The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Pun g 1.0201

Sequence A0A059SSZ0_PUNGR

Full FASTA alignment

Sequence name:
Query sequence:
MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
KCGVSIPYKISPSTDCSRVK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Pun g 1.0201A0A059SSZ0Go!120157.01.3e-40
2Pun g 1.0301A0A059ST23Go!120104.01.1e-24
3Pun g 1.0101A0A059STC4Go!12098.64.8e-23
4Zea m 14.0101P19656-1Go!12095.54.3e-22
5Zea m 14.0102P19656-2Go!12894.68.3e-22
6Pru av 3Q9M5X8Go!11794.39.2e-22
7Hev b 12AAL25839Go!11691.94.9e-21
8Pla or 3.0101ABY21307Go!11891.09.4e-21
9Pla a 3.0101CAL07989Go!11890.21.6e-20
10Pru p 3CAB96876Go!9189.81.6e-20
11Pha v 3.0201ADC80503Go!11890.11.8e-20
12Cor a 8AAK28533Go!11589.13.4e-20
13Mal d 3Q9M5X7Go!11589.13.4e-20
14Fra a 3.0201Q4PLU0Go!11788.65.0e-20
15Ara h 9.0101ABX56711Go!11688.45.7e-20
16Pru p 3P81402Go!9188.05.9e-20
17Fra a 3.0202Q4PLT6Go!11788.07.3e-20
18Tri tu 14.0101CAH69206Go!11587.69.4e-20
19Len c 3.0101A0AT29Go!11887.69.5e-20
20Pru ar 3P81651Go!9187.29.9e-20
21Pyr c 3Q9M5X6Go!11587.41.1e-19
22Mor n 3.0101P85894Go!9187.01.1e-19
23Fra a 3.0101Q8VX12Go!11787.31.2e-19
24Lup an 3.0101XP_019446786Go!11686.91.6e-19
25Rub i 3.0101Q0Z8V0Go!11786.12.7e-19
26Lyc e 3AAB42069Go!11485.63.9e-19
27Sola l 3.0101P93224Go!11485.63.9e-19
28Fra a 3.0102Q4PLT9Go!11785.63.9e-19
29Api g 2ACV04796Go!11885.05.8e-19
30Pis s 3.0101A0A161AT60Go!12084.96.6e-19
31Pru d 3P82534Go!9182.03.6e-18
32Pru du 3.0101ACN11576Go!12382.34.1e-18
33Can s 3.0101W0U0V5Go!9181.45.4e-18
34Ara h 9.0201ABX75045Go!9280.97.9e-18
35Art gm 3.0102ANC85023Go!11780.21.6e-17
36Art gm 3.0101ANC85022Go!11780.01.9e-17
37Art ar 3.0102ANC85020Go!11679.62.4e-17
38Art si 3.0102ANC85027Go!11679.62.4e-17
39Art v 3.0202ACE07187Go!11679.62.4e-17
40Hor v 1AAA32970Go!11779.33.1e-17
41Pha v 3.0101ADC80502Go!11578.94.0e-17
42Hor v 1CAA42832Go!13478.65.5e-17
43Art v 3.0301EU564847Go!11778.36.0e-17
44Art an 3.0102ANC85018Go!11777.88.8e-17
45Art an 3.0101ANC85017Go!11777.88.8e-17
46Art ca 3.0101ANC85021Go!11777.88.8e-17
47Art ca 3.0102QIN55516Go!11777.61.0e-16
48Art la 3.0102ANC85025Go!11577.41.1e-16
49Art v 3.0201EU564845Go!11476.81.7e-16
50Art ar 3.0101ANC85019Go!11676.81.7e-16
51Art la 3.0101ANC85024Go!11676.81.7e-16
52Art si 3.0101ANC85026Go!11675.54.1e-16
53Ara h 17.0101A0A510A9S3Go!9370.31.2e-14
54Tri a 14.010119846220Go!9069.71.8e-14
55Sin a 3.0101ABU95411Go!9269.03.0e-14
56Sola l 7.0101NP_001316123Go!11566.62.0e-13
57Hel a 3.0101P82007Go!11662.05.0e-12
58Par j 2O04403Go!13355.45.5e-10
59Par j 1Q40905Go!13854.51.1e-09
60Par j 1P43217Go!13953.81.8e-09
61Par j 2P55958Go!13353.22.6e-09
62Par j 1.0103CAI94601Go!13953.03.0e-09
63Amb a 6O04004Go!11851.47.9e-09
64Par j 1O04404Go!17651.61.0e-08
65Par j 1.0101CAA54587Go!13349.14.4e-08
66Vit v 1P80274Go!3730.45.1e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 100.00 (120/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGVSIPYKISPSTDCSRVK
Sequence 2 KCGVSIPYKISPSTDCSRVK



Alignment 2
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 64.17 (77/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MAS--FL--L------CM-VA--V-E---TCGQV-SSL--CI-YARG--A
Sequence 2 MASSGFLR-LAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGA

Sequence 1 AP-SAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP
           -P---ACC-G-RSLN-AAKTTPDRQ-AC-CLK--A-SI-GINYG-V---P
Sequence 2 GPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAP

Sequence 1 GKCGVSIPYKISPSTDCSRVK
           GKCGVSIPYKI-PST-C--VK
Sequence 2 GKCGVSIPYKIAPSTNCDNVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 59.17 (71/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVV-ESAVTCGQVTSSLTPCIPYARGVV
           ------L--L--A-F----VAA----E-AVTCGQV-SSL-PCIPYAR---
Sequence 2 -MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAG

Sequence 1 AAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP
           -A---ACCSG---L---A-TTPDRQ--C-CLK----SI-GINYG-V--LP
Sequence 2 GAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLP

Sequence 1 GKCGVSIPYKISPSTDCSRVK
           -KCGV-IPYKISPSTDC-RVK
Sequence 2 AKCGVNIPYKISPSTDCARVK



Alignment 4
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 55.83 (67/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MA----L-----A-------AA---E-A--CGQV-S---PCI-YARG---
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PSA-CCSGVRSLNNAA-TT-DR--ACNCLK--A----G-N-G-----P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGVSIPY-IS-STDCSRV-
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 5
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 55.00 (66/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MA----L-----A-------AA---E-A--CGQV-S---PCI-YARG---
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PSA-CCSGVRSLNNAA-TT-DR--ACNCLK--A----G-N-G-----P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVSIPYKISPSTDCSRVK--------
           KCGVSIPY-IS-STDCSR----------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 6
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 54.17 (65/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ---------L-----LCMVV-------A-TCGQV-S-L-PCI-Y-RG--A
Sequence 2 -MACSAMTKLALVVALCMVVSVPIAQ-ALTCGQVSSNLAPCIAYVRGGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-G-R--NN-AKTT-DRQTACNCLK----S--G-N-----ALPG
Sequence 2 VPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV--PYKISPST-C--VK
Sequence 2 KCGVNVPYKISPSTNCATVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 53.33 (64/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------V--L-LCM-VAA-----A-TCGQV-S-L-PC--Y------
Sequence 2 ----MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGP

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GVR--NNAAKTT-DR-TAC-CLK--A-S--G-N---V--LPG
Sequence 2 TPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS-ST-C--VK
Sequence 2 KCGVNIPYKISLSTNCATVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 55.83 (67/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR-GVV
           MA--R----L---L--CMV--A---E-A-TCG-V---LTPC--Y-R-G--
Sequence 2 MAFSR-VAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGA

Sequence 1 AAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP
           -AP--ACC-GV--LNN-AKTTPDRQ-AC-CLK----SI-GI--G----L-
Sequence 2 VAP--ACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLA

Sequence 1 GKCGVSIPYKISPSTDCSRVK
           GKCGV--PYKISP--DCS-VK
Sequence 2 GKCGVNLPYKISPTIDCSKVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 55.00 (66/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR-GVV
           MA--R----L---L--CMV--A---E-A-TCG-V---LTPC----R-G--
Sequence 2 MAFSR-VAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA

Sequence 1 AAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP
           -AP--ACC-GV--LNN-AKTTPDRQ-AC-CLK----SI-GI--G----L-
Sequence 2 VAP--ACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLA

Sequence 1 GKCGVSIPYKISPSTDCSRVK
           GKCGV--PYKISP--DCS-VK
Sequence 2 GKCGVNLPYKISPTIDCSKVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 50.00 (60/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           -----------------------------TCGQV-SSL-PCIPY-RG--A
Sequence 2 ----------------------------ITCGQVSSSLAPCIPYVRGGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-G-R--NN-A-TTPDRQ-ACNCLK----S--G-N-----ALPG
Sequence 2 VPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGVSIPYKIS-ST-C--VK
Sequence 2 KCGVSIPYKISASTNCATVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 55.83 (67/120)
Sequence 1 MASKRFLNNLVPALFLCMVV-AASVVESAVTCGQVTSSLTPCIPYARGVV
           ------LN-------LC-VV--A-----A--CGQVTSSL--CIP------
Sequence 2 ---MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGG

Sequence 1 AAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP
           --P-A-CCSGVRSLN-AAKTTPDRQ--CNCLK--A--I-G-N----G-LP
Sequence 2 PVP-ASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILP

Sequence 1 GKCGVSIPYKISPSTDCSRVK-
           GKCGVSIPYKIS-ST-C---K-
Sequence 2 GKCGVSIPYKISTSTNCATIKF



Alignment 12
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 52.50 (63/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR-GVV
           ---------LV-A--LCM-VAA-V-----TC-Q----LTPC--Y---G-V
Sequence 2 ----MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGV

Sequence 1 AAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP
           --PS--CC-GVR--N-A--TT-DRQ-ACNCLK--A--I-G-N------LP
Sequence 2 LPPS--CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLP

Sequence 1 GKCGVSIPYKISPSTDCSRVK
           GKCGV-IPYKISPST-C--VK
Sequence 2 GKCGVNIPYKISPSTNCNNVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 55.83 (67/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MAS------L-----LCM-V----V--A-TCGQVTSSL-PCI-Y-R---A
Sequence 2 MASSA-VTKLALVVALCMAVS---VAHAITCGQVTSSLAPCIGYVRSGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-G-R--N--A-TT-DRQTACNCLK--A-SI-G-N------LPG
Sequence 2 VPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV--PYKIS-ST-C--VK
Sequence 2 KCGVNVPYKISTSTNCATVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 55.00 (66/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MAS---------AL-LC-VVA------A-TCGQV-SS--PC--Y-----A
Sequence 2 MASSTAMKLSLVAL-LCIVVALPIAQ-AITCGQVASSISPCVNYVKSGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-AACC-G-RSLN-AAKTT-DRQ--CNCLK-----I-G-N------LPG
Sequence 2 VP-AACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGVS-PYKIS-ST-C--VK
Sequence 2 KCGVSVPYKISTSTNCAAVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 52.50 (63/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPY-ARGVV
           MAS--F----------CM---------A--CGQV-S-L-PCIP----G--
Sequence 2 MASLKF----AFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKG--

Sequence 1 AAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP
           -AP--ACCSGVR-L--A--TT-DRQ-ACNCLK--A-S--G-N-G---ALP
Sequence 2 GAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALP

Sequence 1 GKCGVSIPYKISPSTDCSRVK-
           G-CGVSIPYKIS-ST-C---K-
Sequence 2 GRCGVSIPYKISTSTNCATIKF



Alignment 16
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 48.33 (58/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           -----------------------------TCGQV-S-L-PCIPY-RG--A
Sequence 2 ----------------------------ITCGQVSSALAPCIPYVRGGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-G-R--NN-A-TTPDRQ-ACNCLK----S--G-N-----ALPG
Sequence 2 VPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS-ST-C--VK
Sequence 2 KCGVHIPYKISASTNCATVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 51.67 (62/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ---------L-----LC-VVA------A-TCGQV-SS--PC--Y-----A
Sequence 2 -MAISTAMKLSLVALLCIVVALPIAQ-AITCGQVASSISPCVNYVKSGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-AACC-G-RSLN-AAKTT-DRQT-CNCLK-----I-G-N------LPG
Sequence 2 VP-AACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV--PYKIS-ST-C--VK
Sequence 2 KCGVNVPYKISTSTNCAAVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 51.67 (62/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAA---SVVESAVTCGQVTSSLTPCIPYARG
           ----------V----L--VVAA----V-E-AV-CGQV-S-L-PCI-YARG
Sequence 2 -----MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARG

Sequence 1 VVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGA
           --A-PSAACCSGVRSL---A--T-D-Q-AC-C-K--A----G-N-G----
Sequence 2 NGASPSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAG

Sequence 1 LPGKCGVSIPYKISPSTDCSRVK
           -P-KCGVS-PY-IS-S-DCS---
Sequence 2 IPTKCGVSVPYAISSSVDCSKIR



Alignment 19
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 52.50 (63/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----R--------L--CMVV-A---E-A--CG-VTS-L-PC--Y--G---
Sequence 2 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGG-P

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PS--CC-GV--L--AA-TTPDRQ-ACNCLK--A-SIT--N-----ALPG
Sequence 2 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG

Sequence 1 KCGVSIPYKISPSTDCSRVK-
           KCGV-IPYKIS--T-C--VK-
Sequence 2 KCGVNIPYKISTTTNCNTVKF



Alignment 20
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 49.17 (59/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           -----------------------------TCGQV-SSL-PCI-Y-RG--A
Sequence 2 ----------------------------ITCGQVSSSLAPCIGYVRGGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-G-R--NN-A-TTPDR-TACNCLK----SI-G-N-----ALPG
Sequence 2 VPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS-ST-C--VK
Sequence 2 KCGVNIPYKISASTNCATVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 52.50 (63/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MAS------L-----LCM-V----V--A-TC-QV---L-PCI-Y-R---A
Sequence 2 MASSAVIK-LALVVALCMAVS---VAHAITCSQVSANLAPCINYVRSGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-G----N--AKTTPDRQ-ACNCLK--A-S--G-N-G----LPG
Sequence 2 VPPA-CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV--PYKIS-ST-C--VK
Sequence 2 KCGVNVPYKISTSTNCATVK



Alignment 22
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 51.67 (62/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           -----------------------------TCGQV-SSL-PCI-Y-R----
Sequence 2 ----------------------------ITCGQVSSSLAPCINYLRAGGV

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GVRSLNNAAKTT-DRQ-ACNCLK----SI-G-N------LPG
Sequence 2 VP-ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGVS-PYKISPSTDC--VK
Sequence 2 KCGVSVPYKISPSTDCKSVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 54.17 (65/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MAS---------AL-LC-VVA------A-TCGQV-S---PC--Y-----A
Sequence 2 MASSTAMKLSLVAL-LCIVVALPIAQ-AITCGQVASNISPCLTYVKSGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-AACCSG-R-LN--AKTT-DRQ-ACNCLK--A--I-G-N------LPG
Sequence 2 VP-AACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGVS-PYKIS--T-C--VK
Sequence 2 KCGVSVPYKISTTTNCAAVK



Alignment 24
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 49.17 (59/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ---------L--A---CMVV-------A-TCGQVT--L--C--Y-R---A
Sequence 2 ---MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-G-----N-AKTTPDR-TACNCLK--A----G-N----G-LPG
Sequence 2 VP-APCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS-ST-C---K
Sequence 2 KCGVNIPYKISTSTNCASIK



Alignment 25
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 52.50 (63/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ---------L-----LC-VVA--V---A-TCGQVT----PC--Y-----A
Sequence 2 -MACSAVMKLALVALLCIVVAVPVAQ-AITCGQVTQNVAPCFNYVKNGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-AACC-GVR-LN--AKTT-DRQ--CNCLK--A-SI-G-N------LPG
Sequence 2 VP-AACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGVS-PYKIS-ST-C--VK
Sequence 2 KCGVSVPYKISTSTNCATVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 50.83 (61/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------CMVV-A---ES---CG-VTS-L-PC-PY--G---
Sequence 2 ---MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEG--R

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P---CC-GV--L--AAKT--DR-TAC-CLK--A-SI-GI--G----LPG
Sequence 2 GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           -CGV-IPYKISPSTDCS-V-
Sequence 2 VCGVNIPYKISPSTDCSTVQ



Alignment 27
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 50.83 (61/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------CMVV-A---ES---CG-VTS-L-PC-PY--G---
Sequence 2 ---MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEG--R

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P---CC-GV--L--AAKT--DR-TAC-CLK--A-SI-GI--G----LPG
Sequence 2 GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           -CGV-IPYKISPSTDCS-V-
Sequence 2 VCGVNIPYKISPSTDCSTVQ



Alignment 28
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 52.50 (63/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MAS---------AL-LC-VVA------A-TCGQV-S---PC--Y-----A
Sequence 2 MASSTAMKLSLVAL-LCIVVALPIAQ-AITCGQVASNISPCVTYVKSGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CCSG-R-LN--AKTT-DRQ--CNCLK--A--I-G-N------LPG
Sequence 2 VP-APCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGVS-PYKIS--T-C--VK
Sequence 2 KCGVSVPYKISTTTNCAAVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 49.17 (59/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------V-------V-----V----TCGQVT--L--C--Y--G---
Sequence 2 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG-G

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PS-ACC-GV--LN--AKT--DR--AC-CLK--A-S--GINYG---ALPG
Sequence 2 YPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCG--IPY-ISPSTDCSRV-
Sequence 2 KCGIRIPYPISPSTDCSRVN



Alignment 30
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 50.00 (60/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVV-
           ----R-------AL--CMVV-A---E-A--CG-V-----PC--Y------
Sequence 2 --MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNN

Sequence 1 AAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP
           A-P---CC-GV--L--AA-TTPDRQ-ACNCLK--A-SI---N-----ALP
Sequence 2 ASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALP

Sequence 1 GKCGVSIPYKISPSTDCSRVK-
           GKCGVSIPYKIS-ST-C--V--
Sequence 2 GKCGVSIPYKISTSTNCNTVRF



Alignment 31
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 45.00 (54/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           -----------------------------TCGQV-S-L-PCI-Y--G--A
Sequence 2 ----------------------------ITCGQVSSNLAPCINYVKGGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-G-R--NN-A-TT-DR--ACNCLK----SI-G-N-----ALPG
Sequence 2 VPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV--PYKIS-ST-C--VK
Sequence 2 KCGVNVPYKISASTNCATVK



Alignment 32
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 55.83 (67/120)
Sequence 1 MASKRFLNNLV--PALFLCMVVAASVVESAVTCGQVTSSLTPCIPY-ARG
           MAS---L--LV---A---CM-V-------AV-CGQV---LTPCI-Y-A-G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 VVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSI--TGINYGRV
           ----PS--CC-GVRSL---A-TT-DRQ--CNCLK-----I--T--N-G--
Sequence 2 GALNPS--CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLA

Sequence 1 GALPGKCGVSIPYKISPSTDCSRVK
           --LPGKCGV-IPYKISPSTDC---K
Sequence 2 AGLPGKCGVNIPYKISPSTDCKTIK



Alignment 33
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 46.67 (56/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           -----------------------------TCGQV-SSL-PC--Y-----A
Sequence 2 ----------------------------ITCGQVASSLAPCLSYLKVGGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P---CC----SL--AAKT--DRQ-AC-CLK--A-SI-G-N------LPG
Sequence 2 VPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGVSIPYKISPSTDCS-VK
Sequence 2 KCGVSIPYKISPSTDCSSVK



Alignment 34
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 47.50 (57/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPY-ARGVV
           ------------------------------CGQV-S-L-PCI-----G-V
Sequence 2 ----------------------------LSCGQVNSALAPCITFLTKGGV

Sequence 1 AAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP
           --PS--CCSGVR-L--AAKTT-DRQ-ACNCLK--A-S--G-N-G---ALP
Sequence 2 --PSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALP

Sequence 1 GKCGVSIPYKISPSTDCSRVK-
           G-CGVSIPYKIS-ST-C---K-
Sequence 2 GRCGVSIPYKISTSTNCATIKF



Alignment 35
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 45.00 (54/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------CMVV--S--E-A-TC--V-----PC---------
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 36
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 45.00 (54/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------CMVV--S--E-A-TC--V-----PC---------
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 37
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 46.67 (56/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ------------A---CMV---S--E-A-TC--V----TPC--Y------
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 38
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 46.67 (56/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ------------A---CMV---S--E-A-TC--V----TPC--Y------
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 39
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 46.67 (56/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ------------A---CMV---S--E-A-TC--V----TPC--Y------
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 40
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 45.83 (55/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MA----L--L--A----M--AA-----A--CGQV-S---PC--Y--G---
Sequence 2 MARAQVL--LMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGG-P

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PS--CC-GVR-L-N-A----DRQT-CNCLK-IAR-I---N-------P-
Sequence 2 GPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KC-V--PY-ISP--DCSR--
Sequence 2 KCNVNVPYTISPDIDCSRIY



Alignment 41
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 46.67 (56/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MAS--F----V----LCMVV---------TCGQV-S-L-PC---------
Sequence 2 MASVKFACVVV----LCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGF

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GVR---N-A--T-DR---CNCLK--A----G-N-----ALPG
Sequence 2 VP-AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPG

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS-ST-C----
Sequence 2 KCGVNIPYKISTSTNCASIN



Alignment 42
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 45.83 (55/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           MA----L--L--A----M--AA-----A--CGQV-S---PC--Y--G---
Sequence 2 MARAQVL--LMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGG-P

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PS--CC-GVR-L-N-A----DRQT-CNCLK-IAR-I---N-------P-
Sequence 2 GPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPS

Sequence 1 KCGVSIPYKISPSTDCSRVK-----------------
           KC-V--PY-ISP--DCSR-------------------
Sequence 2 KCNVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 43
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 43.33 (52/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------CMVV--S--ESA-TC--V-----PC--Y------
Sequence 2 --MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-A-KTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCG---PYK-S--TDC--VK
Sequence 2 KCGLNLPYKLSLETDCNKVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 44.17 (53/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------CMVV--S--E-A-TC--VT----PC---------
Sequence 2 --MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P---CC-GV--LN-AAKTTPDRQ-ACNCLK----S-----------LP-
Sequence 2 VP-VDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 45
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 45.83 (55/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR--GV
           ----------------CMVV--S--E-A-TC--V-----PC-------G-
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGE

Sequence 1 VAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGAL
           V---SA-CC-GV--LN-AAKTTPDRQ-ACNCLK----S-----------L
Sequence 2 V---SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVL

Sequence 1 PGKCGVSIPYKISPSTDCSRVK
           P-KCGV-IPYKIS--TDC--VK
Sequence 2 PSKCGVNIPYKISLETDCNKVK



Alignment 46
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 45.83 (55/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR--GV
           ----------------CMVV--S--E-A-TC--V-----PC-------G-
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGE

Sequence 1 VAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGAL
           V---SA-CC-GV--LN-AAKTTPDRQ-ACNCLK----S-----------L
Sequence 2 V---SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVL

Sequence 1 PGKCGVSIPYKISPSTDCSRVK
           P-KCGV-IPYKIS--TDC--VK
Sequence 2 PSKCGVNIPYKISLETDCNKVK



Alignment 47
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 44.17 (53/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------CMVV--S--E-A-TC--V----TPC---------
Sequence 2 --MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKT-PDRQ-ACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNTVK



Alignment 48
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 42.50 (51/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------CMVV--S--E-A-TC--V-----PC--Y------
Sequence 2 ----MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-A-KTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCG---PYK-S--TDC--VK
Sequence 2 KCGLNLPYKLSLETDCNKVK



Alignment 49
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 45.00 (54/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ------------A---CMVV--S--E-A--C--V------C--Y------
Sequence 2 ----MKMMKFFCAMVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 50
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 45.00 (54/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ------------A---CMVV--S--E-A--C--V------C--Y------
Sequence 2 --MAMKMMKFFCAMVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 51
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 45.00 (54/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ------------A---CMVV--S--E-A--C--V------C--Y------
Sequence 2 --MAMKMMKFFCAMVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKTTPDRQTACNCLK----S-----------LP-
Sequence 2 VP-ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYKIS--TDC--VK
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 52
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 43.33 (52/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------CMVV--S--E-A-TC--V-----PC--Y------
Sequence 2 --MAMKMMKVFCVMVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGE

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P-A-CC-GV--LN-AAKTTPDRQTAC-CLK----------------LP-
Sequence 2 VP-ANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPS

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV-IPYK-S--TDC--VK
Sequence 2 KCGVTIPYKLSMETDCNKVK



Alignment 53
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 41.67 (50/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR--GV
           ---------------------------A--C--VT-S--PC--Y----G-
Sequence 2 ---------------------------AIQCSFVTKSIAPCFGYLKSGGT

Sequence 1 VAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSI-TGINYGRVGA
           V--P---CCSG----N--AKTT-DRQ--CNCLK--A-S----IN------
Sequence 2 VSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAAS

Sequence 1 LPGKCGVSIPYKISPSTDCSRVK
           LPGKCGVSIPYKIS-S--CS--K
Sequence 2 LPGKCGVSIPYKISTSINCSSIK



Alignment 54
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 37.50 (45/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ------------------------------CG-V-S---PC--Y--G---
Sequence 2 ----------------------------IDCGHVDSLVRPCLSYVQGG-P

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PS--CC-GV--L-N-A----DRQ-ACNCLK-IAR-I---N-------P-
Sequence 2 GPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPP

Sequence 1 KCGVSIPYKISPSTDCSRVK
           KCGV--PY-IS---DCSRV-
Sequence 2 KCGVNLPYTISLNIDCSRV-



Alignment 55
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 40.00 (48/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ---------------------------A--CG-V-S-L--CI-Y------
Sequence 2 ---------------------------ALSCGTVNSNLAACIGYLTQNAP

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P---CC-GV--LNN-A-TTPDRQ-AC-CL---A-S----N--R--ALP-
Sequence 2 LPKG-CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPK

Sequence 1 KCGVSIPYKISPSTDCSRVK
           -CGV-IPYKIS-ST-C--V-
Sequence 2 ACGVNIPYKISKSTNCNSVR



Alignment 56
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 37.50 (45/120)
Sequence 1 MASKRFLNNLVPALFLCMVVA----ASVVESAVTCGQVTSSLTPCIPY-A
           ------------A-----V-A----A-V---A-TCGQV---L-PC-P---
Sequence 2 --------MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLT

Sequence 1 RGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRV
           -G----P-AACCSGVR-LN-------DR-TACNC-K--A-----------
Sequence 2 QG--GEPGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAA

Sequence 1 GALPGKCGVSIPYKISPSTDCSRVK
           --LP-KCG-S----IS----C----
Sequence 2 QSLPSKCGISLTVPISRTVNCDTIS



Alignment 57
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 35.00 (42/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVV---ESAVTCGQVTSSLTPCIPYARG
           ---------------L-M-V-A--------A-TC--VT--LTPC-PY-R-
Sequence 2 -----MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRS

Sequence 1 VVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGA
           ----P--ACC-G---L--A--T--DR-TAC-C-K--A-------------
Sequence 2 G-GKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASS

Sequence 1 LPGKCGVSIPYKISPSTDCSRVK
           LPGKCG-S----I-P---C----
Sequence 2 LPGKCGISTSIPINPNVNCNTIP



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 28.33 (34/120)
Sequence 1 ----MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR
           ----------------A-------A---------CG-V-----PC-----
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 GVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVG
           G----PS--CCSG---L----KTT-----AC-C-------I-GI----V-
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 ALPGKCGV--SIPYKISPSTDCSRVK--------
           --P-KCG-----P--I----DCS-----------
Sequence 2 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 30.00 (36/120)
Sequence 1 ---------MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPC
           ----------A----------------V--A----S--TCG-V---L-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 IPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGIN
           -P---G----PS--CCSG---L----KT-P-R--AC-C----------I-
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 YGRVGALPGKCGVSIPYKISP---STDCSRVK-------
           ---V---P--CG-----K--P-----DC-----------
Sequence 2 GKLVSEVPKHCGI-VDSKLPPIDVNMDCKTLGVLHYKGN



Alignment 60
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 26.67 (32/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           -----------------------------TCG-----L-PC-P---G---
Sequence 2 ---------------------------QETCGTMVRALMPCLPFVQGKEK

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PS--CCSG---L----KT-P-R--AC-C----------I----V---P-
Sequence 2 EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK

Sequence 1 KCGVSIPYKISP---STDCSRVK---------------------------
           -CG-----K--P-----DC--V----------------------------
Sequence 2 HCGI-VDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKA

Sequence 1 -----------------
           -----------------
Sequence 2 RLERPQIRVPPPAPEKA



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 27.50 (33/120)
Sequence 1 ----MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR
           ----------------A-------A---------CG-V-----PC-----
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 GVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVG
           G----PS--CCSG---L----KTT-----AC-C-------I-GI----V-
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 ALPGKCGV--SIPYKISPSTDCSRVK--------
           --P-KC------P--I----DCS-----------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 25.83 (31/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           -----------------------------TCG-----L-PC-P---G---
Sequence 2 ---------------------------QETCGTMVRALMPCLPFVQGKEK

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PS--CCSG---L----KT-P-R--AC-C----------I----V---P-
Sequence 2 EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK

Sequence 1 KCGVSIPYKISP---STDCSRVK---------------------------
           -CG-----K--P-----DC-------------------------------
Sequence 2 HCGI-VDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKA

Sequence 1 -----------------
           -----------------
Sequence 2 RLERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 31.67 (38/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------V----L-------------TC--V---L-PC-----G---
Sequence 2 -MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTG--Q

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PS-ACC-GV--LNN--KT--DR---CNC-K----SI------R---L--
Sequence 2 EPSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA-YDPKRMPLLST

Sequence 1 KCGVSIPYK-ISPSTDCSRVK-
           KCGV-----------DCS----
Sequence 2 KCGVKPDFPAVDKNLDCSKLPV



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 28.33 (34/120)
Sequence 1 ----------MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTP
           -------------------L-----------A----S--TCG-V---L-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGI
           C-P---G----PS--CCSG---L----KT---R--AC-C----------I
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NYGRVGALPGKCGVSIPYKISP---STDCSRVK-----------------
           ----V---P--CG-----K--P-----DC---------------------
Sequence 2 DGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 24.17 (29/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           -------------------------------------L-PC-P---G---
Sequence 2 ---------------------------------MVRALMPCLPFVQGKEK

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -PS--CCSG---L----KT-P-R--AC-C----------I----V---P-
Sequence 2 EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK

Sequence 1 KCGVSIPYKISP---STDCSRVK---------------------------
           -CG-----K--P-----DC--V----------------------------
Sequence 2 HCGI-VDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKA

Sequence 1 -----------------
           -----------------
Sequence 2 RLERPQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 14.17 (17/120)
Sequence 1 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA
           ----------------------------VTCGQV-S-L-PCI-Y-----A
Sequence 2 ---------------------------TVTCGQVASALSPCIDYLQKDGA

Sequence 1 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG
           -P---CC----S--------------------------------------
Sequence 2 VPAGSCCXKXLSSA------------------------------------

Sequence 1 KCGVSIPYKISPSTDCSRVK
           --------------------
Sequence 2 --------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.