ----------------------------------L--CL---------P-
Sequence 2 ------------------------------MVRALMPCLPFVQGKEKEPS

Sequence 1 P-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           --CC-G-K------KT-P-R--AC-C---A---------------P--CG
Sequence 2 KGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCG

Sequence 1 V---NIPYKISTSTNCASIK------------------------------
           ------P--I-----C----------------------------------
Sequence 2 IVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLE

Sequence 1 --------------
           --------------
Sequence 2 RPQIRVPPPAPEKA



Alignment 67
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 15.52 (18/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           -------------------------ITC-QV---L--CL-YL-S-G--P-
Sequence 2 ------------------------SITCTQVSKSLMPCLTYLKSNGGSPP

Sequence 1 P--CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC
           P--CC-G-K-----------------------------------------
Sequence 2 PGTCCQGVKL----------------------------------------

Sequence 1 GVNIPYKISTSTNCASIK
           ------------------
Sequence 2 ------------------



Alignment 68
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 13.79 (16/116)
Sequence 1 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA
           --------------------------TCGQV---L--C--YL---GAVPA
Sequence 2 ------------------------TVTCGQVASALSPCIDYLQKDGAVPA

Sequence 1 -PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCG
           --CC----------------------------------------------
Sequence 2 GSCCXKXLSSA---------------------------------------

Sequence 1 VNIPYKISTSTNCASIK
           -----------------
Sequence 2 -----------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.