The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Pin k 2.0101

Sequence VCL_PINKO

Full FASTA alignment

Sequence name:
Query sequence:
MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEG
ISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKL
EEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGR
NPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMR
RGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDV
TVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSP
RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINT
SGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRG
PQRQRRDEPRSSS

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Pin k 2.0101V9VGU0Go!463625.02.6e-180
2Ses i 3AAK15089Go!585217.02.2e-57
3Jug r 6.0101A0A2I4E5L6Go!502216.62.5e-57
4Mac i 1.0201Q9SPL4Go!666216.43.7e-57
5Jug r 2AAF18269Go!593213.03.4e-56
6Mac i 1.0101Q9SPL3Go!625212.64.7e-56
7Jug n 2AAM54366Go!481208.85.1e-55
8Pis v 3.0101EF116865Go!519204.21.3e-53
9Car i 2.0101B3STU4Go!792203.14.4e-53
10Gly m conglycininAAB23463Go!439156.33.0e-39
11Cor a 11AAL86739Go!448150.91.3e-37
12Ana o 1.0101AAM73730Go!538143.42.8e-35
13Ana o 1.0102AAM73729Go!536143.23.2e-35
14Vig r 2.0101Q198W3Go!453111.21.2e-25
15Vig r 2.0201B1NPN8Go!454111.01.4e-25
16Gly m 5.0201Q9FZP9Go!559107.61.7e-24
17Gly m 5.0101O22120Go!543106.24.4e-24
18Gly m conglycininCAA35691Go!605106.24.8e-24
19Len c 1.0102CAD87731Go!41586.52.9e-18
20Len c 1.0101CAD87730Go!41885.36.6e-18
21Lup an 1.0101ACB05815Go!61185.58.2e-18
22Coc n 1.0101A0A0S3B0K0Go!49083.72.3e-17
23Ara h 1P43237Go!61482.47.5e-17
24Ara h 1P43238Go!62681.81.2e-16
25Gly m Bd28KBAB21619Go!47377.02.4e-15
26Gly m conglycininAAA33947Go!21874.37.1e-15
27Gly m conglycininAAB01374Go!63966.74.2e-12
28Pis v 2.0201DQ631677Go!47242.65.5e-05

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Pin k 2.0101, Sequence: V9VGU0
Sequence identity: 100.00 (463/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
           MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
Sequence 2 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG

Sequence 1 RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEG
           RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEG
Sequence 2 RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEG

Sequence 1 ISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKL
           ISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKL
Sequence 2 ISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKL

Sequence 1 EEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGR
           EEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGR
Sequence 2 EEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGR

Sequence 1 NPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMR
           NPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMR
Sequence 2 NPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMR

Sequence 1 RGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDV
           RGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDV
Sequence 2 RGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDV

Sequence 1 TVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSP
           TVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSP
Sequence 2 TVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSP

Sequence 1 RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINT
           RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINT
Sequence 2 RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINT

Sequence 1 SGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRG
           SGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRG
Sequence 2 SGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRG

Sequence 1 PQRQRRDEPRSSS
           PQRQRRDEPRSSS
Sequence 2 PQRQRRDEPRSSS



Alignment 2
Sequence 1:
Sequence 2: Allergen Ses i 3, Sequence: AAK15089
Sequence identity: 37.58 (174/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSCGGRLCLVLFALLLASAVVASESKDPELKQCKHQCKAQQQISKEQKEA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 CIQACKEYIRQKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGCEQQH

Sequence 1 ------------------------------MAFVSLLTILLAISSSSVAL
           --------------------------------------------------
Sequence 2 GEQREECLRRCQEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQGEGGGF

Sequence 1 TEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGRE--EEREEN---
           --------------EQ-GR--------E-GRG----GRE--EE-EE----
Sequence 2 SREHCERRREEKYREQQGR--------EGGRGEMYEGREREEEQEEQGRG

Sequence 1 --PYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKP
           --PYVF----F--------G--R-L--F---SELL-GI--YRV---E--P
Sequence 2 RIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEP

Sequence 1 NTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHT
           -T---P---DA-----V--GRG-I--V-Q----------GD------G-T
Sequence 2 QTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTT

Sequence 1 FYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDV
           -YL-N-D----L--A-LL---ST--GE-E-F--AGG-NPE-----FSD--
Sequence 2 AYLINRDNNERLVLAKLLQPVSTP-GEFELFFGAGGENPESFFKSFSDEI

Sequence 1 LEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMR--RGG---FSAES
           LEAAFNT----L--IFG--R-GVI--A-EEQ-R-M-R---GG---F--ES
Sequence 2 LEAAFNTRRDRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGES

Sequence 1 TSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLN
           ----------N---Q-P---N--G------------L---D-TV------
Sequence 2 KGT------INIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANIT

Sequence 1 PGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDI
           -G-MTAP--N-KAT-IA-V--GEG--EMACPH-----G------RG----
Sequence 2 QGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRP--

Sequence 1 NYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFL
           -Y-RV--RL--GTV---PAGHP----AS-N--L--L-F--N---NE---L
Sequence 2 SYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPL

Sequence 1 AGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDE
           AG--NV---LE-E---L-F--P---E-EEV---Q-------GP--Q----
Sequence 2 AGRRNVMNQLEREAKELAFGMP-AREVEEVSRSQQEEFFFKGPRQQQQGR

Sequence 1 PRSSS
           -----
Sequence 2 ADA--



Alignment 3
Sequence 1:
Sequence 2: Allergen Jug r 6.0101, Sequence: A0A2I4E5L6
Sequence identity: 36.29 (168/463)
Sequence 1 -----------------------------MAFVSLLTILLAISSSSVALT
           --------------------------------------------------
Sequence 2 MAFKPKIPIALLLLTSLLAICAGLALAMQDPELKQCKHQCRHQRQFDEQE

Sequence 1 EPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREEE-----REENP
           -------------E---R--------E-G-----G--EEE------EENP
Sequence 2 KEHCQRSCDEYHIEKKARERAERRRSEEGSSREEGYEEEELGGEREEENP

Sequence 1 YVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTV
           YVF----F--R-----G-I--L--F---S-LL-GI---RV---E--P-T-
Sequence 2 YVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQTF

Sequence 1 MLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYL
           --P---DA-----V--GR--I--V----------E-GD----P-G---YL
Sequence 2 ISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYL

Sequence 1 VNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEA
           -N-D----L-I---LR--S---G--E-F---GG--PE--Y-AFS--VLEA
Sequence 2 INRDENEKLYIVKILRPVS-VPGHFEAFHGSGGEDPESFYRAFSWEVLEA

Sequence 1 AFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRGGFSAES-TSASEQP
           A--T----LE--FG----GVI--A--EQIR-M------------------
Sequence 2 ALKTRRDQLEKLFGKQTQGVIIKASKEQIRSMSKHEETTPRIWPFGGDST

Sequence 1 KPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAP
           -PFNL----P---N--GR-----PK----L---D--V-F-----G-M--P
Sequence 2 HPFNLFHKRPSQSNQFGRLFETDPKECKQLQDLDLMVSFANITKGSMAGP

Sequence 1 SHNTKATSIAIVMEGEGRIEMACPHL------GQEHGWSSPRERGHQDIN
           --N--AT-I--V-EGEG--EMACPHL------GQ--G--S-R-R------
Sequence 2 YYNSRATKISVVIEGEGYFEMACPHLSSSGSRGQREGSGSSRRRSRSGPS

Sequence 1 YERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLA
           Y---R-RLR-G-V-V-PAGHP---IAS-N--L--L-FD-N--GN-R--LA
Sequence 2 YQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFDVNAQGNIRFPLA

Sequence 1 GKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEP
           GKNN-----EKE---L-FN-P---E-E-----Q-------GP-RQ-----
Sequence 2 GKNNIVNEFEKEAKELAFNFP-AREVEKIFRNQDQEFFFPGPSRQPEEGG

Sequence 1 RSSS
           R---
Sequence 2 RAFE



Alignment 4
Sequence 1:
Sequence 2: Allergen Mac i 1.0201, Sequence: Q9SPL4
Sequence identity: 36.29 (168/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAINTSNLCSLLFLLSLFLLSTTVSLAESEFDRQEYEECKRQCMQLETSG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QMRRCVSQCDKRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 YCQRRCKEICEEEEEYNRQRDPQQQYEQCQERCQRHETEPRHMQTCQQRC

Sequence 1 ------------------------------------MAFVSLLTILLAIS
           --------------------------------------------------
Sequence 2 ERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKRDPQQREYEDCRRR

Sequence 1 SSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREEEREE
           ---------------------QHGRG-----P---G-G----G-EE----
Sequence 2 CEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRYEEG-EEKQSD

Sequence 1 NPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPN
           NPY-F-------R---E-G-I--L-NF---S-LL-----YR----E--PN
Sequence 2 NPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPN

Sequence 1 TVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTF
           ---LP---DA--IL-VTGGRG--------------LE-GDV---P-G-TF
Sequence 2 AFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTF

Sequence 1 YLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVL
           YL-N-D----L-IA--L-T-ST--G-Y--F--AGG-NPE---S-FS---L
Sequence 2 YLINRDNNERLHIAKFLQTISTP-GQYKEFFPAGGQNPEPYLSTFSKEIL

Sequence 1 EAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRGGFSA--ESTSAS
           EAA-NT----L----G--R-GVI--A--EQIRE--R----S---------
Sequence 2 EAALNTQAERLRGVLGQQREGVIISASQEQIRELTRDDSESRRWHIRRGG

Sequence 1 EQPK-PFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGT
           E----P-NL-N--P---N--G------P-D---L---DV-V-------G-
Sequence 2 ESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGS

Sequence 1 MTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGW--SSPRERGHQDIN
           M--P--NT--T----V--GE---EMACPHL---HG------R-----D--
Sequence 2 MMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEEDVH

Sequence 1 YERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLA
           YE-V-ARL------VVP-GHP-----S-N--L----F-IN---N---FLA
Sequence 2 YEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLA

Sequence 1 GKN-NVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDE
           G---NVLQ--E-----L-F--PR--E-EE----Q-------GP-------
Sequence 2 GRERNVLQQIEPQAMELAFAAPR-KEVEELFNSQDESIFFPGPRQHQQQS

Sequence 1 PRSSS--------------
           -RS----------------
Sequence 2 SRSTKQQQPLVSILDFVGF



Alignment 5
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 37.37 (173/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE

Sequence 1 ------------------MAFVSLLTILLAISSSSVALTEPVASMADQGV
           --------------------------------------------------
Sequence 2 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ

Sequence 1 FPEQHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEA
           --EQ-GR---G--PE---R---RG--EE----NPY-FHS---R-R--SE-
Sequence 2 YKEQQGR-ERG--PEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEE

Sequence 1 GEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTG
           GE---L--F-E--ELL-GI--YRV------PNT-MLPH--DA-----VT-
Sequence 2 GEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTR

Sequence 1 GRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR
           GR-----V-Q-------LE-GDV--VP-G-T-Y--N-D----L----LL-
Sequence 2 GRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQ

Sequence 1 TESTMRGEYEPFYVAGGRNPETVY-SAFSDDVLEAAFNTDVQKLEHIFGA
           ------G-----Y-AG---P---Y---FS-D-L-AA-NT----LE--F--
Sequence 2 PVNNP-GQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQ

Sequence 1 H--RRGVIFYANEEQIREMMRRGGFSAESTSASEQP-------KPFNLRN
           ---R-GVI--A--E--R--------S----SA---P--------P--L--
Sequence 2 QEQREGVIIRASQEKLRAL------SQHAMSAGQRPWGRRSSGGPISLKS

Sequence 1 QKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKAT
           --P---N--G-F--A-P-----L---DV-V-------G-M--P--N-KAT
Sequence 2 ESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKAT

Sequence 1 SIAIVMEGEGRIEMACPHLG-QEHGWSSPRERGHQDIN--YERVRARLRT
           ----V-EG-GR-EMACPH---Q-------RE------------V-ARL--
Sequence 2 VVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLAR

Sequence 1 GTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLE
           G---V-PAGHPI---AS-N--L--L-FDIN---N-R-FLAG-NN----LE
Sequence 2 GDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLE

Sequence 1 KEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS------
           -E---LSFN-PR-EEIEE----Q------------RR---R---------
Sequence 2 REAKELSFNMPR-EEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILD

Sequence 1 ----
           ----
Sequence 2 FAFF



Alignment 6
Sequence 1:
Sequence 2: Allergen Mac i 1.0101, Sequence: Q9SPL3
Sequence identity: 36.07 (167/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQEDPQTECQQCQRRCRQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QESDPRQQQYCQRRCKEICEEEEEYNRQRDPQQQYEQCQKRCQRRETEPR

Sequence 1 ---------------------------------------------MAFVS
           --------------------------------------------------
Sequence 2 HMQICQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEGDNKRDPQQ

Sequence 1 LLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHR
           ------------------------------QHGRG-----P---G-G---
Sequence 2 REYEDCRRHCEQQEPRLQYQCQRRCQEQQRQHGRGGDLMNPQRGGSGRYE

Sequence 1 GGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYR
           -G-EE----NPY-F-------R---E-G-I--L-NF---S-LL-----YR
Sequence 2 EG-EEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYR

Sequence 1 VTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDV
           ----E--PN---LP---DA--IL-V-GGRG--------------LE-GDV
Sequence 2 LVLLEANPNAFVLPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGDV

Sequence 1 FGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETV
           ---P-G-TFYL-N-D----L-IA--L-T-ST--G-Y--F--AGG-NPE--
Sequence 2 IRIPAGTTFYLINRDNNERLHIAKFLQTISTP-GQYKEFFPAGGQNPEPY

Sequence 1 YSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRGGFS
           -S-FS---LEAA-NT----L----G--R-GVI--A--EQIRE--R----S
Sequence 2 LSTFSKEILEAALNTQTERLRGVLGQQREGVIIRASQEQIRELTRDDSES

Sequence 1 A--ESTSASEQPK-PFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTV
           ---------E----P-NL-N--P---N--G------P-D---L---DV-V
Sequence 2 RRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSV

Sequence 1 GFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGW--SSP
           -------G-M--P--NT--T----V--GE---EMACPHL---HG------
Sequence 2 FIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRGGGK

Sequence 1 RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINT
           R--------YE-VRARL------VV-AGHP-----S-N--L----F-IN-
Sequence 2 RHEEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGINA

Sequence 1 SGNEREFLAGKN-NVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILR
           --N---FLAG---NVLQ--E-----L-F---R--E-EE----Q-------
Sequence 2 QNNHENFLAGRERNVLQQIEPQAMELAFAASR-KEVEELFNSQDESIFFP

Sequence 1 GPQRQRRDEPRSSS--------------
           GP-------PRS----------------
Sequence 2 GPRQHQQQSPRSTKQQQPLVSILDFVGF



Alignment 7
Sequence 1:
Sequence 2: Allergen Jug n 2, Sequence: AAM54366
Sequence identity: 36.29 (168/463)
Sequence 1 ------MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGV
           ----------------------------------------EQ-GR---G-
Sequence 2 GRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGR-ERG-

Sequence 1 FPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEV
           -PE---R----G--EE----NPY-FHS---R-R--SE-GE---L--F-E-
Sequence 2 -PEASPRRESKGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFAER

Sequence 1 SELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNE
           -ELL-GI--YRV------PNT-MLPH--DA-----VT-GR-----V-Q--
Sequence 2 TELLRGIENYRVVILDANPNTFMLPHHKDAESVIVVTRGRATLTLVSQET

Sequence 1 LVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPF
           -----LE-GDV--VP-G-T-Y--N-D----L----LL-------G-----
Sequence 2 RESFNLECGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNP-GQVREY

Sequence 1 YVAGGRNPETVY-SAFSDDVLEAAFNTDVQKLEHIFGAH--RRGVIFYAN
           Y-AG---P---Y---FS-D-L-AA-NT----LE--F-----R-GVI--A-
Sequence 2 YAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRAS

Sequence 1 EEQIREMMRRGGFSAESTSASEQP-------KPFNLRNQKPDFENDNGRF
           -E--R--------S----SA---P--------P--L----P---N--G-F
Sequence 2 QEKLRAL------SQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQF

Sequence 1 TRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRI
           --A-P-----L---DV-V-------G-M--P--N-KAT----V-EG-GR-
Sequence 2 FEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRY

Sequence 1 EMACPHLGQEHGWSSPRERGHQDIN---YERVRARLRTGTVYVVPAGHPI
           EMACPH----------R--------------V-ARL--G---V-PAGHPI
Sequence 2 EMACPHVSSQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPI

Sequence 1 TEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPR
           ---AS-N--L--L-F-IN---N-R-FLAG-N-----LE-E---LSFN-PR
Sequence 2 AITASQNENLRLLGFGINGENNQRNFLAGQNSIINQLEREAKELSFNMPR

Sequence 1 GEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS----------
           -EEIEE----Q------------RR---R-------------
Sequence 2 -EEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILGFAFF



Alignment 8
Sequence 1:
Sequence 2: Allergen Pis v 3.0101, Sequence: EF116865
Sequence identity: 33.05 (153/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 KTDPELKQCKHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQEEEEEEE

Sequence 1 ------------MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHG
           --------------------------------------------------
Sequence 2 WGSGRGRGDEFSTHEPGEKRLSQCMKQCERQDGGQQKQLCRFRCQEKYKK

Sequence 1 RGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRAL
           ---------------------EE--ENPYVF----F--R---E-G----L
Sequence 2 ERREHSYSRDEEEEEEGDEEQEEEDENPYVFEDEHFTTRVKTEQGKVVVL

Sequence 1 PNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIA
           P-F---S-LL-G---YR-------P-----P---DA--I--V--GRG-I-
Sequence 2 PKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDADSIFFVSWGRGTIT

Sequence 1 YVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMR
           ----N---------GD------G--FY-VN-D----L-I--LL-------
Sequence 2 KIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQPVN-LP

Sequence 1 GEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIF
           G-YE-F---GG-NPE--Y-AFS--VLEAA--T---KLE--F-----G-I-
Sequence 2 GHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEKLFEKQDEGAIV

Sequence 1 YANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAG
           -A--EQIR-M-RRG---------------FNL----P---N--G------
Sequence 2 KASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQLFESE

Sequence 1 PKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMAC
           -KD-P-L---D--V-------G-M--P--N--AT-IAIV--GEGR-E-AC
Sequence 2 FKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIAC

Sequence 1 PHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTN
           PHL-------S--E-------Y-------RT--V-VVPAGHP----AS-N
Sequence 2 PHLSSSK--NSGQEKSGP--SYKKLSSSIRTDSVFVVPAGHPFVTVASGN

Sequence 1 GRLEILWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEV
           --LEIL-F--N--GN-R--LAGK-N-----EKE---L-F----GEE---V
Sequence 2 QNLEILCFEVNAEGNIRYTLAGKKNIIEVMEKEAKELAFKT-KGEEVDKV

Sequence 1 LQAQKDQVILRGPQRQRRDEPRSSS
           ---Q-------GP--------R---
Sequence 2 FGKQDEEFFFQGPKWRQHQQGRADE



Alignment 9
Sequence 1:
Sequence 2: Allergen Car i 2.0101, Sequence: B3STU4
Sequence identity: 36.93 (171/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVTKAKIPLFLFLSALFLALVCSSLALETEDLSNELNPHHDPESHRWEFQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCQERCQHEERGQRQAQQCQRRCEEQLREREREREREEIVDPREPRKQYE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCRETCEKQDPRQQPQCERRCERQFQEQQERERRERRRGRDDDDKENPRD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PREQYRQCEEHCRRQGQGQRQQQQCQSRCEERFEEEQRRQEERERRRGRD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NDDEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ERERRRGRDEDDQNPRDPEQRYEQCQQQCERQRRGQEQQLCRRRCEQQRQ

Sequence 1 --------------MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQ
           ------------------------------------------------EQ
Sequence 2 QEERERQRGRDRQDPQQQYHRCQRRCQTQEQSPERQRQCQQRCERQYKEQ

Sequence 1 HGRGHHGVFPEEHG-RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEI
           -GR---G--P-----R---RG--EE----NPY-FHS---R-R--S--GE-
Sequence 2 QGR-EWG--PDQASPRRESRGREEEQQRHNPYYFHSQGLRSRHESGEGEV

Sequence 1 RALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRG
           --L--F-E--ELL-GI--YRV---E--PNT--LP---DA-----VT-GR-
Sequence 2 KYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAESVIVVTRGRA

Sequence 1 YIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTES
           ----V-Q-------LE-GDV--VP-G-T-Y--N-D----L----LL----
Sequence 2 TLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQPVN

Sequence 1 TMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGA--HR
           ---G-----Y-AG----E-----FS-D-L-AA-NT----LE--F-----R
Sequence 2 NP-GQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQR

Sequence 1 RGVIFYANEEQIREMMRRGGFSAESTSASEQP-------KPFNLRNQKPD
           -GVI--A--E--R--------S----SA---P--------P--L--Q---
Sequence 2 EGVIIRASQEKLRAL------SQHAMSAGQRPWGRRSSGGPISLKSQRSS

Sequence 1 FENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAI
           --N--G-F--A-P-----L---DV-V-------G-M--P--N-KAT----
Sequence 2 YSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVY

Sequence 1 VMEGEGRIEMACPH--LGQEHGWSSPRERGHQDIN---YERVRARLRTGT
           V-EG-GR-EMACPH----Q-------RE-------------V-ARL--G-
Sequence 2 VVEGTGRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGD

Sequence 1 VYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEKE
           --V-PAGHPI---AS-N--L----F-IN---N-R-FLAG-NN----LE-E
Sequence 2 IFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAGQNNIINQLERE

Sequence 1 VRHLSFNIPRGEEIEEVLQAQKDQVIL---RGPQR-QRRDEPRSSS----
           ---LSFN-PR-EEIEE----Q---------R---R-Q-RD-P--S-----
Sequence 2 AKELSFNMPR-EEIEEIFERQVESYFVPMERQSRRGQGRDHPLASILDFA

Sequence 1 ---
           ---
Sequence 2 GFF



Alignment 10
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB23463
Sequence identity: 27.65 (128/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
           --------------------------------------------------
Sequence 2 ---------------------------------MMRVRFPLLVLLGTVFL

Sequence 1 RGHHRGGREEEREENPYVFHS-DRFRIRASSEAGEIRALPNFGEVSELLE
           ----------E-E-NP--F-S---F----------IR-L--F---S--LE
Sequence 2 ASVCVSLKVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLE

Sequence 1 GISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRK
           ----YR------KPNT--LPH--DA---L-V--GR-----V---------
Sequence 2 NLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYN

Sequence 1 LEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGG
           L--GD----P-G-T-YLVN--DH--L-I--L--------G-Y--F-----
Sequence 2 LHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLA-IPVNKPGRYDDFFLSST

Sequence 1 RNPETVYSAFSDDVLEAAFNTDVQKLEHI-FGA-----HRRGVIFYANEE
           ---------FS---LE--F-----------FG---------GVI-----E
Sequence 2 QAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKE

Sequence 1 QIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNP
           QIR---RR---S---T--SE---PFNLR---P---N--G-F----P--NP
Sequence 2 QIRQLSRRAKSSSRKTISSED-EPFNLRSRNPIYSNNFGKFFEITPEKNP

Sequence 1 FLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQ
           -L---D--------N-G----P--N-KA--I----EG---IE-------Q
Sequence 2 QLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQ

Sequence 1 EHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEI
           ------------------R-RA-L----V-V-PA--P----A--N--L--
Sequence 2 QK-----QKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSN--LNF

Sequence 1 LWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIP-RGEEIEEVLQA
           L-F-IN---N-R-FLAG-K-NV----E--V--L-F--P------E--L--
Sequence 2 LAFGINAENNQRNFLAGEKDNVVRQIERQVQELAF--PGSAQDVERLLKK

Sequence 1 QKDQVILRGPQRQRRDEPRSSS-----------
           Q-----------Q--------------------
Sequence 2 QRESYFVDAQPQQKEEGSKGRKGPFPSILGALY



Alignment 11
Sequence 1:
Sequence 2: Allergen Cor a 11, Sequence: AAL86739
Sequence identity: 34.56 (160/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEE-H
           -------------------L--------D---F-EQ--R-------E---
Sequence 2 -----------MLPKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEKAR

Sequence 1 GRGHHRGGREEE-----REENPYVFHSDRFRIRASSEAGEIRALPNFGEV
           -R----G---EE------EENPYVF----F--R---E-G----L-NF---
Sequence 2 ERQQEEGNSSEESYGKEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKR

Sequence 1 SELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNE
           S-LL-GI---R----E--P-T---P---DA---L-V--GR--I--V----
Sequence 2 SRLLSGIENFRLAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEK

Sequence 1 LVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPF
           ------E-GD----P-G---Y--N-D----L-I---L---S---G--E-F
Sequence 2 RESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAP-GHFEAF

Sequence 1 YVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQ
           Y-AGG--PE--Y-AFS--VLEAA-------LE--FG----G-I--A--E-
Sequence 2 YGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREK

Sequence 1 IREM-MRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNP
           IR-------G---------E---P-NL----P---N--GR---A-P-D--
Sequence 2 IRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHK

Sequence 1 FLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQ
           -L---D--V-F-----G-M--P--N--AT-I--V-EGEG--EMACPHL--
Sequence 2 QLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSS

Sequence 1 EHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEI
           --G-------------Y----ARLR-G-V-V-PAGHP---IAS-N--L--
Sequence 2 SSG------------SYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQV

Sequence 1 LWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQK
           L-F--N--GN-R--LAGK-N-----E-----L-FN-P---E-E-----Q-
Sequence 2 LCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLP-SREVERIFKNQD

Sequence 1 DQVILRGPQRQRRDEPRSSS---
           ------GP--Q-----R------
Sequence 2 QAFFFPGPNKQQEEGGRGGRAFE



Alignment 12
Sequence 1:
Sequence 2: Allergen Ana o 1.0101, Sequence: AAM73730
Sequence identity: 33.91 (157/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQK

Sequence 1 --------------------------------------MAFVSLLTILLA
           --------------------------------------------------
Sequence 2 EQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCM

Sequence 1 ISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREEER
           --------------------------RG-H-----E----------EEE-
Sequence 2 RQCERQEGGQQKQLCRFRCQERYKKERGQHN-YKREDDEDEDEDEAEEE-

Sequence 1 EENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMK
           -ENPYVF----F------E-G----LP-F---S-LL-----YR-------
Sequence 2 DENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVAN

Sequence 1 PNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGH
           P-----P---DA--I--V--GRG-I-----N---------GD-----SG-
Sequence 2 PQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGT

Sequence 1 TFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDD
           -FY--NND----L-----LR------G--E-F---GG-NPE--Y-AFS--
Sequence 2 PFYIANNDENEKLYLVQFLRPVN-LPGHFEVFHGPGGENPESFYRAFSWE

Sequence 1 VLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRG------GFSA
           -LEAA--T----LE--F-----G-I--A--EQIR-M-RRG-------F--
Sequence 2 ILEAALKTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTE

Sequence 1 ESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGV
           EST--------F-L----P---N--G----A---D-P-L---D--V----
Sequence 2 ESTGS------FKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYAN

Sequence 1 LNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQ
           ---G-M--P--N--AT-IAIV--GEG--E-ACPHL------S-P------
Sequence 2 ITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKS-SHP------

Sequence 1 DINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNERE
           ---Y---RAR-R--TV--VPAGHP----AS-N--LEI--F--N--GN-R-
Sequence 2 --SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRY

Sequence 1 FLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRR
           -LAGK-N-----EKE---L-F----GEE---V---Q-------GP-----
Sequence 2 TLAGKKNIIKVMEKEAKELAFKM-EGEEVDKVFGKQDEEFFFQGPEWRKE

Sequence 1 DEPRSSS
           -E-R---
Sequence 2 KEGRADE



Alignment 13
Sequence 1:
Sequence 2: Allergen Ana o 1.0102, Sequence: AAM73729
Sequence identity: 33.69 (156/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQ

Sequence 1 ------------------------------------MAFVSLLTILLAIS
           --------------------------------------------------
Sequence 2 CVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQ

Sequence 1 SSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREEEREE
           ------------------------RG-H-----E----------EEE--E
Sequence 2 CERQEGGQQKQLCRFRCQERYKKERGQHN-YKREDDEDEDEDEAEEE-DE

Sequence 1 NPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPN
           NPYVF----F------E-G----LP-F---S-LL-----YR-------P-
Sequence 2 NPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQ

Sequence 1 TVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTF
           ----P---DA--I--V--GRG-I-----N---------GD-----SG--F
Sequence 2 AFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPF

Sequence 1 YLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVL
           Y--NND----L-----LR------G--E-F---GG-NPE--Y-AFS---L
Sequence 2 YIANNDENEKLYLVQFLRPVN-LPGHFEVFHGPGGENPESFYRAFSWEIL

Sequence 1 EAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRG------GFSAES
           EAA--T----LE--F-----G-I--A--EQ-R-M-RRG-------F--ES
Sequence 2 EAALKTSKDTLEKLFEKQDQGTIMKASKEQVRAMSRRGEGPKIWPFTEES

Sequence 1 TSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLN
           T--------F-L----P---N--G----A---D-P-L---D--V------
Sequence 2 TGS------FKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANIT

Sequence 1 PGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDI
           -G-M--P--N--AT-IAIV--GEG--E-ACPHL------S-P--------
Sequence 2 KGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKS-SHP--------

Sequence 1 NYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFL
           -Y---RAR-R--TV--VPAGHP----AS-N--LEI--F--N--GN-R--L
Sequence 2 SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTL

Sequence 1 AGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDE
           AGK-N-----EKE---L-F----GEE---V---Q-------GP------E
Sequence 2 AGKKNIIKVMEKEAKELAFKM-EGEEVDKVFGKQDEEFFFQGPEWRKEKE

Sequence 1 PRSSS
           -R---
Sequence 2 GRADE



Alignment 14
Sequence 1:
Sequence 2: Allergen Vig r 2.0101, Sequence: Q198W3
Sequence identity: 28.94 (134/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
           ------------------------------G-----------G----EH-
Sequence 2 --------------------MVRARVQLLLGILFLASLSVSFGIVHREHQ

Sequence 1 RGHHRGGREEEREENPYVFHSDR-FRIRASSEAGEIRALPNFGEVSELLE
           --------------NP--F-SDR-F--------G--R----F---S----
Sequence 2 ESQEES--DSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQ

Sequence 1 GISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRK
           ----YRV-----KPNT--LPH--DA---L-V--GR-----V---------
Sequence 2 NLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYI

Sequence 1 LEEGDVFGVPSGHTFYLVNNDDHNSLRIASL-LRTESTMRGEYEPFYVAG
           LE-G-----P-G-TF-LVN--D---LRI--L--------R-----F----
Sequence 2 LEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHR--FQNFFLSS

Sequence 1 GRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FGAHRR----------GVI
           ----------FS---LEA-F--D--------FG--R-----------GVI
Sequence 2 TEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVI

Sequence 1 FYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRA
           -----EQIRE-------S------S-Q--PFNLRN--P---N--GR----
Sequence 2 VELKREQIRELIKHAKSSSRKELSS-QDEPFNLRNSNPIYSNKFGRWYEI

Sequence 1 GPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMA
           -P--NP-L---DV---------G----P--N-KA--I----EGE--IE--
Sequence 2 TPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELV

Sequence 1 CPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIAST
           -P---------S------------R-RA-L----V-V-PA--P----A--
Sequence 2 GP---------SDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATS

Sequence 1 NGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIPRGEEIE
           N--L----F-IN---N-R-FLAG-K-NV------EV---SF----G---E
Sequence 2 N--LNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPAS-GNKVE

Sequence 1 EVLQAQKD-QVILRGPQRQRRDEPRSSS------------
           -----Q---------P--Q-R-E-----------------
Sequence 2 KLIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY



Alignment 15
Sequence 1:
Sequence 2: Allergen Vig r 2.0201, Sequence: B1NPN8
Sequence identity: 28.51 (132/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
           --------------------------------------------------
Sequence 2 --------------------MVRARIPLLLLLGILFLASLSVSFGIVHRE

Sequence 1 RGHHRGGREEEREENPYVFHSDR-FRIRASSEAGEIRALPNFGEVSELLE
           --------------NP--F-SDR-F--------G--R-L--F---S----
Sequence 2 NIDGAEVSVSRGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQ

Sequence 1 GISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRK
           ----YRV-----KPNT--LPH--DA---L-V--GR-----V---------
Sequence 2 NLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTLVNPDGRDSNI

Sequence 1 LEEGDVFGVPSGHTFYLVNNDDHNSLRIASL-LRTESTMRGEYEPFYVAG
           LE-G-----P-G-TF-LVN-DD---LRI--L--------R-----F----
Sequence 2 LEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHR--FQDFFLSS

Sequence 1 GRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FG-----------AHRRGV
           ----------FS---LEA-F--D--------FG---------------GV
Sequence 2 TEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGV

Sequence 1 IFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTR
           I-----EQIRE-------S------SE---PFNLRNQKP---N--GR---
Sequence 2 IVELKREQIRELTKHAKSSSKKSLSSED-QPFNLRNQKPIYSNKLGRWFE

Sequence 1 AGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEM
           --P--NP-L---D----------G----P--N-KA--I----EG---IE-
Sequence 2 ITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIEL

Sequence 1 ACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIAS
           -----GQ--------E---------R-RA-L----V---PA--P----A-
Sequence 2 ----VGQREQQKQQEEQ-EESWEVQRYRAELSEDDVFIIPATYPVAINAT

Sequence 1 TNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIPRGEEI
           -N--L----F-IN---N-R-FLAG-K-NV------EV----F----GE--
Sequence 2 SN--LNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPAS-GEKV

Sequence 1 EEVLQAQKD-QVILRGPQRQRRDEPRSSS------
           ------Q---Q-----P--Q-R-E-R---------
Sequence 2 KKLIKKQSESQFVDAQPEQQEREEARKGGKGPFVY



Alignment 16
Sequence 1:
Sequence 2: Allergen Gly m 5.0201, Sequence: Q9FZP9
Sequence identity: 26.57 (123/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPH

Sequence 1 ----------------------------------MAFVSLLTILLAISSS
           --------------------------------------------------
Sequence 2 QEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEW

Sequence 1 SVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREEEREENP
           ------------------------------E--G----R--R------NP
Sequence 2 QHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRH-KNKNP

Sequence 1 YVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTV
           --F-S-RF--------G--R-L--F---S--L-----YR------KPNT-
Sequence 2 FHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTL

Sequence 1 MLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYL
           -LPH--DA--------G------V---------L--GD---VP-G-T-Y-
Sequence 2 LLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYV

Sequence 1 VNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEA
           VN-D----LR---L--------G--E-F--------------FS---LEA
Sequence 2 VNPDNDENLRMITLA-IPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEA

Sequence 1 AFNTDVQKLEHI-FG---AHRRG-------VIFYANEEQIREMMRRGGFS
           ---T---------FG-------G-------VI------QIRE-------S
Sequence 2 SYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSS

Sequence 1 AESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFG
           ---T--SE--KPFNLR---P---N--G------P--NP-L---DV-----
Sequence 2 SRKTISSED-KPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVV

Sequence 1 VLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGH
           --N-G----P--N-KA-------EGE--IE-------Q------------
Sequence 2 DMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQR-----QQQEE

Sequence 1 QDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNER
           Q-------RA-L------V-PAG-P----A-----L----F-IN---N-R
Sequence 2 QPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFAFGINAENNQR

Sequence 1 EFLAG-KNNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQR
           -FLAG-K-NV-------V--L-F--P-----IE-----Q-----------
Sequence 2 NFLAGSKDNVISQIPSQVQELAF--PGSAKDIENLIKSQSESYFVDAQPQ

Sequence 1 QRRDEPRSSS-----------
           Q--------------------
Sequence 2 QKEEGNKGRKGPLSSILRAFY



Alignment 17
Sequence 1:
Sequence 2: Allergen Gly m 5.0101, Sequence: O22120
Sequence identity: 25.49 (118/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPR

Sequence 1 -----------------MAFVSLLTILLAISSSSVALTEPVASMADQGVF
           --------------------------------------------------
Sequence 2 QEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPHQK

Sequence 1 PEQHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAG
           -E-----------------------------NP--F-S-RF--------G
Sequence 2 EERKQEEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFETLFKNQYG

Sequence 1 EIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGG
           -IR-L--F---S--L-----YR------KPNT--LP---DA--------G
Sequence 2 RIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNG

Sequence 1 RGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRT
           ------V---------L--GD---VPSG-T-Y-VN-D----LR---L---
Sequence 2 TAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLA-I

Sequence 1 ESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHR
           -----G--E-F--------------FS---LEA---T-------------
Sequence 2 PVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSRE

Sequence 1 RG-----------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRN
           -G-----------VI-----EQIR----R---S---T--SE--KPFNLR-
Sequence 2 EGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSED-KPFNLRS

Sequence 1 QKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKAT
           --P---N--G-F----P--NP-L---D--------N-G----P--N-KA-
Sequence 2 RDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAI

Sequence 1 SIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTV
           -I----EG---IE-------Q------------Q-------RA-L-----
Sequence 2 VILVINEGDANIELVGLKEQQQE-----QQQEEQPLEVRKYRAELSEQDI

Sequence 1 YVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKE
           -V-PAG-P----A--N--L------IN---N-R-FLAG---NV-------
Sequence 2 FVIPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAGSQDNVISQIPSQ

Sequence 1 VRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS-------
           V--L-F--P------E--L--Q----------------------------
Sequence 2 VQELAF--PGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSIL

Sequence 1 ----
           ----
Sequence 2 RAFY



Alignment 18
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: CAA35691
Sequence identity: 25.49 (118/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ

Sequence 1 -----------------------------MAFVSLLTILLAISSSSVALT
           --------------------------------------------------
Sequence 2 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE

Sequence 1 EPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHS
           -------------E-----------------------------NP--F-S
Sequence 2 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS

Sequence 1 DRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHY
           -RF--------G-IR-L--F---S--L-----YR------KPNT--LP--
Sequence 2 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH

Sequence 1 IDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDD
           -DA--------G------V---------L--GD---VPSG-T-Y-VN-D-
Sequence 2 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN

Sequence 1 HNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTD
           ---LR---L--------G--E-F--------------FS---LEA---T-
Sequence 2 NENLRLITLA-IPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTK

Sequence 1 VQKLEHIFGAHRRG-----------VIFYANEEQIREMMRRGGFSAESTS
           -------------G-----------VI-----EQIR----R---S---T-
Sequence 2 FEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI

Sequence 1 ASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPG
           -SE--KPFNLR---P---N--G-F----P--NP-L---D--------N-G
Sequence 2 SSED-KPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG

Sequence 1 TMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINY
           ----P--N-KA--I----EG---IE-------Q------------Q----
Sequence 2 ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE-----QQQEEQPLEV

Sequence 1 ERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG
           ---RA-L------V-PAG-P----A--N--L------IN---N-R-FLAG
Sequence 2 RKYRAELSEQDIFVIPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAG

Sequence 1 -KNNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQRQRRDE
           ---NV-------V--L-F--P------E--L--Q----------------
Sequence 2 SQDNVISQIPSQVQELAF--PGSAQAVEKLLKNQRESYFVDAQPKKKEEG

Sequence 1 PRSSS-----------
           ----------------
Sequence 2 NKGRKGPLSSILRAFY



Alignment 19
Sequence 1:
Sequence 2: Allergen Len c 1.0102, Sequence: CAD87731
Sequence identity: 28.94 (134/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEG
           -------------ENP--F-S-RF------E-G-IR-L--F---S---E-
Sequence 2 --------SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFEN

Sequence 1 ISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKL
           ---YR------KP-T--LP-Y-DA--IL-V--G---------N------L
Sequence 2 LQNYRLLEYKSKPHTLFLPQYTDADFILVVLSGKAVLTVLNSNDRNSFNL

Sequence 1 EEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGR
           E-GD----P-G---YL-N-DD---LR---L--------G--E-F---G--
Sequence 2 ERGDTIKLPAGTIAYLANRDDNEDLRVLDLA-IPVNNPGQLESFLLSGTQ

Sequence 1 NPETVYSAFSDDVLEAAFNTDVQKLEHIF-------GAHRRG--------
           N-----S-F----LEAAFNTD----E------------HRR---------
Sequence 2 NQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSLRDRRQEI

Sequence 1 ----VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDN
           ----VI-----EQI-E-------S------SE---PFNLR---P---N--
Sequence 2 NKENVIVKVSREQIKELSKNAKSSSKKSVSSES-EPFNLRSRNPIYSNKF

Sequence 1 GRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGE
           G-F----P--NP-L---D--V-------G----P--N--A--I--V-EG-
Sequence 2 GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGK

Sequence 1 GRIEMACPHLGQEHGWSSPRERGHQDIN--YERVRARLRTGTVYVVPAGH
           G--E----------------E-----------R-RA-L--G-V-VVPAGH
Sequence 2 GYFELVGQRNENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGH

Sequence 1 PITEIASTNGRLEILWFDINTSGNEREFLAGK-NNVLQTLEKEVRHLSFN
           P----AS----L----F-IN---N-R-FLAG---NV-------V--L-F-
Sequence 2 PVAINASSD--LNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAF-

Sequence 1 IP-RGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS
           -P----E----L--QK----------Q---------
Sequence 2 -PGSSREVDRLLTNQKQSHFANAQPLQIE-------



Alignment 20
Sequence 1:
Sequence 2: Allergen Len c 1.0101, Sequence: CAD87730
Sequence identity: 29.16 (135/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEG
           -------------ENP--F-S-RF------E-G-IR-L--F---S---E-
Sequence 2 --------SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFEN

Sequence 1 ISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKL
           ---YR------KP-T--LP---DA--IL-V--G---------N------L
Sequence 2 LQNYRLLEYKSKPHTIFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNL

Sequence 1 EEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGR
           E-GD----P-G---YL-N-DD---LR---L--------G----F---G--
Sequence 2 ERGDTIKLPAGTIAYLANRDDNEDLRVLDLA-IPVNRPGQLQSFLLSGTQ

Sequence 1 NPETVYSAFSDDVLEAAFNTDVQKLEHIF-------GAHRRG--------
           N-----S-FS---LEAAFNT-----E------------HRR---------
Sequence 2 NQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEI

Sequence 1 ----VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDN
           ----VI-----EQI-E-------S------SE---PFNLR---P---N--
Sequence 2 TNEDVIVKVSREQIEELSKNAKSSSKKSVSSES-EPFNLRSRNPIYSNKF

Sequence 1 GRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGE
           G-F----P--NP-L---D--V-------G----P--N--A--I--V-EG-
Sequence 2 GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGK

Sequence 1 GRIEMACPHL--GQEHGWSSPRERGHQD---INYERVRARLRTGTVYVVP
           G--E---------QE-------E-G----------R-RARL--G-V-V-P
Sequence 2 GDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIP

Sequence 1 AGHPITEIASTNGRLEILWFDINTSGNEREFLAGK-NNVLQTLEKEVRHL
           AGHP----AS----L----F-IN---N-R-FLAG---NV-------V--L
Sequence 2 AGHPVAINASSD--LNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKEL

Sequence 1 SFNIP-RGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS
           -F--P----E----L--QK----------Q---------
Sequence 2 AF--PGSSREVDRLLTNQKQSHFANAQPLQIE-------



Alignment 21
Sequence 1:
Sequence 2: Allergen Lup an 1.0101, Sequence: ACB05815
Sequence identity: 32.61 (151/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKMRVRLPMLILLLGVVFLLAASIGIAYGEKDFTKNPPKEREEEEHEPR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QQPRPRQQEEQEREHRREEKHDGEPSRGRSQSEESQEEEHERRREHHRER

Sequence 1 -----------MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGR
           --------------------------------E----------------R
Sequence 2 EQEQQPRPQRRQEEEEEEEEWQPRRQRPQSRREEREEREQEQGSSSGSQR

Sequence 1 GHHGVFPEEHGRGHHRGGREEE--------REENPYVFHSDRFRIRASSE
           G----------R--HR--RE-E--------R--NPY-F-S-RF-------
Sequence 2 GGGDERRQHRERRVHREEREQEQDSRSDSRRQRNPYHFSSNRFQTYYRNR

Sequence 1 AGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVT
           -G-IR-L--F------LE----YR------KPNT--LP---DA--IL-V-
Sequence 2 NGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDADFILVVL

Sequence 1 GGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLL
           -GR--I--V---------LE-GD----P-G-T-Y--N-DD---LR-A-L-
Sequence 2 NGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAKLA

Sequence 1 RTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF-G
           -------G----FY-----------S-FS---LEA-FNT-----E----G
Sequence 2 -IPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLG

Sequence 1 --------AHRRG---------VIFYANEEQIREMMRRGGFSAESTSASE
           ----------RRG---------VI------QI-E--------A-S-S---
Sequence 2 DDELQENEKQRRGQEQSHQDEGVIVRVSKKQIQELRKH----AQSSSGEG

Sequence 1 QPK---PFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPG
           -P----PFNLR--KP---N--G-F----P--NP----------F---N-G
Sequence 2 KPSESGPFNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEG

Sequence 1 TMTAPSHNTKATSIAIVMEGEGRIEMAC--PHLGQEHGWSSPRERGHQDI
           ----P--N-KA--I--V-EGEG--E---------Q--------E-G----
Sequence 2 ALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQRQQDEQEEEYEQGEEEV

Sequence 1 NYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFL
           ---R----L--G-V---PAGHP----AS-N-RL--L-F-IN---N-R-FL
Sequence 2 --RRYSDKLSKGDVFIIPAGHPLSINASSNLRL--LGFGINANENQRNFL

Sequence 1 AG-KNNVLQTLEKEVRHLSFNIPRG-EEIEEVLQAQKDQVILRG-PQRQR
           AG---NV---L--EV--L-F--P---E--E-----Q---------PQ-Q-
Sequence 2 AGSEDNVIKQLDREVKELTF--PGSIEDVERLIKNQQQSYFANAQPQQQQ

Sequence 1 RDEPRSSS--------------
           --E-------------------
Sequence 2 QREKEGRRGRRGPISSILNALY



Alignment 22
Sequence 1:
Sequence 2: Allergen Coc n 1.0101, Sequence: A0A0S3B0K0
Sequence identity: 29.59 (137/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
           ---------------------------A---------------V-----G
Sequence 2 ------------------MVSAMGDRTASAILALLLLSSWSLMVVMAYQG

Sequence 1 RGHHRGGREEEREENPYVFHSDR--FRIRASSEAGEIRALPNFGEVSELL
           RG----GRE---EE-------DR--F--R-S-E-----A----GEV--L-
Sequence 2 RGME--GREKRVEEKAPRSPEDRGLFILRRSKEVLKTDA----GEV-RLM

Sequence 1 EGISRYR-------VTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQ
           -G--RYR----------I-M-PNT---P-YIDA--IL-V--G-----Y--
Sequence 2 MGY-RYRGNHSPMHIGFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIY

Sequence 1 QNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMR--G
           -N-LV---L--G-V---P-G--FY-VN-D----L-I-----T---M---G
Sequence 2 KNKLVEKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYG

Sequence 1 EY-EPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIF
           -Y---FYV-GG--P--V-S-F----L-AAFN-----LE-I----R-G-I-
Sequence 2 AYPQSFYVGGGVLPRSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPII

Sequence 1 YANEE------------QIRE-MMRRGGFSAESTSASEQ-----------
           --N-E------------Q--E-M--------------EQ-----------
Sequence 2 RLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDVWTWRCL

Sequence 1 ---------------------PKPFNLRNQKPDFENDNGRFTRAGPKDNP
           ---------------------P---NL----P---ND-G--------D--
Sequence 2 LKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYS

Sequence 1 FLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQ
           -L------V----L--G-M--P--N--AT---I---G-G-I----P----
Sequence 2 ALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVFPN---

Sequence 1 EHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEI
           ----------G----N-----A----G-V---P---P---IAS----LE-
Sequence 2 ----------GTAAMN-----AKVSEGDVFWIPRYFPFCQIASDGAPLEF

Sequence 1 LWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQK
           --F------N---FL-GK---L-----------F-----E--E----AQ-
Sequence 2 FGFTTSARKNRPQFLVGKSSLLHSMRGPELAAAFGVSE-EQLERIVKAQR

Sequence 1 DQVIL-RGPQRQRRDEPRSSS--------------
           --VIL---P-R------------------------
Sequence 2 EAVILPTSPHREMEEINGKKWKGEEVLVMKRGLFA



Alignment 23
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43237
Sequence identity: 29.59 (137/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MRGRVSPLMLLLGILVLASVSATQAKSPYRKTENPCAQRCLQSCQQEPDD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LKQKACESRCTKLEYDPRCVYDTGATNQRHPPGERTRGRQPGDYDDDRRQ

Sequence 1 --MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEE
           --------------------------------------------G---E-
Sequence 2 PRREEGGRWGPAEPREREREEDWRQPREDWRRPSHQQPRKIRPEGREGEQ

Sequence 1 HGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELL
           ---------REE----NP--F-S-RF--R-----G-IR-L--F---S---
Sequence 2 EWGTPGSEVREETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQF

Sequence 1 EGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKR
           ------R---IE--PNT--LP---DA--IL----G---------N-----
Sequence 2 QNLQNHRIVQIEARPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSF

Sequence 1 KLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAG
           -L-EG-----PSG---Y--N--D---LR-A-------T--G--E-F--A-
Sequence 2 NLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTP-GQFEDFFPAS

Sequence 1 GRNPETVYSAFSDDVLEAAFNTDVQKLEHIF------------GAHRR--
           -R--------FS---LEAAFN----------------------G--RR--
Sequence 2 SRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRRST

Sequence 1 ------GVIFYANEEQIREMMRRG-GFSAESTSASEQPKPFNLRNQKPDF
           ------GVI-----E---E--------S-----------P-NLR---PD-
Sequence 2 RSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPDL

Sequence 1 ENDNGRFTRAGP-KDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAI
           -N--GR-----P-K-NP-L---D----------G----P--N-KA--I--
Sequence 2 SNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVV

Sequence 1 VMEGEGRIEM-ACPHLGQEHG-----WSSPRERGHQDINYERVR---ARL
           V--G-G--E--A-----Q--G-----W----E----------VR---ARL
Sequence 2 VNKGTGNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARL

Sequence 1 RTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG-KNNVLQ
           --G-V---PA-HP----AS----L--L-F-IN---N-R-FLAG-K-NV--
Sequence 2 KEGDVFIMPAAHPVAINASSE--LHLLGFGINAENNHRIFLAGDKDNVID

Sequence 1 TLEKEVRHLSFNIP-RGEEIEEVLQAQKD-QVILRGPQRQRRDEPRSSS-
           --EK----L-F--P--GE--E-----Q---------PQ-Q----P-----
Sequence 2 QIEKQAKDLAF--PGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKEDQ

Sequence 1 -------------------
           -------------------
Sequence 2 EEENQGGKGPLLSILKAFN



Alignment 24
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43238
Sequence identity: 30.89 (143/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MRGRVSPLMLLLGILVLASVSATHAKSSPYQKKTENPCAQRCLQSCQQEP

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 DDLKQKACESRCTKLEYDPRCVYDPRGHTGTTNQRSPPGERTRGRQPGDY

Sequence 1 -----------MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGR
           --------------------------------------------------
Sequence 2 DDDRRQPRREEGGRWGPAGPREREREEDWRQPREDWRRPSHQQPRKIRPE

Sequence 1 GHHGVFPEEHGR-GHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRAL
           G--G----E-G--G-H---REE----NP--F-S-RF--R-----G-IR-L
Sequence 2 GREG--EQEWGTPGSHV--REETSRNNPFYFPSRRFSTRYGNQNGRIRVL

Sequence 1 PNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIA
           --F---S---------R---IE-KPNT--LP---DA--IL----G-----
Sequence 2 QRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVT

Sequence 1 YVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMR
           ----N------L-EG-----PSG---Y--N--D---LR-A-------T--
Sequence 2 VANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTP-

Sequence 1 GEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF---------
           G--E-F--A--R--------FS---LEAAFN-------------------
Sequence 2 GQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQ

Sequence 1 ---GAHR---------RGVIFYANEEQIREMMRRGGFSAESTSASEQP--
           ---G--R----------GVI-----E---E------------S--E----
Sequence 2 EERGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDIT

Sequence 1 KPFNLRNQKPDFENDNGRFTRAGP-KDNPFLDSVDVTVGFGVLNPGTMTA
           -P-NLR---PD--N--G------P-K-NP-L---D----------G----
Sequence 2 NPINLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALML

Sequence 1 PSHNTKATSIAIVMEGEGRIEM-ACPHLGQEHGWSSPRE---RGHQDINY
           P--N-KA--I--V--G-G--E--A-----Q--G-----E---------N-
Sequence 2 PHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNR

Sequence 1 E--RVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFL
           E--R--ARL--G-V---PA-HP----AS----L--L-F-IN---N-R-FL
Sequence 2 EVRRYTARLKEGDVFIMPAAHPVAINASSE--LHLLGFGINAENNHRIFL

Sequence 1 AG-KNNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKD-QVILRGPQRQR
           AG-K-NV----EK----L-F--P--GE--E-----QK--------PQ-Q-
Sequence 2 AGDKDNVIDQIEKQAKDLAF--PGSGEQVEKLIKNQKESHFVSARPQSQS

Sequence 1 RDEPRSSS----------------------------
           ---P-S------------------------------
Sequence 2 QS-PSSPEKESPEKEDQEEENQGGKGPLLSILKAFN



Alignment 25
Sequence 1:
Sequence 2: Allergen Gly m Bd28K, Sequence: BAB21619
Sequence identity: 23.97 (111/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
           -----------------------------------------HGV------
Sequence 2 -----------------------------KTTLLLLLFVLCHGVATTTMA

Sequence 1 RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEG
           -----GG-------------S---R------AGE-R-L---G--------
Sequence 2 FHDDEGG--DKKSPKSLFLMSNSTRVF-KTDAGEMRVLKSHG--GRIF--

Sequence 1 ISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKL
           --------I-M-P-----P-Y-D---I-----G----------EL--R-L
Sequence 2 YRHMHIGFISMEPKSLFVPQYLDSNLIIFIRRGEAKLGFIYDDELAERRL

Sequence 1 EEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGE-YEPFYVAGG
           --GD----PSG--FYLVN------L--------------E----FY--GG
Sequence 2 KTGDLYMIPSGSAFYLVNIGEGQRLHVICSIDPSTSLGLETFQSFYIGGG

Sequence 1 RNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYAN--------
           -N---V-S-F----LE-AFN------E-IF-----G-I------------
Sequence 2 ANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFVDDSHAPSLW

Sequence 1 -----------EEQIREMMR------------------------RGGFSA
           -----------E-Q---MM-------------------------------
Sequence 2 TKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVNEKI

Sequence 1 ESTSASEQPKPFNLRN-QKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFG
           E-------P---NL----K-DF-N--G----------P-L---D--V---
Sequence 2 ENKDTAGSPASYNLYDDKKADFKNAYGWSKALHGGEYPPLSEPDIGVLLV

Sequence 1 VLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGH
           -L--G-M-AP--N-------IV--G-G-------H-G---G---------
Sequence 2 KLSAGSMLAPHVNPISDEYTIVLSGYGEL-----HIGYPNGSRA------

Sequence 1 QDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNER
           --------------G-V-VVP---P----AS--G-LE---F------N--
Sequence 2 -------MKTKIKQGDVFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKP

Sequence 1 EFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQR
           -FLAG----L-TL--------F-------------AQ---VIL-------
Sequence 2 QFLAGAASLLRTLMGPELSAAFGVSE-DTLRRAVDAQHEAVILPSAWAAP

Sequence 1 RDEPRSSS--------------------
           ----------------------------
Sequence 2 PENAGKLKMEEEPNAIRSFANDVVMDVF



Alignment 26
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAA33947
Sequence identity: 12.74 (59/463)
Sequence 1 MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMR
           --------------------------------------------------
Sequence 2 ------------------------------------------------SK

Sequence 1 RGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDV
           R---S---T--SE--KPFNL----P------G-F----P--NP-L---D-
Sequence 2 RAKSSSRKTISSED-KPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDI

Sequence 1 TVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSP
           -------N-G----P--N-KA--I----EG---IE-------Q-------
Sequence 2 FLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE-----

Sequence 1 RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINT
           -----Q-------RA-L------V-PAG-P----A--N--L------IN-
Sequence 2 QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN--LNFFAIGINA

Sequence 1 SGNEREFLAG-KNNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVIL
           --N-R-FLAG---NV-------V--L-F--P------E--L--Q------
Sequence 2 ENNQRNFLAGSQDNVISQIPSQVQELAF--PGSAQAVEKLLKNQRESYFV

Sequence 1 RGPQRQRRDEPRSSS-----------
           --------------------------
Sequence 2 DAQPNEKEEGNKGRKGPLSSILRAFY



Alignment 27
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB01374
Sequence identity: 27.00 (125/463)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYR

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NQACHARCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQP

Sequence 1 ----------------------------------------------MAFV
           --------------------------------------------------
Sequence 2 RPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPH

Sequence 1 SLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHH
           ------------------------------------------E--G----
Sequence 2 QPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQ

Sequence 1 RGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRY
           R--R------NP--F-S-RF--------G--R-L--F---S--L-----Y
Sequence 2 REPRRH-KNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDY

Sequence 1 RVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGD
           R------KPNT--LPH--DA--------G------V---------L--GD
Sequence 2 RILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGD

Sequence 1 VFGVPSGHTFYLVNNDDHNSLR-IASLL------RTESTMR---------
           ---VP-G-TFY-VN-D----LR-IA---------------R---------
Sequence 2 ALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVN

Sequence 1 --GEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FG---AH
           --G--E-F--------------FS---LEA---T---------FG-----
Sequence 2 KPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQ

Sequence 1 RRG-------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKP
           --G-------VI------QIRE-------S---T--SE--KPFNL----P
Sequence 2 QQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSED-KPFNLGSRDP

Sequence 1 DFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIA
           ---N--G---------NP-L---DV-------N-G----P--N-KA----
Sequence 2 IYSNKLGKLFEITQR-NPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVL

Sequence 1 IVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVV
           ---EGE--IE-------Q------------Q-------RA-L------V-
Sequence 2 VINEGEANIELVGIKEQQQR-----QQQEEQPLEVRKYRAELSEQDIFVI

Sequence 1 PAGHPITEIASTNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRH
           PAG-P----A-----L----F-IN---N-R-FLAG-K-NV-------V--
Sequence 2 PAGYPVMVNATSD--LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQE

Sequence 1 LSFNIPRG-EEIEEVLQAQKDQVILRGPQRQRRDEPRSSS----------
           L-F--PR----IE-----Q-----------Q-------------------
Sequence 2 LAF--PRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAF

Sequence 1 -
           -
Sequence 2 Y



Alignment 28
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 20.95 (97/463)
Sequence 1 -----MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVF
           ---------SL---LL---S--------------Q---------------
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 PEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVS
           -E---R-----G--E----N-----------------------P------
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAP

Sequence 1 ELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNEL
           EL--------------------------------------------Q---
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQSQSRSQHSRSERSQQSGEQHQK

Sequence 1 VKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIA--SLLRTESTMRGEYEP
           V-R---EGD----P-G------NN--------A-------E---------
Sequence 2 V-RHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRK

Sequence 1 FYVAG---------------------GRNPETVYSAFSDDVLEAAFNTDV
           F---G---------------------G-------SAF----L---FN-D-
Sequence 2 FVLGGSPQQEIQGGGQSWSQSRSSRKGQQSNNILSAFDEEILAQSFNIDT

Sequence 1 QKLEHIFGAHR-RGVIFYANEE-QI----REMMRRGGFSAESTSASEQPK
           Q-----------RG-I----E--Q-----R----------E-T------K
Sequence 2 QLVKKLQREEKQRGIIVRVKEDLQVLSPQRQEKEYSDNGLEETFCTMTLK

Sequence 1 PFNLRN-QKPDFEND-NGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTA
           --N-------D--N---GR-T-------P-L------V--GVL------A
Sequence 2 -LNINDPSRADVYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNAIMA

Sequence 1 PSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVR
           P--N--A-SI-----G-GR----------E-G-S---E------------
Sequence 2 PHWNMNAHSIVYITRGNGRMQIV-----SENGESVFDEE-----------

Sequence 1 ARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNER-EFLAGKNN
           ---R-G---VVP--------AS--G--E--W----T-G------LAG---
Sequence 2 --IREGQLVVVPQNFAVVKRASSDG-FE--WVSFKTNGLAKISQLAGRIS

Sequence 1 VLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS
           V---L---V---SF-I-R-E-------------I-----R--R-------
Sequence 2 VMRGLPLDVIQNSFDISR-EDAWNLKESRSEMTIFAPGSRSQRQRN----


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.