The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Que i 1.0101

Sequence QGS84240

Full FASTA alignment

Sequence name:
Query sequence:
MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
EIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEAY
LLAHPDLYT

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Que i 1.0101QGS84240Go!159217.91.0e-58
2Que a 1.0201ABZ81045Go!159189.92.8e-50
3Que ac 1.0101QOL10866Go!159188.11.0e-49
4Que a 1.0401ABZ81047Go!160166.92.4e-43
5Que a 1.0301ABZ81046Go!160165.56.5e-43
6Que m 1.0101AUH28179Go!160163.62.4e-42
7Cas s 1CAD10374Go!160151.11.3e-38
8Jug r 5.0101APD76154Go!160150.52.0e-38
9Fag s 1.0101ACJ23864Go!160147.61.5e-37
10Pru ar 1O50001Go!160145.56.4e-37
11Cor a 1.0301CAA96549Go!160143.52.7e-36
12Pru p 1.0101Q2I6V8Go!160142.07.3e-36
13Pru av 1O24248Go!160140.81.7e-35
14Bet v 1.0205Q39427Go!160139.15.5e-35
15Bet v 1.0204P43186Go!160138.96.3e-35
16Mal d 1.0401CAA96535Go!160138.77.3e-35
17Mal d 1.0403CAA96537Go!160138.39.7e-35
18Bet v 1.0301CAA54696.1Go!160137.71.5e-34
19Pru du 1.0101B6CQS9Go!160137.51.7e-34
20Bet v 1.0206CAA04828.1Go!159137.22.0e-34
21Bet v 1.0203P43184Go!160136.24.1e-34
22Mal d 1.0402CAA96536Go!160136.24.1e-34
23Cor a 1.0201CAA96548Go!160136.04.7e-34
24Mal d 1.0304AAO25113Go!159135.85.4e-34
25Bet v 1.0202CAA54481Go!160135.66.3e-34
26Bet v 1.0201CAA54421Go!160135.66.3e-34
27Aln g 1AAB24432Go!160135.28.4e-34
28Bet v 1.0113CAB02160Go!160135.09.7e-34
29Mal d 1.0201AAB01362Go!159134.81.1e-33
30Mal d 1.0202AAD26545Go!159134.81.1e-33
31Mal d 1.0205AAD26558Go!159134.31.5e-33
32Bet v 1.0118CAA07329.1Go!160134.31.5e-33
33Mal d 1.0103AAD26546Go!159134.11.7e-33
34Mal d 1.0105AAD26553Go!159133.92.0e-33
35Mal d 1.0204AAD26548Go!159133.92.0e-33
36Mal d 1.0106AAD26554Go!159133.92.0e-33
37Bet v 1.0112CAB02159Go!160133.92.0e-33
38Bet v 1.0114CAB02161Go!160133.92.0e-33
39Bet v 1.0101CAA33887Go!160133.92.0e-33
40Mal d 1.0206AAD13683Go!159133.72.3e-33
41Mal d 1.0108AAD29671Go!159133.72.3e-33
42Pyr c 1O65200Go!159133.72.3e-33
43Aln g 1P38948Go!159133.72.3e-33
44Bet v 1.0109CAB02156Go!160133.72.3e-33
45Mal d 1.0203AAD26547Go!159133.52.6e-33
46Mal d 1.0207AAK13030Go!159133.52.6e-33
47Mal d 1.0104AAD26552Go!159133.52.6e-33
48Fra a 1Q256S7Go!160133.33.1e-33
49Cor a 1.0402AAG40329Go!161133.33.1e-33
50Bet v 1.0106CAA54487Go!160133.13.5e-33
51Mal d 1.0109AAK13029Go!159132.94.1e-33
52Mal d 1.0107AAD26555Go!159132.94.1e-33
53Fra a 1Q3T923Go!160132.94.1e-33
54Bet v 1.0103CAA54483Go!160132.94.1e-33
55Mal d 1.0101CAA58646Go!159132.74.7e-33
56Cor a 1.0401AAD48405Go!161132.74.7e-33
57Cor a 1.0403AAG40330Go!161132.74.7e-33
58Bet v 1.0116CAA04827.1Go!159132.36.3e-33
59Bet v 1.0104CAA54484Go!160132.17.3e-33
60Cor a 1.0404AAG40331Go!161132.17.3e-33
61Mal d 1.0208CAD32318Go!158131.98.3e-33
62Mal d 1.0302AAK13027Go!159131.98.3e-33
63Bet v 1.0110CAB02157Go!160131.98.4e-33
64Mal d 1.0301CAA96534Go!159131.41.1e-32
65Fra a 1Q256S6Go!160131.41.1e-32
66Car b 1.0302CAB02217Go!161131.41.1e-32
67Mal d 1.0102CAA88833Go!159131.21.3e-32
68Bet v 1.0117CAA07323.1Go!160131.21.3e-32
69Bet v 1.0108CAB02155Go!160131.01.5e-32
70Bet v 1.0105CAA54485Go!160131.01.5e-32
71Bet v 1.0115CAA96547Go!160131.01.5e-32
72Bet v 1.0102CAA54482Go!160130.42.3e-32
73Bet v 1.0107CAA54489Go!160129.64.1e-32
74Fra a 1Q256S2Go!160129.64.1e-32
75Bet v 1.0111CAB02158Go!160129.44.7e-32
76Car b 1.0301CAB02216Go!161129.44.7e-32
77Fra a 1Q256S4Go!159129.06.2e-32
78Bet v 1.0207ACF75030.1Go!150128.39.2e-32
79Cor a 1.0103CAA50325Go!160128.11.1e-31
80Can s 5.0101AFN42528Go!161128.11.1e-31
81Mal d 1.0303AAK13028Go!159127.91.3e-31
82Cor a 1.0101CAA50327Go!160125.66.3e-31
83Cor a 1.0102CAA50328Go!160125.28.3e-31
84Cor a 1Q08407Go!159124.21.7e-30
85Car b 1.0104CAB02207Go!160123.43.0e-30
86Car b 1.0103CAB02206Go!160123.43.0e-30
87Car b 1.0105CAB02208Go!160122.74.7e-30
88Car b 1.0112ABZ81043Go!160121.31.3e-29
89Car b 1.0111ABZ81042Go!160121.31.3e-29
90Car b 1.0109ABZ81040Go!160121.31.3e-29
91Car b 1.0110ABZ81041Go!160121.11.5e-29
92Act c 8.0101CAM31908Go!159120.91.7e-29
93Bet v 1.0119ABC41615.1Go!150120.61.9e-29
94Car b 1.0106CAB02209Go!160120.72.0e-29
95Car b 1.0113ABZ81044Go!160120.52.3e-29
96Ost c 1.0101ADK39021Go!160120.22.6e-29
97Car b 1.0107CAB02213Go!160120.03.0e-29
98Cor a 1.0104CAA50326Go!160119.83.5e-29
99Car b 1P38950Go!159119.64.0e-29
100Car b 1.0108CAB02215Go!160118.01.3e-28
101Car b 1.0102CAA47357Go!159117.51.7e-28
102Act d 8.0101CAM31909Go!157116.73.0e-28
103Car b 1P38949Go!159114.91.1e-27
104Sola l 4.0101AHC08073Go!160111.51.1e-26
105Rub i 1.0101Q0Z8U9Go!137110.32.3e-26
106Gly m 4CAA42646Go!158109.06.1e-26
107Sola l 4.0201NP_001275580Go!160108.01.3e-25
108Pha v 1CAA43637Go!156101.01.6e-23
109Pet c PR10CAA67246Go!155100.52.2e-23
110Pha v 1P25985Go!15599.54.5e-23
111Pha v 1CAA43636Go!15598.96.9e-23
112Ara h 8.0101AAQ91847Go!15798.96.9e-23
113Tar o RAPAAB92255Go!15796.05.2e-22
114Ara h 8.0201EF436550Go!15395.66.8e-22
115Lyc e 4.0101CAA75803Go!17895.01.2e-21
116Vig r 1.0101Q2VU97Go!15593.92.2e-21
117Api g 1.0201P92918Go!15993.13.9e-21
118Dau c 1.0201AAL76932Go!15491.61.0e-20
119Api g 1P49372Go!15490.81.9e-20
120Dau c 1.0104CAB03716Go!15486.05.1e-19
121Dau c 1.0105CAB06416Go!15485.47.8e-19
122Dau c 1.0102BAA13604Go!15485.29.0e-19
123Dau c 1.0101AAB01092Go!16884.81.3e-18
124Dau c 1.0103CAB03715Go!15482.55.8e-18
125Que a 1.0101P85126Go!5062.71.7e-12
126Fra a 1.0101Q5ULZ4Go!10054.69.4e-10
127Vig r 6.0101Q9ZWP8Go!15540.82.1e-05
128Cas s 1Q9S8Q4Go!2437.72.9e-05

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Que i 1.0101, Sequence: QGS84240
Sequence identity: 100.00 (159/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
Sequence 2 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
           PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
Sequence 2 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST

Sequence 1 EIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEAY
           EIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEAY
Sequence 2 EIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEAY

Sequence 1 LLAHPDLYT
           LLAHPDLYT
Sequence 2 LLAHPDLYT



Alignment 2
Sequence 1:
Sequence 2: Allergen Que a 1.0201, Sequence: ABZ81045
Sequence identity: 88.68 (141/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-THESQETSVI-PARLFKA--LDSDNLI-KVLPQAIKS-E-IEGNGG
Sequence 2 MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
           PGTIKKITFGEASKFKY-KHRIDALDPENCTYSFSVIEGDALT-M-SVST
Sequence 2 PGTIKKITFGEASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVST

Sequence 1 EIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEAY
           EIK-VASPDGGSI-KSTTKYQTKGDFQLKEEQIQA-IEK--GL-KAVEAY
Sequence 2 EIKCVASPDGGSIMKSTTKYQTKGDFQLKEEQIQAAIEKAAGLLKAVEAY

Sequence 1 LLAHPDLYT
           L-AHPDLY-
Sequence 2 LVAHPDLYK



Alignment 3
Sequence 1:
Sequence 2: Allergen Que ac 1.0101, Sequence: QOL10866
Sequence identity: 84.28 (134/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---ESQETSVIPPARLFKAFVLDSDNLI-KVLP-A-KS-E-IEGNGG
Sequence 2 MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
           PGTIKK-TFGEASK-KY-KHRID-LDPENC-YSFSVIEG-ALTD--S-ST
Sequence 2 PGTIKKFTFGEASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASIST

Sequence 1 EIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEAY
           E-KFVASPDGGSI-KSTTKYQTKG-FQLKEEQIQA--EK-TGL-KAVEAY
Sequence 2 EVKFVASPDGGSIMKSTTKYQTKGGFQLKEEQIQAAVEKGTGLFKAVEAY

Sequence 1 LLAHPDLYT
           LLAHPDLY-
Sequence 2 LLAHPDLYN



Alignment 4
Sequence 1:
Sequence 2: Allergen Que a 1.0401, Sequence: ABZ81047
Sequence identity: 77.36 (123/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-THESQETSVI-PARLFKA--LDSDNLI-KVLPQAIKS-E-IEGNGG
Sequence 2 MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITFGE-S--K--KHRID--DPEN-TYSFSVIEGDAL-D----VS
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           TE-K-VASPDGGSI-KST-KYQTKGDFQL--E-I----EK--G--KAVEA
Sequence 2 TETKIVASPDGGSIAKSTSKYQTKGDFQLTDELIRGGKEKASGVFKAVEA

Sequence 1 YLLAHPDLYT
           YL-AHPDLY-
Sequence 2 YLVAHPDLYK



Alignment 5
Sequence 1:
Sequence 2: Allergen Que a 1.0301, Sequence: ABZ81046
Sequence identity: 75.47 (120/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-ES---SVIPPARLFKAFVLDSDNLIPKV-PQA-KS-E-IEGNGG
Sequence 2 MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITFGE-S--K--KHRID--DPEN-TYSFSVIEGDAL-D----VS
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           TE-K-VASPDGGSI-KST-KYQTKGDFQL--E-I----EK-----KAVEA
Sequence 2 TETKIVASPDGGSIVKSTSKYQTKGDFQLTDELIRGGKEKASEVFKAVEA

Sequence 1 YLLAHPDLYT
           YL-AHPDLY-
Sequence 2 YLVAHPDLYK



Alignment 6
Sequence 1:
Sequence 2: Allergen Que m 1.0101, Sequence: AUH28179
Sequence identity: 74.21 (118/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---ES---SVIPPARLFKAFVLDSDNLIPKV-PQA-KS-E-IEGNGG
Sequence 2 MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITFGE-S--K--KHRID--DPEN-T-SFSVIEGDAL-D----VS
Sequence 2 PGTIKKITFGEGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           TE-K-VASPDGGSI-KST-KYQTKGDFQL--E-I----EK--G--KAVEA
Sequence 2 TETKIVASPDGGSIVKSTCKYQTKGDFQLTDELIRGGKEKASGVFKAVEA

Sequence 1 YLLAHPDLYT
           YL-AHPD-Y-
Sequence 2 YLVAHPDGYY



Alignment 7
Sequence 1:
Sequence 2: Allergen Cas s 1, Sequence: CAD10374
Sequence identity: 67.92 (108/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-THE---TS-IPP-RLFKAFVLD-DNLIPK--P-AIKS-E-IEGNGG
Sequence 2 MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S-FKY-KHRID--D--N-TY--SVIEGD---------S
Sequence 2 PGTIKKITFGEGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VASPDGGSI-K-T-KY-TKG----KEE---A--EK--GL-KAVEA
Sequence 2 YEIKIVASPDGGSILKNTSKYHTKGEQEIKEEKVMAGKEKAAGLFKAVEA

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 8
Sequence 1:
Sequence 2: Allergen Jug r 5.0101, Sequence: APD76154
Sequence identity: 66.67 (106/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TSVIPPARLFKAFVLD-DNLIPKV-PQA-KS-E-IEGNGG
Sequence 2 MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-FGE-S--KY-KHR-DA-D--N-TY--SVIEGDAL-D-----S
Sequence 2 PGTIKKINFGEGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS--GGSI-KS---Y--KGD---KEE------EK--GL-KAVE-
Sequence 2 YETKIVASHEGGSILKSISHYHSKGDHEIKEEDVKDGKEKASGLFKAVEG

Sequence 1 YLLAHPDLYT
           YLLAHPD-Y-
Sequence 2 YLLAHPDAYN



Alignment 9
Sequence 1:
Sequence 2: Allergen Fag s 1.0101, Sequence: ACJ23864
Sequence identity: 66.67 (106/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-ES--T-VI-PARLFKAFVLD-DNLIPKV-PQAIKS-E-IEG-GG
Sequence 2 MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S-F-Y-KHRID--D--N-TY----IEGDA---------
Sequence 2 PGTIKKITFGEGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIA

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VASPDGGSI-KST-KY-TKGD---KE-QI-A--E---G--KAVEA
Sequence 2 YEIKLVASPDGGSILKSTSKYHTKGDHEIKEDQIKAGKEEASGIFKAVEA

Sequence 1 YLLAHPDLYT
           YLLA-P--Y-
Sequence 2 YLLANPAAYH



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru ar 1, Sequence: O50001
Sequence identity: 61.01 (97/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TSVIPP--LFKAF-LD-DNLIPKV-P-A-K--E--EG-GG
Sequence 2 MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GTIKK-TFGE-S---Y-KHR-D--D--N--YS---IEGDAL-D------
Sequence 2 VGTIKKVTFGEGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIA

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           --IK-VASPDGGSI-K-T--Y-TKGD---KEEQ--A--EK--GL-K-VEA
Sequence 2 YDIKLVASPDGGSIVKTTSHYHTKGDVEIKEEQVKAGKEKAAGLFKLVEA

Sequence 1 YLLAHPDLYT
           YLLA-PD-Y-
Sequence 2 YLLANPDAYN



Alignment 11
Sequence 1:
Sequence 2: Allergen Cor a 1.0301, Sequence: CAA96549
Sequence identity: 65.41 (104/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIPPARLFK-FVLDSDNLIPKV-P-AIKSIE-IEGNGG
Sequence 2 MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKI-F-E-S-F-Y-K------D--N--Y--SVIEGDAL-D------
Sequence 2 PGTIKKICFDEGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKIN

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VASP-GGSI-KS--KY-T-GD--LK-EQI-A--EK--GL-KAVE-
Sequence 2 YEIKIVASPHGGSILKSISKYHTIGDHELKDEQIKAGKEKASGLFKAVEG

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru p 1.0101, Sequence: Q2I6V8
Sequence identity: 61.64 (98/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-ES--TS-IPP-RLFKAFVLD-DNL-PK--PQAIK--E--EG-GG
Sequence 2 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITFGE-S---Y-KH-ID--D-EN--YS---IEGDAL-D-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VASP-GGSI-KST--Y-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIET

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 13
Sequence 1:
Sequence 2: Allergen Pru av 1, Sequence: O24248
Sequence identity: 61.01 (97/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-ES--TS-IPP-RLFKAFVLD-DNL-PK--PQAIK--E--EG-GG
Sequence 2 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-ID--D-EN--YS---IEGDAL-D-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VASP-GGSI-KST--Y-TKG----KEE---A--EK---L-K--E-
Sequence 2 YETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIET

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 14
Sequence 1:
Sequence 2: Allergen Bet v 1.0205, Sequence: Q39427
Sequence identity: 62.26 (99/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNLIPKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-K-R-D--D--N--YS-S-IEG-AL-D------
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-E---A--EK---L--AVE-
Sequence 2 NEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKAEALLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 15
Sequence 1:
Sequence 2: Allergen Bet v 1.0204, Sequence: P43186
Sequence identity: 62.89 (100/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---ES--TSVIP-ARLFKAF-LD-DNLIPKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-K-R-D--D--N--YS-S-IEG-AL-D------
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-E---A--EK---L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 16
Sequence 1:
Sequence 2: Allergen Mal d 1.0401, Sequence: CAA96535
Sequence identity: 59.12 (94/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP--RLFKAF-LD-DNLIPK--PQAIKS-E-IEG-GG
Sequence 2 MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           -GTIKK-TFGE-S---Y-K-R----D--N-TYS-S-IEGD-L-D------
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K--ASPDGGSI-K-T--Y--KGD---KEE---A--EK--GL-K--EA
Sequence 2 YETKLIASPDGGSIIKTTSHYHAKGDVEIKEEHVKAGKEKASGLFKLLEA

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 17
Sequence 1:
Sequence 2: Allergen Mal d 1.0403, Sequence: CAA96537
Sequence identity: 59.12 (94/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP--RLFKAF-LD-DNLIPK--PQAIKS-E-IEG-GG
Sequence 2 MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           -GTIKK-TFGE-S---Y-K-R----D--N-TYS-S-IEGD-L-D------
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K--ASPDGGSI-K-T--Y--KGD---KEE---A--EK--GL-K--EA
Sequence 2 YETKLIASPDGGSIIKTTSHYRAKGDVEIKEEHVKAGKEKASGLFKLLEA

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 18
Sequence 1:
Sequence 2: Allergen Bet v 1.0301, Sequence: CAA54696.1
Sequence identity: 62.26 (99/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVI-PARLFK-FVLD-DNLIPKV-P----S-E-IEGNGG
Sequence 2 MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-KHR-D--D--N--Y--S-IEG--L-D-----S
Sequence 2 PGTIKKITFPEGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-P-GGSI-K-T-KY-TKGD--L-EE-I-A--EK--GL-KAVE-
Sequence 2 YEIKIVAAPGGGSILKITSKYHTKGDISLNEEEIKAGKEKGAGLFKAVEN

Sequence 1 YLLAHPDLYT
           YL-AHP--Y-
Sequence 2 YLVAHPNAYN



Alignment 19
Sequence 1:
Sequence 2: Allergen Pru du 1.0101, Sequence: B6CQS9
Sequence identity: 58.49 (93/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MG--T-----TSVIPP-RLFKA-VL--D-LIPK--PQ--KS-E--EG-GG
Sequence 2 MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GTIKKI-FGE-S---Y-KH-ID-LD--N--Y--S--EGDAL-D-V---S
Sequence 2 VGTIKKISFGEGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VAS-DGGS--KST--Y-TKGD---KEE---A--EK-TGL-K--E-
Sequence 2 YEIKLVASADGGSVIKSTSNYHTKGDVEIKEEDVKAGKEKATGLFKLIEN

Sequence 1 YLLAHPDLYT
           YL-A-PD-Y-
Sequence 2 YLVANPDAYN



Alignment 20
Sequence 1:
Sequence 2: Allergen Bet v 1.0206, Sequence: CAA04828.1
Sequence identity: 62.26 (99/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV---ES--TSVIP-ARLFKAF-LD-DNLIPKV-PQAI-S-E-IEGNGG
Sequence 2 -GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-K-R-D--D--N--YS-S-IEG-AL-D------
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-E---A--EK---L--AVE-
Sequence 2 NEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 21
Sequence 1:
Sequence 2: Allergen Bet v 1.0203, Sequence: P43184
Sequence identity: 61.64 (98/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---ES--TSVIP-ARLFKAF-L--D-LIPKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-K-R-D--D--N--YS-S-IEG-AL-D------
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-E---A--EK---L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 22
Sequence 1:
Sequence 2: Allergen Mal d 1.0402, Sequence: CAA96536
Sequence identity: 57.86 (92/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP--RLFKAF-LD-DNLIPK--PQAIKS---IEG-GG
Sequence 2 MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           -GTIKK-TFGE-S---Y-K-R----D--N-TYS-S-IEGD-L-D------
Sequence 2 VGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K--ASPDGGSI-K----Y--KGD---KEE---A--EK--GL-K--EA
Sequence 2 YETKLIASPDGGSIIKTNSHYHAKGDVEIKEEHVKAGKEKASGLFKLLEA

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 23
Sequence 1:
Sequence 2: Allergen Cor a 1.0201, Sequence: CAA96548
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD--NLIPKV-PQA--S-E--EGNGG
Sequence 2 MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-K-R----D--N--YS--VIEG----D-V----
Sequence 2 PGTIKKITFSEGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD-----E-I----EK--GL--AVEA
Sequence 2 NEIKIVAAPDGGSILKISNKYHTKGDHEVDAEHIKGGKEKVEGLFRAVEA

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 24
Sequence 1:
Sequence 2: Allergen Mal d 1.0304, Sequence: AAO25113
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-ES--TSVIPPARLF-AFVLD-DNLIPK--PQA-KS-E--EG-GG
Sequence 2 MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GTIKKI-FGE-S---Y-KHRID--D-EN--Y--SVIEGDA--------S
Sequence 2 VGTIKKINFGEGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GS--KST--Y-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVAS-GSGSVIKSTSHYHTKGDVEIKEEHVKAGKEKASHLFKLIEN

Sequence 1 YLLAHPDLYT
           YLL-HPD-Y-
Sequence 2 YLLEHPDAYN



Alignment 25
Sequence 1:
Sequence 2: Allergen Bet v 1.0202, Sequence: CAA54481
Sequence identity: 61.64 (98/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---ES--TSVIP-ARLFKAF-L--D-LIPKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-K-R-D--D--N--YS-S-IEG-AL-D------
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-E---A--EK---L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 26
Sequence 1:
Sequence 2: Allergen Bet v 1.0201, Sequence: CAA54421
Sequence identity: 61.01 (97/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-L--D-LIPKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-K-R-D--D--N--YS-S-IEG-AL-D------
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-E---A--EK---L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 27
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: AAB24432
Sequence identity: 61.01 (97/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFKAF-LD-D-L-PKV-P-A--S-E-IEGNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-K-R-D--D--N--YSFSVIEG-A--D----V-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---K--TKGD-----EQI----EK--GL-KAVE-
Sequence 2 NEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 28
Sequence 1:
Sequence 2: Allergen Bet v 1.0113, Sequence: CAB02160
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 29
Sequence 1:
Sequence 2: Allergen Mal d 1.0201, Sequence: AAB01362
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-ID--D--N--Y----IEGDALTD----VS
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GSI-KS---Y-TKGD---KEE---A--EK--GL-K--E-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 30
Sequence 1:
Sequence 2: Allergen Mal d 1.0202, Sequence: AAD26545
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-ID--D--N--Y----IEGDALTD----VS
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GSI-KS---Y-TKGD---KEE---A--EK--GL-K--E-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 31
Sequence 1:
Sequence 2: Allergen Mal d 1.0205, Sequence: AAD26558
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-ID--D--N--Y----IEGDALTD----VS
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GSI-KS---Y-TKGD---KEE---A--EK--GL-K--E-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVMAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 32
Sequence 1:
Sequence 2: Allergen Bet v 1.0118, Sequence: CAA07329.1
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNLIPKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-----KY-TKGD---K-E---A--EK---L--AVE-
Sequence 2 NEIKLVATPDGGSILEISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 33
Sequence 1:
Sequence 2: Allergen Mal d 1.0103, Sequence: AAD26546
Sequence identity: 59.12 (94/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHRID--D-----YS---IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA---G--IK-S---Y-TKG----KEE---A--EK--GL-K--E-
Sequence 2 YETKLVACGSGSTIK-SISHYHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 34
Sequence 1:
Sequence 2: Allergen Mal d 1.0105, Sequence: AAD26553
Sequence identity: 59.12 (94/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHRID--D-----YS---IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA---G--IK-S---Y-TKG----KEE---A--EK--GL-K--E-
Sequence 2 YETKLVACGSGSTIK-SISHYHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKDHPDAYN



Alignment 35
Sequence 1:
Sequence 2: Allergen Mal d 1.0204, Sequence: AAD26548
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-ID--D--N--Y----IEGDALTD----VS
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K--AS---GSI-KS---Y-TKGD---KEE---A--EK--GL-K--E-
Sequence 2 YETKLMAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 36
Sequence 1:
Sequence 2: Allergen Mal d 1.0106, Sequence: AAD26554
Sequence identity: 59.12 (94/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHRID--D-----YS---IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA---G--IK-S---Y-TKG----KEE---A--EK--GL-K--E-
Sequence 2 YETKLVACGSGSTIK-SISHYHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKDHPDAYN



Alignment 37
Sequence 1:
Sequence 2: Allergen Bet v 1.0112, Sequence: CAB02159
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPEGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 38
Sequence 1:
Sequence 2: Allergen Bet v 1.0114, Sequence: CAB02161
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMRETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 39
Sequence 1:
Sequence 2: Allergen Bet v 1.0101, Sequence: CAA33887
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 40
Sequence 1:
Sequence 2: Allergen Mal d 1.0206, Sequence: AAD13683
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFK-FVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-ID--D--N--Y----IEGDALTD----VS
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GSI-KS---Y-TKGD---KEE---A--EK--GL-K--E-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 41
Sequence 1:
Sequence 2: Allergen Mal d 1.0108, Sequence: AAD29671
Sequence identity: 59.12 (94/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHRID--D-----YS---IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA---G--IK-S---Y-TKG----KEE---A--EK--GL-K--E-
Sequence 2 YETKLVACGSGSTIK-SISHYHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKDHPDAYN



Alignment 42
Sequence 1:
Sequence 2: Allergen Pyr c 1, Sequence: O65200
Sequence identity: 58.49 (93/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MG--T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHR-D--D-----Y----IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS--G--IK-S---Y-TKGD---KEE---A--EK--GL-K--E-
Sequence 2 YEAKLVASGSGSTIK-SISHYHTKGDIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKDHPDAYN



Alignment 43
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: P38948
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV---E----SVIP-ARLFKAF-LD-D-L-PKV-P-A--S-E-IEGNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S-FKY-K-R-D--D--N--YSFSVIEG-A--D----V-
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---K--TKGD-----EQI----EK--GL-KAVE-
Sequence 2 NEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 44
Sequence 1:
Sequence 2: Allergen Bet v 1.0109, Sequence: CAB02156
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 45
Sequence 1:
Sequence 2: Allergen Mal d 1.0203, Sequence: AAD26547
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-ID--D--N--Y----IEGDALTD----VS
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GSI-KS---Y-TKGD---KEE---A--EK--GL-K--E-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           -L--HPD-Y-
Sequence 2 HLKGHPDAYN



Alignment 46
Sequence 1:
Sequence 2: Allergen Mal d 1.0207, Sequence: AAK13030
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGT-KKITFGE-S---Y-KH-ID--D--N--Y----IEGDALTD----VS
Sequence 2 PGTTKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GSI-KS---Y-TKGD---KEE---A--EK--GL-K--E-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 47
Sequence 1:
Sequence 2: Allergen Mal d 1.0104, Sequence: AAD26552
Sequence identity: 59.12 (94/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHRID--D-----YS---IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA---G--IK-S---Y-TKG----KEE---A--EK--GL-K--E-
Sequence 2 YETKLVACGSGSTIK-SISHYHTKGNIEIKEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKDHPDAYN



Alignment 48
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S7
Sequence identity: 57.86 (92/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IP---LFKAFVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-I---D-EN-TYS-S-IEGDAL-D------
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-V--P-GG-I-K-T-KY-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YLLAHPDLYT
           YL--HP--Y-
Sequence 2 YLKDHPSEYN



Alignment 49
Sequence 1:
Sequence 2: Allergen Cor a 1.0402, Sequence: AAG40329
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIPPARLFK-FVLD-DNLIPKV-PQ-----E--EGNGG
Sequence 2 MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITF-E-S-FKY-KH-----D--N--Y--S-IEG--L-------S
Sequence 2 PGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS

Sequence 1 TEIKFVASPDGG-SIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVE
           -EIK--A-P-GG-SI-K-T-KY-TKG-----EE-I-A--EK--GL-KAVE
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVE

Sequence 1 AYLLAHPDLYT
           AYLLAHPD-Y-
Sequence 2 AYLLAHPDTYC



Alignment 50
Sequence 1:
Sequence 2: Allergen Bet v 1.0106, Sequence: CAA54487
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--YS-SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-P-GGSI-K---KY-TKGD---K-EQI-A--E----L--AVE-
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 51
Sequence 1:
Sequence 2: Allergen Mal d 1.0109, Sequence: AAK13029
Sequence identity: 58.49 (93/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHRID--D-----YS---IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA---G--IK-S---Y-TKG----KEE------EK--GL-K--E-
Sequence 2 YETKLVACGSGSTIK-SISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKDHPDAYN



Alignment 52
Sequence 1:
Sequence 2: Allergen Mal d 1.0107, Sequence: AAD26555
Sequence identity: 58.49 (93/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHRID--D-----YS---IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA---G--IK-S---Y-TKG----KEE---A---K--GL-K--E-
Sequence 2 YETKLVACGSGSTIK-SISHYHTKGNIEIKEEHVKAGKAKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 53
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q3T923
Sequence identity: 56.60 (90/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IP---LFKAFVLD-DNLIPK--PQA-K--E--EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-I---D-EN-TYS-S-IEGDAL-D------
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-V--P-GG---K-T-KY-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVSAPHGGTVIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YLLAHPDLYT
           YL--HP--Y-
Sequence 2 YLKDHPSEYN



Alignment 54
Sequence 1:
Sequence 2: Allergen Bet v 1.0103, Sequence: CAA54483
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--YS-SVIEG----D-----S
Sequence 2 PGTIKKISFPEGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-P-GGSI-K---KY-TKGD---K-EQI-A--E----L--AVE-
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 55
Sequence 1:
Sequence 2: Allergen Mal d 1.0101, Sequence: CAA58646
Sequence identity: 58.49 (93/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHRID--D-----YS---IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA---G--IK-S---Y-TKG----KEE------EK--GL-K--E-
Sequence 2 YETKLVACGSGSTIK-SISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKDHPDAYN



Alignment 56
Sequence 1:
Sequence 2: Allergen Cor a 1.0401, Sequence: AAD48405
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIPPARLFK-FVLD-DNLIPKV-PQ---S-E--EGNGG
Sequence 2 MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITF-E---FKY-KH-----D--N--Y--S-IEG--L-------S
Sequence 2 PGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS

Sequence 1 TEIKFVASPDGG-SIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVE
           -EIK--A-P-GG-SI-K-T-KY-TKG-----EE-I-A--EK--GL-KAVE
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAVE

Sequence 1 AYLLAHPDLYT
           AYLLAHPD-Y-
Sequence 2 AYLLAHPDAYC



Alignment 57
Sequence 1:
Sequence 2: Allergen Cor a 1.0403, Sequence: AAG40330
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIPPARLFK-FVLD-DNLIPKV-PQ-----E--EGNGG
Sequence 2 MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITF-E-S-FKY-KH-----D--N--Y--S-IEG--L-------S
Sequence 2 PGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIS

Sequence 1 TEIKFVASPDGG-SIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVE
           -EIK--A-P-GG-SI-K-T-KY-TKG-----EE-I-A--EK--GL-KAVE
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVE

Sequence 1 AYLLAHPDLYT
           AYLLAHPD-Y-
Sequence 2 AYLLAHPDTYC



Alignment 58
Sequence 1:
Sequence 2: Allergen Bet v 1.0116, Sequence: CAA04827.1
Sequence identity: 59.12 (94/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 -GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--YS-S-IEG----D-----S
Sequence 2 PGTIKKISFPEGIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 59
Sequence 1:
Sequence 2: Allergen Bet v 1.0104, Sequence: CAA54484
Sequence identity: 60.38 (96/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--YS-SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-P-GGSI-K---KY-TKGD---K-EQI-A--E----L--AVE-
Sequence 2 NEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 60
Sequence 1:
Sequence 2: Allergen Cor a 1.0404, Sequence: AAG40331
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIPPARLFK-FVLD-DNLIPKV-PQ---S-E--EGNGG
Sequence 2 MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITF-E---FKY-KH-----D--N--Y--S-IEG--L--------
Sequence 2 PGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIP

Sequence 1 TEIKFVASPDGG-SIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVE
           -EIK--A-P-GG-SI-K-T-KY-TKG-----EE-I-A--EK--GL-KAVE
Sequence 2 YEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAVE

Sequence 1 AYLLAHPDLYT
           AYLLAHPD-Y-
Sequence 2 AYLLAHPDAYC



Alignment 61
Sequence 1:
Sequence 2: Allergen Mal d 1.0208, Sequence: CAD32318
Sequence identity: 59.12 (94/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 -GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-ID--D--N--Y----IEGDALTD----VS
Sequence 2 PGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GSI-KS---Y-TKGD----EE---A--EK--GL-K--E-
Sequence 2 YETKLVAS-GSGSIIKSISHYHTKGDVEIMEEHVKAGKEKAHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKDHPDAYN



Alignment 62
Sequence 1:
Sequence 2: Allergen Mal d 1.0302, Sequence: AAK13027
Sequence identity: 58.49 (93/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-ES--TSVIPPARLF-AFVLD-DNLIPK--PQA-KS-E--EG-GG
Sequence 2 MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GTIKKI-FGE-S---Y-KHRID--D--N--Y--SVIEGDA--------S
Sequence 2 VGTIKKINFGEGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA----GS--KST--Y-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVAA-GSGSVIKSTSHYHTKGDVEIKEEHVKAGKEKASHLFKLIEN

Sequence 1 YLLAHPDLYT
           YLL-H-D-Y-
Sequence 2 YLLEHQDAYN



Alignment 63
Sequence 1:
Sequence 2: Allergen Bet v 1.0110, Sequence: CAB02157
Sequence identity: 57.86 (92/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGG---K---KY-TKG----K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 64
Sequence 1:
Sequence 2: Allergen Mal d 1.0301, Sequence: CAA96534
Sequence identity: 58.49 (93/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIPPARLF-AFVLD-DNLIPK--PQA-KS-E--EG-GG
Sequence 2 MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GTIKKI-FGE-S---Y-KHRID--D-EN--Y--SVIEGDA--------S
Sequence 2 VGTIKKINFGEGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GS--KST--Y-TK-D---KEE---A--EK---L-K--E-
Sequence 2 YETKLVAS-GSGSVIKSTSHYHTKSDVEIKEEHVKAGKEKASHLFKLIEN

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 65
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S6
Sequence identity: 57.23 (91/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MG--T-E---TS-IP---LFKAFVLD-DNLIPK--PQAIK--E--EG-GG
Sequence 2 MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-I---D-EN-TYS-S-IEGDAL-D------
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-V--P-GG-I-K-T-KY-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YLLAHPDLYT
           YL--HP--Y-
Sequence 2 YLKDHPSEYN



Alignment 66
Sequence 1:
Sequence 2: Allergen Car b 1.0302, Sequence: CAB02217
Sequence identity: 58.49 (93/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD--NLIPKV-PQA--S-E--EGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S--KY-K-R----D--N--YS--VIEG----D-V----
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K-T-KY-TKGD-----E-I----E---GL-K-VEA
Sequence 2 NEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKGGKERVEGLLKPVEA

Sequence 1 YLLAHPDLYT-
           YLLAH---Y--
Sequence 2 YLLAHTAEYNN



Alignment 67
Sequence 1:
Sequence 2: Allergen Mal d 1.0102, Sequence: CAA88833
Sequence identity: 57.86 (92/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IPP-RLFKAFVLD-DNLIPK--PQAIK--E--EGNGG
Sequence 2 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KHRID--D-----YS---IEGDALTD-----S
Sequence 2 PGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA---G--IK-S---Y--KG----KEE------EK--GL-K--E-
Sequence 2 YETKLVACGSGATIK-SISHYHPKGNIEIKEEHVKVGKEKGHGLFKLIES

Sequence 1 YLLAHPDLYT
           YL--HPD-Y-
Sequence 2 YLKGHPDAYN



Alignment 68
Sequence 1:
Sequence 2: Allergen Bet v 1.0117, Sequence: CAA07323.1
Sequence identity: 57.86 (92/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGG---K---KY-TKG----K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 69
Sequence 1:
Sequence 2: Allergen Bet v 1.0108, Sequence: CAB02155
Sequence identity: 57.86 (92/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGG---K---KY-TKG----K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 70
Sequence 1:
Sequence 2: Allergen Bet v 1.0105, Sequence: CAA54485
Sequence identity: 58.49 (93/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---ES--TSVIP-ARLFKAF-L--DNLIPKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGG---K---KY-TKG----K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 71
Sequence 1:
Sequence 2: Allergen Bet v 1.0115, Sequence: CAA96547
Sequence identity: 59.75 (95/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D-----N--YS-SVIEG----D-----S
Sequence 2 PGTIKKISFPEGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDG-SI-K---KY-TKGD---K-EQI-A--E----L--AVE-
Sequence 2 NEIKIVATPDGRSILKISNKYHTKGDHEVKAEQIKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 72
Sequence 1:
Sequence 2: Allergen Bet v 1.0102, Sequence: CAA54482
Sequence identity: 57.86 (92/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGG---K---KY-TKG----K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 73
Sequence 1:
Sequence 2: Allergen Bet v 1.0107, Sequence: CAA54489
Sequence identity: 56.60 (90/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-AR-FKAF-LD-D-L-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGG---K---KY-TKG----K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 74
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S2
Sequence identity: 55.97 (89/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IP---LFKAFVLD-DNLIPK--PQA-K--E--EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-I---D--N-TYS-S-IEGDAL--------
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKID

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-V--P-GG-I-K-T-KY-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEG

Sequence 1 YLLAHPDLYT
           YL--HP--Y-
Sequence 2 YLKDHPSEYN



Alignment 75
Sequence 1:
Sequence 2: Allergen Bet v 1.0111, Sequence: CAB02158
Sequence identity: 57.23 (91/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S-E-IEGNGG
Sequence 2 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-----FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKISFPGGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGG---K---KY-TKG----K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHSDAYN



Alignment 76
Sequence 1:
Sequence 2: Allergen Car b 1.0301, Sequence: CAB02216
Sequence identity: 57.86 (92/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFKAF-LD---LIPKV-PQA--S-E--EGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E-S--KY-K-R----D--N--YS--VIEG----D-V----
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K-T-KY-TKGD-----E-I----E---GL-K-VEA
Sequence 2 NEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKGGKERVEGLLKPVEA

Sequence 1 YLLAHPDLYT-
           YLLAH---Y--
Sequence 2 YLLAHTAEYNN



Alignment 77
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S4
Sequence identity: 56.60 (90/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS-IP---LFKAFVLD-DNLIPK--PQA-K--E--EG-GG
Sequence 2 MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITFGE-S---Y-KH-I---D-EN-TYS-S-IEGDAL-D------
Sequence 2 PGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKID

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-V--P-G--I-K-T-KY-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVSAPHG-TIIKTTSKYHTKGDVEIKEEHVKAGKEKASHLFKLIEG

Sequence 1 YLLAHPDLYT
           YL--HP--Y-
Sequence 2 YLKDHPSEYN



Alignment 78
Sequence 1:
Sequence 2: Allergen Bet v 1.0207, Sequence: ACF75030.1
Sequence identity: 57.86 (92/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           ------ES--TSVIP-ARLFKAF-L--DNLIPKV-PQAI-S-E-IEGNGG
Sequence 2 ---FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITF-E-S-FKY-K-R-D--D--N--YS-S-IEG-AL-D------
Sequence 2 PGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKIC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGGSI-K---KY-TKGD---K-E---A--EK---L--AVE-
Sequence 2 NEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKAIKEKGEALLRAVES

Sequence 1 YLLAHPDLYT
           YLL-------
Sequence 2 YLL-------



Alignment 79
Sequence 1:
Sequence 2: Allergen Cor a 1.0103, Sequence: CAA50325
Sequence identity: 56.60 (90/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TSVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E--EGNGG
Sequence 2 MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITFGE-S--KY-K-R-D--D--N-TYS--VIEGD-L-D----V-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E-I----E----L--AVE-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEINAEEIKGAKEMAEKLLRAVET

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHSAEYN



Alignment 80
Sequence 1:
Sequence 2: Allergen Can s 5.0101, Sequence: AFN42528
Sequence identity: 55.35 (88/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-ES--TS-I-PARLFKAFVLD-DNL-PK--PQA----E--EGNGG
Sequence 2 MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDAL--TDMVSV
           -GTIKKITFG----FKY-KH-I-A-D-E--TYS-S-IEGDAL--------
Sequence 2 VGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKI

Sequence 1 STEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVE
           --E-K-VAS-DGG---K---KY---GD-Q--EE---------T---K-VE
Sequence 2 THESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVKEGEKQATQMLKTVE

Sequence 1 AYLLAHPDLYT
           AYL--HP--Y-
Sequence 2 AYLKDHPEAYN



Alignment 81
Sequence 1:
Sequence 2: Allergen Mal d 1.0303, Sequence: AAK13028
Sequence identity: 56.60 (90/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TSVIPPARL--AFVLD-DNLIPK--PQA-KS-E--EG-GG
Sequence 2 MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GTIKKI-FGE-S---Y-KH-ID--D--N--Y--SVIEGDA--------S
Sequence 2 VGTIKKINFGEGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VAS---GS--KS---Y-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVAS-GSGSVIKSISHYHTKGDVEIKEEHVKAGKEKASHLFKLIEN

Sequence 1 YLLAHPDLYT
           YLL-H-D-Y-
Sequence 2 YLLEHHDAYN



Alignment 82
Sequence 1:
Sequence 2: Allergen Cor a 1.0101, Sequence: CAA50327
Sequence identity: 55.35 (88/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E--EGNGG
Sequence 2 MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITFGE-S--KY-K-R-D--D--N-TYS--VIEGD-L-D----V-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHSAEYN



Alignment 83
Sequence 1:
Sequence 2: Allergen Cor a 1.0102, Sequence: CAA50328
Sequence identity: 54.72 (87/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E--EGNGG
Sequence 2 MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITFGE-S--KY-K-R-D--D--N--YS--VIEGD-L-D----V-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 SELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHSAEYN



Alignment 84
Sequence 1:
Sequence 2: Allergen Cor a 1, Sequence: Q08407
Sequence identity: 54.72 (87/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E--EGNGG
Sequence 2 -GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITFGE-S--KY-K-R-D--D--N-TYS--VIEGD-L-D----V-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHSAEYN



Alignment 85
Sequence 1:
Sequence 2: Allergen Car b 1.0104, Sequence: CAB02207
Sequence identity: 54.09 (86/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHTDEYN



Alignment 86
Sequence 1:
Sequence 2: Allergen Car b 1.0103, Sequence: CAB02206
Sequence identity: 54.09 (86/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHTDEYN



Alignment 87
Sequence 1:
Sequence 2: Allergen Car b 1.0105, Sequence: CAB02208
Sequence identity: 54.09 (86/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH-D-Y-
Sequence 2 YLLAHTDEYN



Alignment 88
Sequence 1:
Sequence 2: Allergen Car b 1.0112, Sequence: ABZ81043
Sequence identity: 53.46 (85/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 89
Sequence 1:
Sequence 2: Allergen Car b 1.0111, Sequence: ABZ81042
Sequence identity: 53.46 (85/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 90
Sequence 1:
Sequence 2: Allergen Car b 1.0109, Sequence: ABZ81040
Sequence identity: 53.46 (85/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 91
Sequence 1:
Sequence 2: Allergen Car b 1.0110, Sequence: ABZ81041
Sequence identity: 52.83 (84/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGS--K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSVVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 92
Sequence 1:
Sequence 2: Allergen Act c 8.0101, Sequence: CAM31908
Sequence identity: 52.20 (83/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T------S--PP--L-KAF-LD-D-L-PKVLP-AIK-----EG-G-
Sequence 2 MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGC

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           -GTIK--TFGE-S--K--K-R-DA-D--N-TYS---IEGD-L-----S-S
Sequence 2 AGTIKEVTFGEGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           --IK-VA-PDGGSI-K----Y-TKGD----EE-I----EK-----KA-EA
Sequence 2 YHIKIVACPDGGSICKNRSIYTTKGDCKVSEEEIKLGKEKAAEIFKALEA

Sequence 1 YLLAHPDLYT
           YLLA-PD---
Sequence 2 YLLANPDYC-



Alignment 93
Sequence 1:
Sequence 2: Allergen Bet v 1.0119, Sequence: ABC41615.1
Sequence identity: 53.46 (85/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           ------E---TSVIP-ARLFKAF-LD-DNL-PKV-PQAI-S---IEGNGG
Sequence 2 ---FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKI-F-E---FKY-K-R-D--D--N--Y--SVIEG----D-----S
Sequence 2 PGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VA-PDGG-I-K---KY-TKG----K-EQ--A--E----L--AVE-
Sequence 2 NEIKIVATPDGGCILKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVES

Sequence 1 YLLAHPDLYT
           YLL-------
Sequence 2 YLL-------



Alignment 94
Sequence 1:
Sequence 2: Allergen Car b 1.0106, Sequence: CAB02209
Sequence identity: 53.46 (85/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 95
Sequence 1:
Sequence 2: Allergen Car b 1.0113, Sequence: ABZ81044
Sequence identity: 53.46 (85/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E---FK--K-R-D--D--N--YS--VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 96
Sequence 1:
Sequence 2: Allergen Ost c 1.0101, Sequence: ADK39021
Sequence identity: 52.83 (84/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI---E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 97
Sequence 1:
Sequence 2: Allergen Car b 1.0107, Sequence: CAB02213
Sequence identity: 53.46 (85/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N---S--VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 LELKIVAAPGGGSILKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 98
Sequence 1:
Sequence 2: Allergen Cor a 1.0104, Sequence: CAA50326
Sequence identity: 52.83 (84/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SVI--ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITFGE-S--KY-K-R-D--D--N--YS--VIEGD-L-D----V-
Sequence 2 PGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVC

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGS--K---K---KGD-----E------E----L--AVE-
Sequence 2 SELKIVAAPGGGSTLKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVET

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHSAEYN



Alignment 99
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38950
Sequence identity: 52.83 (84/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV---E---TSVIP-ARLFKAF-LD---LIPKV-PQA--S-E--EGNGG
Sequence 2 -GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIKKITF-E-S--KY-K-R----D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KG------E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 100
Sequence 1:
Sequence 2: Allergen Car b 1.0108, Sequence: CAB02215
Sequence identity: 52.20 (83/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----SV-P-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N---S--VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E---VA-P-GGSI-K---K---KGD-----E------E----L--AVE-
Sequence 2 LELTIVAAPGGGSILKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 101
Sequence 1:
Sequence 2: Allergen Car b 1.0102, Sequence: CAA47357
Sequence identity: 52.20 (83/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV---E----SVIP-ARLFK--VLD-D-LIPKV-PQAI-S-E---GNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E-S-FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KG------E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 102
Sequence 1:
Sequence 2: Allergen Act d 8.0101, Sequence: CAM31909
Sequence identity: 52.83 (84/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MG--T------S-I-----FKAFVLD-D--IPK-LP-AI------EG-GG
Sequence 2 MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
           -GTIK--TFGE-S--K--KHRID-LD-EN-TYS-S-IEG-AL----S-S-
Sequence 2 VGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISY

Sequence 1 EIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEAY
           -IK-VA-PDGG-I-K----Y--K-D-Q--EE-I-A--E---G--K-VEAY
Sequence 2 HIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEAY

Sequence 1 LLAHPDLYT
           LLA-PD---
Sequence 2 LLANPDC--



Alignment 103
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38949
Sequence identity: 50.94 (81/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV---E----SVIP-ARLFK--VLD-D-LIPKV-PQ-I-S-E---GNGG
Sequence 2 -GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           PGTIK-ITF-E---FK--K-R-D--D--N--Y---VIEGD-L-D----VS
Sequence 2 PGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-VA-P-GGSI-K---K---KG------E------E----L--AVE-
Sequence 2 HELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVES

Sequence 1 YLLAHPDLYT
           YLLAH---Y-
Sequence 2 YLLAHTAEYN



Alignment 104
Sequence 1:
Sequence 2: Allergen Sola l 4.0101, Sequence: AHC08073
Sequence identity: 49.06 (78/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-----T--I-P-RLFKA-VLD-DNL-PK-L-Q--K--E-IEG-GG
Sequence 2 MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           -G-IK---F-E----KY-KH-I---D--N-----S-IEGD-L-----S--
Sequence 2 VGSIKQMNFVEGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           --IKF-A---GG---K-TT-Y-TKGD----EE------E-I---SKAVEA
Sequence 2 YDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNVGRERIMNISKAVEA

Sequence 1 YLLAHPDLYT
           YLLA-P--Y-
Sequence 2 YLLANPSVYA



Alignment 105
Sequence 1:
Sequence 2: Allergen Rub i 1.0101, Sequence: Q0Z8U9
Sequence identity: 49.06 (78/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           ----------TSVIPP--LFKAFVLD-DNLIPK--PQA-KS-E-IEG-GG
Sequence 2 ---------YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GT-KKI--GE-----Y-KH-ID-LD--N--YS-S--EGDAL-D-----S
Sequence 2 VGTVKKIHLGEGTEHSYVKHKIDGLDKVNFVYSYSITEGDALGDKIEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -EIK-VAS--G-SI-K-T--Y--KG----KEEQ-----E---GL-K----
Sequence 2 YEIKLVASGRG-SIIKTTSHYHCKGGAEIKEEQVKDGKERAAGLFKI---

Sequence 1 YLLAHPDLYT
           ----------
Sequence 2 ----------



Alignment 106
Sequence 1:
Sequence 2: Allergen Gly m 4, Sequence: CAA42646
Sequence identity: 49.06 (78/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E----S---PA-L-KA-V-D-DN-IPK-L----KS-E--EGNGG
Sequence 2 MGVFTFEDEINSPVAPATLYKALVTDADNVIPKAL-DSFKSVENVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKITF-E----K---H-I---D--N--YS-SV--G-AL-D------
Sequence 2 PGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ---K-VA-P-GGS--K-T-KY-TKGD-------------K---L-KA-EA
Sequence 2 FDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEA

Sequence 1 YLLAHPDLYT
           YLLAHPD---
Sequence 2 YLLAHPDYN-



Alignment 107
Sequence 1:
Sequence 2: Allergen Sola l 4.0201, Sequence: NP_001275580
Sequence identity: 47.17 (75/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-----T--I-P-RLFK--VLD-D-L-PK-L----KSIE--EG-GG
Sequence 2 MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           -G-IK---F-E----KY-KH-I---D--N-----S-IEGD-L-D---S--
Sequence 2 AGSIKQMNFVEGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIA

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ---KF-A--DGG---K-TT-Y-TKGD----EE-------K---L-KA-EA
Sequence 2 YDVKFEAAGDGGCVCKTTTEYHTKGDHVVSEEEHNVGKGKAIDLFKAIEA

Sequence 1 YLLAHPDLYT
           YLLA-P--Y-
Sequence 2 YLLANPSVYA



Alignment 108
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43637
Sequence identity: 44.65 (71/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E-Q-TS---PA-L-KA---D-D---PK-LP---KS-E--EGNGG
Sequence 2 MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E----K---H-I---D--N--YS-S---G-AL--------
Sequence 2 PGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ---K----P-GGS--K----Y--KGD----E----A---K---L-KAVEA
Sequence 2 FDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKAGKAKSDSLFKAVEA

Sequence 1 YLLAHPDLYT
           YLLA-P----
Sequence 2 YLLANP----



Alignment 109
Sequence 1:
Sequence 2: Allergen Pet c PR10, Sequence: CAA67246
Sequence identity: 45.91 (73/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E---TS--P-A-LFKA--LD-D-L-P-VLP-AIK--E--EG-GG
Sequence 2 MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GT-K--T-G-AS--K--K--IDA-D-E--T-S-S-I-GD-L-----S--
Sequence 2 VGTVKLVTLGDASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSIN

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ----FV---DGG----ST----TKGD----EE-I-----------KAVEA
Sequence 2 NHLSFVPTADGGCTATSTAVFNTKGDAVVPEENIKFANDQNNLIFKAVEA

Sequence 1 YLLAHPDLYT
           YLLA------
Sequence 2 YLLAN-----



Alignment 110
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: P25985
Sequence identity: 44.03 (70/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV-T-E-Q-TS---PA-L-KA---D-D---PK-LP---KS-E--EGNGG
Sequence 2 -GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E----K---H-I---D--N--YS-S---G-AL--------
Sequence 2 PGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ---K----P-GGS--K----Y--KGD----E----A---K---L-KAVEA
Sequence 2 FDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKAGKAKSDSLFKAVEA

Sequence 1 YLLAHPDLYT
           YLLA-P----
Sequence 2 YLLANP----



Alignment 111
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43636
Sequence identity: 44.03 (70/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           M-V-T-E-Q-TS---PA-L-KA-V-D-D---PK------KS-E--EGNGG
Sequence 2 MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E----K---H-I---D--N--YS-S---G-AL-D-----S
Sequence 2 PGTIKKISFVEDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKIS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ---K----P-GGS--K---KY--KGD----E----A---K---L-K--EA
Sequence 2 IDSKLSDGPNGGSVVKLSIKYHSKGDAPPNEDELKAGKAKSDALFKVIEA

Sequence 1 YLLAHPDLYT
           YLLA-P----
Sequence 2 YLLANP----



Alignment 112
Sequence 1:
Sequence 2: Allergen Ara h 8.0101, Sequence: AAQ91847
Sequence identity: 44.03 (70/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS--PPA-L--A---D-D---PK------KS-E--EGNGG
Sequence 2 MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKK-T--E----K---H-----D--N--Y--SV--G-AL--------
Sequence 2 PGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-V--P-GGSI-K-T-KY-TKGD----EE-------K--GL--A-E-
Sequence 2 FETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEG

Sequence 1 YLLAHPDLYT
           Y-LA-P--Y-
Sequence 2 YVLANPTQY-



Alignment 113
Sequence 1:
Sequence 2: Allergen Tar o RAP, Sequence: AAB92255
Sequence identity: 38.99 (62/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           ------E---TS---P---FKAFV-D-D---PK--P---KSI--IEG-GG
Sequence 2 --MAVAEFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
           -GTIK-IT------F--SKH--DA-D--N---S----EGD-L-------T
Sequence 2 VGTIKSITYSDGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGT

Sequence 1 E-IKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ---KF--S-DGGS--K-------KGD--L--E------E------KA-E-
Sequence 2 HHLKFLPSADGGSVYKHSMVFKCKGDAKLTDENVSLMKEGLKKTFKAIET

Sequence 1 YLLAHPDLYT
           Y---HP----
Sequence 2 YVISHPEAC-



Alignment 114
Sequence 1:
Sequence 2: Allergen Ara h 8.0201, Sequence: EF436550
Sequence identity: 44.65 (71/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-E---TS--PPA-LFKA-V-D-D-L-PK--P-AI-SIE--EGNGG
Sequence 2 MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGT-KK-T--E--K--Y--H-IDA-D----TY------G---------VS
Sequence 2 PGTVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVS

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ---K--A--DGGS--K------TKGD--L--E--Q----K--G--KA-E-
Sequence 2 FKTKLEAA-DGGSKIKVSVTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEG

Sequence 1 YLLAHPDLYT
           Y-L-------
Sequence 2 YVLSN-----



Alignment 115
Sequence 1:
Sequence 2: Allergen Lyc e 4.0101, Sequence: CAA75803
Sequence identity: 40.25 (64/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-T-----T--I-P-RLFKA-VLD-DNL-PK-L-Q--K--E-IEG-GG
Sequence 2 MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVS
           -G-IK---F-E----KY-KH-I---D--N-----S-IEGD-L-----S--
Sequence 2 VGSIKQMNFVEGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           --IKF-A---GG---K-TT-Y-TKGD----EE------------------
Sequence 2 YDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNVGRRENHEYFQGCRS

Sequence 1 YLLAHPDLYT------------------
           ----------------------------
Sequence 2 IPSRESFCLRLNIDEKESGLHVRNYACT



Alignment 116
Sequence 1:
Sequence 2: Allergen Vig r 1.0101, Sequence: Q2VU97
Sequence identity: 43.40 (69/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           M-V-T---Q-TS---PA-L--A---D-DN-IPK-------S-E--EGNGG
Sequence 2 MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGTIKKI-F-E----K---H-I---D--N--YS-S---G-AL-D------
Sequence 2 PGTIKKISFVEDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKIT

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ---K-----DGGS--K-T--Y--KGD----E----A---K---L-KAVEA
Sequence 2 IDTKISDGADGGSLIKLTISYHGKGDAPPNEDELKAGKAKSDALFKAVEA

Sequence 1 YLLAHPDLYT
           YLLA-P----
Sequence 2 YLLANP----



Alignment 117
Sequence 1:
Sequence 2: Allergen Api g 1.0201, Sequence: P92918
Sequence identity: 43.40 (69/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV--------S----------F-LD-D---PKVLPQ-IKS-E--EG-GG
Sequence 2 MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GT-K----GEA------K---D--D-----Y----I-GD-L-D---SV-
Sequence 2 VGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVV

Sequence 1 TEIKFVASP-DGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVE
           -E--FV--P-DGG-I-K-TT-Y-TKGD--L-E--I----EK-----KAVE
Sequence 2 NE--FVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVE

Sequence 1 AYLLAHPDLYT
           AYLLA------
Sequence 2 AYLLANLQFLA



Alignment 118
Sequence 1:
Sequence 2: Allergen Dau c 1.0201, Sequence: AAL76932
Sequence identity: 40.88 (65/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV---E----S----------F-LD-D---PKVLPQ-IKS-E--EG-GG
Sequence 2 MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
           -GT------GEA------K---D--D-----Y----I-GD-L------S-
Sequence 2 VGTVRLVHLGEATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLE-SV

Sequence 1 EIKFVASP-DGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           ---FV--P-DGG-I-K-TT-Y-TKGD--L-E-------EK-----KAVEA
Sequence 2 VNQFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKVKEATEKSALAFKAVEA

Sequence 1 YLLAHPDLYT
           YLLA------
Sequence 2 YLLAN-----



Alignment 119
Sequence 1:
Sequence 2: Allergen Api g 1, Sequence: P49372
Sequence identity: 41.51 (66/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MGV-TH----TS-------F--FV-D-D---PK--P-A-KS-E-I-G-GG
Sequence 2 MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           PGT-K-IT------------RID----E--T---SVI-GD-L-----S--
Sequence 2 PGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIE

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -----V---DGGSI-K-T----TKGD----EE-I----E--T-L-KA-EA
Sequence 2 NHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEA

Sequence 1 YLLAHPDLYT
           YL-A------
Sequence 2 YLIAN-----



Alignment 120
Sequence 1:
Sequence 2: Allergen Dau c 1.0104, Sequence: CAB03716
Sequence identity: 40.25 (64/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MG---H----TS-------F---VLD-D--IPK--P-A-KS-----G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GT---IT--E-S-------R-DA---E--TY---VI-GD-L-----S--
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIE

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           T----V---DGGSI-K-T----TKGD----EE-I----E--T-L-KA-EA
Sequence 2 THLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADEQNTALFKAIEA

Sequence 1 YLLAHPDLYT
           YL-A------
Sequence 2 YLIAN-----



Alignment 121
Sequence 1:
Sequence 2: Allergen Dau c 1.0105, Sequence: CAB06416
Sequence identity: 40.25 (64/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MG---H----TS-------F---VLD-D--IPK--P-A-KS-E---G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GT---IT--E-S-------R-DA---E--TY---VI-GD-L-----S--
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIE

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           T----V---DGGSI-K-T----TKGD----EE-I-------T-L-KA-EA
Sequence 2 THLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEA

Sequence 1 YLLAHPDLYT
           YL-A------
Sequence 2 YLIAN-----



Alignment 122
Sequence 1:
Sequence 2: Allergen Dau c 1.0102, Sequence: BAA13604
Sequence identity: 39.62 (63/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MG---H----TS-------F---VLD-D--IPK--P-A-KS-----G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GT---IT--E-S-------R-DA---E--TY---VI-GD-L-----S--
Sequence 2 AGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIE

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           T----V---DGGSI-K-T----TKGD----EE-I-------T-L-KA-EA
Sequence 2 THMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEA

Sequence 1 YLLAHPDLYT
           YL-A------
Sequence 2 YLIAN-----



Alignment 123
Sequence 1:
Sequence 2: Allergen Dau c 1.0101, Sequence: AAB01092
Sequence identity: 39.62 (63/159)
Sequence 1 --------------MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLP
           --------------MG---H----TS-------F---VLD-D--IPK--P
Sequence 2 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP

Sequence 1 QAIKSIERIEGNGGPGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSV
           -A-KS-----G-GG-GT---IT--E-S-------R-DA---E--TY---V
Sequence 2 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV

Sequence 1 IEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQA
           I-GD-L-----S--T----V---DGGSI-K-T----TKGD----EE-I--
Sequence 2 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF

Sequence 1 TIEKITGLSKAVEAYLLAHPDLYT
           -----T-L-KA-EAYL-A------
Sequence 2 ADAQNTALFKAIEAYLIAN-----



Alignment 124
Sequence 1:
Sequence 2: Allergen Dau c 1.0103, Sequence: CAB03715
Sequence identity: 38.99 (62/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           MG---H----TS-------F---VLD-D--IPK----A-KS-E---G-GG
Sequence 2 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -GT---IT--E-S-------R-DA---E---Y---VI-GD-L-----S--
Sequence 2 AGTVRIITLPEGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIE

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           T----V---DGGSI-K-T----TKGD----EE-I-------T-L-KA-EA
Sequence 2 THMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEA

Sequence 1 YLLAHPDLYT
           YL-A------
Sequence 2 YLIAN-----



Alignment 125
Sequence 1:
Sequence 2: Allergen Que a 1.0101, Sequence: P85126
Sequence identity: 27.04 (43/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV-THESQETSVI-PARLFKA--LDSDNLI-KVLPQAIKS-E-IEGNGG
Sequence 2 -GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
           P-------------------------------------------------
Sequence 2 P-------------------------------------------------

Sequence 1 EIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEAY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LLAHPDLYT
           ---------
Sequence 2 ---------



Alignment 126
Sequence 1:
Sequence 2: Allergen Fra a 1.0101, Sequence: Q5ULZ4
Sequence identity: 33.33 (53/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           ---------------------AFVLD-DNLIPK-----------------
Sequence 2 ---------------------AFVLDADNLIPK-----------------

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVS
           -----KITFGE-S---Y-K------------------EGDAL-D------
Sequence 2 -----KITFGEGSQYGYVK-----------------VEGDALSDTLEKID

Sequence 1 TEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEA
           -E-K-V--P----I-K-T-KY-TKGD---KEE---A--EK---L-K--E-
Sequence 2 YETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEG

Sequence 1 YLLAHPDLYT
           YL--HP--Y-
Sequence 2 YLKDHPSEYN



Alignment 127
Sequence 1:
Sequence 2: Allergen Vig r 6.0101, Sequence: Q9ZWP8
Sequence identity: 23.27 (37/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSD--NLIPKVLPQAIKSIERIEGN
           ------E----------------VL--D-----PKVLP---K----IEG-
Sequence 2 ---MVKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGD

Sequence 1 GGPGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSV
           GG-GTI----F-------Y----I---D---------VIEG--L----S-
Sequence 2 GGVGTILIFNFLPEVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSY

Sequence 1 -STEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAV
           --T--K----------------Y----D---K-------------L----
Sequence 2 YKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTLMYLRR-L

Sequence 1 EAYLLAHPDLYT
           E-YL--------
Sequence 2 ERYLSNGSA---



Alignment 128
Sequence 1:
Sequence 2: Allergen Cas s 1, Sequence: Q9S8Q4
Sequence identity: 14.47 (23/159)
Sequence 1 MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGG
           -GV-THESQETSVIPPARLFKAFVL-------------------------
Sequence 2 -GVFTHESQETSVIPPARLFKAFVL-------------------------

Sequence 1 PGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVST
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKITGLSKAVEAY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LLAHPDLYT
           ---------
Sequence 2 ---------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.