The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Lol p 5

Sequence Q40237

Full FASTA alignment

Sequence name:
Query sequence:
MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Lol p 5Q40237Go!339388.81.4e-109
2Phl p 5.0101CAA52753Go!312263.75.6e-72
3Poa p 5P22285Go!333261.72.4e-71
4Poa p 5P22286Go!307242.81.1e-65
5Phl p 5.0109CAD87529Go!284237.24.8e-64
6Phl p 5.0102Q40962Go!286232.21.5e-62
7Phl p 5.0107AAC16527Go!276229.51.0e-61
8Phl p 5.0106AAC16526Go!276226.96.2e-61
9Phl p 5.0108AAC16528Go!276225.91.2e-60
10Phl p 5.0105AAC16525Go!276223.56.2e-60
11Phl p 5.0104CAB05372Go!276221.13.3e-59
12Poa p 5P22284Go!373219.01.9e-58
13Phl p 5AAK25823Go!275202.11.8e-53
14Dac g 5.02AAK62277Go!265198.22.6e-52
15Hol l 5.0101CAB10765Go!264197.44.3e-52
16Dac g 5.01AAK62276Go!265195.02.3e-51
17Lol p 5AAD20386Go!301194.92.8e-51
18Sec c 5.0101CBG76811Go!292185.32.2e-48
19Poa p 5.0101Q9FPR0Go!303176.88.1e-46
20Hol l 5.0201CAB10766Go!240172.21.5e-44
21Pha a 5P56164Go!320157.26.7e-40
22Hor v 5.0101U57845Go!313147.65.2e-37
23Phl p 5.0201Q40963Go!284147.07.1e-37
24Phl p 5.0202CAB05371Go!281144.73.3e-36
25Phl p 5.0204AAC25996Go!265144.53.6e-36
26Phl p 5.02059249029Go!265142.51.5e-35
27Pha a 5P56167Go!175125.11.7e-30
28Pha a 5P56165Go!305125.52.2e-30
29Lol p 5Q40240Go!308114.83.7e-27
30Pha a 5P56166Go!29497.27.0e-22
31Phl p 6.0101P43215Go!13278.61.3e-16
32Phl p 6.0102CAA76556Go!13877.52.9e-16

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40237
Sequence identity: 100.00 (339/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
Sequence 2 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
Sequence 2 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
Sequence 2 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
Sequence 2 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
Sequence 2 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
Sequence 2 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
Sequence 2 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV



Alignment 2
Sequence 1:
Sequence 2: Allergen Phl p 5.0101, Sequence: CAA52753
Sequence identity: 69.91 (237/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAV---TVALFLAVALVAGPAASYAAD-GY-PATPA-PAA-----TPATP
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADLGYGPATPAAPAA---GYTPATP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           A-PA---A-P-GKATTEEQKLIEKINAGFKAA-AAAA-V-PADKY-TFV-
Sequence 2 AAPAE--AAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVA

Sequence 1 TFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGATP
           TFG-A-NKAF-EGL-----G-A--S-K--LTSKLDAA-KLAY--A-GATP
Sequence 2 TFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP

Sequence 1 EAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKV
           EAKYDAYVATL-EALR-IAGTLEVHAVKPAAEEVKV--IPA-E-Q-I-KV
Sequence 2 EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKV

Sequence 1 DAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVA
           DAA---AATAANAAPANDKFTVFE--FN-AIK-S-G-AY-SYKFIP-L-A
Sequence 2 DAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEA

Sequence 1 AVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPT
           AVKQAYAA--ATAPEVKYTV-ETALKKA-TAMSEA-K-A-PAAAATAT-T
Sequence 2 AVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATAT

Sequence 1 PAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           -A---AT----AA------------------------------
Sequence 2 AAVGAATGAATAATGGYKV------------------------



Alignment 3
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22285
Sequence identity: 73.16 (248/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGY-APATPATPAAPATAATPAT
           MAV---TVALFLAVALVAGPAASYAAD-GY-APAT-ATPA-PA--A---T
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAAPAAGYT

Sequence 1 PATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFV
           PA-PA---A-P--KATT-EQKLIEKINAGFKAAVAAAA-VP--DKYKTFV
Sequence 2 PAAPA--GAAP--KATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFV

Sequence 1 ETFGTATNKAFVEGLAS---GYADQSKNQ-LTSKLDAALKLAYEAAQGAT
           -TFGTA-NKAF-E-L-----G-A--S-N--LTSKLDAA-KLAY--A-GAT
Sequence 2 ATFGTASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGAT

Sequence 1 PEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDK
           PEAKYDAYVATL-EALR-IAGTLEVHAVKPA-EEVK--AIPA-E-Q-IDK
Sequence 2 PEAKYDAYVATLSEALRIIAGTLEVHAVKPAGEEVK--AIPAGELQVIDK

Sequence 1 VDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLV
           VDAA---AATAANAAPANDKFTVFE--FN-AIK-S-G-AY-SYKFIP-L-
Sequence 2 VDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALE

Sequence 1 AAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATP
           AAVKQ-YAA--ATAP-VKYTV-ETALKKA-TAMS-A-K-A-PAAA-TAT-
Sequence 2 AAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTATA

Sequence 1 TPAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           T-A---AT----AA---AT-AAA----T-AA---TP-A-GGYKV
Sequence 2 TGAVGAATGAVGAATGAAT-AAAGGYKTGAA---TPTA-GGYKV



Alignment 4
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22286
Sequence identity: 66.67 (226/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAVQK-TVALFL-VALV-GPAASYAAD--Y----PATPAAPA---TPA-P
Sequence 2 MAVQKYTVALFL-VALVVGPAASYAADLSYG--APATPAAPAAGYTPAAP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           A------A-P--KATT-EQK-IEKIN-GFKAAVAAA--VP-A-KYKTFV-
Sequence 2 A-----GAAP--KATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVA

Sequence 1 TFGTATNKAFVEGLAS---GYA-DQSKNQLTSKLDAALKLAYEAAQGATP
           TFG-A-NKAF-E-L-----G-A-D-SK--LTSKLDAA-KLAY--A-GATP
Sequence 2 TFGAASNKAFAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATP

Sequence 1 EAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKV
           EAKYD-YVATL-EALR-IAGTLEVH-VKPAAEEVK--A-PA-E-Q-IDKV
Sequence 2 EAKYDDYVATLSEALRIIAGTLEVHGVKPAAEEVK--ATPAGELQVIDKV

Sequence 1 DAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVA
           DAA---AATAANAAPANDKFTVFE--FN-AIK-S-G-AY-SYKFIP-L-A
Sequence 2 DAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEA

Sequence 1 AVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPT
           AVKQ-YAA--ATAP-VKYTV-ETALKKA-TAMS-A-K-A-PAAAAT-T-T
Sequence 2 AVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAATGTAT

Sequence 1 PA--AATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           -A--AAT--AT-AA-------------------------------
Sequence 2 AAVGAATGAATAAAGGYKV--------------------------



Alignment 5
Sequence 1:
Sequence 2: Allergen Phl p 5.0109, Sequence: CAD87529
Sequence identity: 63.13 (214/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------AD-GY-PATPA-PAA-----TPA-P
Sequence 2 -------------------------ADLGYGPATPAAPAA---GYTPAAP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           A------A-P-GKATTEEQKLIEKINAGFKAA-AAAA-VPPADKY-TFV-
Sequence 2 A-----GAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVA

Sequence 1 TFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGATP
           TFG-A-NKAF-EGL-----G-A--S-K--LTSKLDAA-KLAY--A-GATP
Sequence 2 TFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP

Sequence 1 EAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKV
           EAKYDAYVATL-EALR-IAGTLEVHAVKPAAEEVKV--IPA-E-Q-I-KV
Sequence 2 EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKV

Sequence 1 DAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVA
           DAA---AATAANAAPANDKFTVFE--FNNAIK-S-G-AY-SYKFIP-L-A
Sequence 2 DAAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEA

Sequence 1 AVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPT
           AVKQAYAA--ATAPEVKYTV-ETALKKA-TAMSEA-K-A-PAAAATAT-T
Sequence 2 AVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATAT

Sequence 1 PAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           -A---AT----AA------------------------------
Sequence 2 SAVGAATGAATAATGGYKV------------------------



Alignment 6
Sequence 1:
Sequence 2: Allergen Phl p 5.0102, Sequence: Q40962
Sequence identity: 62.24 (211/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------AD-GY-PATPA-PAA-----TPATP
Sequence 2 -------------------------ADLGYGPATPAAPAA---GYTPATP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           A-PA---A---GKATTEEQKLIEKINAGFKAA-A-A-V--PADKY-TFV-
Sequence 2 AAPAGADA--AGKATTEEQKLIEKINAGFKAALAGAGV-QPADKYRTFVA

Sequence 1 TFGTATNKAFVEGLA---SGYADQS-KNQLTSKLDAALKLAYEAAQGATP
           TFG-A-NKAF-EGL-----G-A--S-K--LTSKLDAA-KLAY--A-GATP
Sequence 2 TFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP

Sequence 1 EAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKV
           EAKYDAYVATL-EALR-IAGTLEVHAVKPAAEEVKV--IPA-E-Q-I-KV
Sequence 2 EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKV

Sequence 1 DAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVA
           DAA---AATAANAAPANDKFTVFE--FN--IK-S-G-AY-SYKFIP-L-A
Sequence 2 DAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEA

Sequence 1 AVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPT
           AVKQAYAA--ATAPEVKYTV-ETALKKA-TAMSEA-K-A-PAAAATAT-T
Sequence 2 AVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATAT

Sequence 1 PAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           -A---AT----AA------------------------------
Sequence 2 AAVGAATGAATAATGGYKV------------------------



Alignment 7
Sequence 1:
Sequence 2: Allergen Phl p 5.0107, Sequence: AAC16527
Sequence identity: 60.77 (206/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------------------------------P
Sequence 2 ------------------------------------------ADLGYGGP

Sequence 1 ATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFV
           ATPA-PA-A-P-GKATTEEQKLIEKIN-GFKAA-AAAA-VPPADKYKTFV
Sequence 2 ATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV

Sequence 1 ETFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGAT
           -TFG-A-NKAF-EGL-----G-A--S-K--LTSKLDAA-KLAY--A-GAT
Sequence 2 ATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGAT

Sequence 1 PEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDK
           PEAKYDAYVATL-EALR-IAGTLEVHAVKPAAEEVKV--IPA-E-Q-I-K
Sequence 2 PEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEK

Sequence 1 VDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLV
           VD-A---AATAANAAPANDKFTVFE--FNNAIK-S-G-AY-SYKFIP-L-
Sequence 2 VDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALE

Sequence 1 AAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATP
           AAVKQAYAA--ATAPEVKYTV-ETALKKA-TAMSEA-K-A-PAAAATAT-
Sequence 2 AAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATA

Sequence 1 TPAAATAT-ATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           T-A---AT-AT-AAA------------------------------
Sequence 2 TSAVGAATGATTAAAGGYKV-------------------------



Alignment 8
Sequence 1:
Sequence 2: Allergen Phl p 5.0106, Sequence: AAC16526
Sequence identity: 59.29 (201/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------------------------------P
Sequence 2 ------------------------------------------ADLGYGGP

Sequence 1 ATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFV
           ATPA-PA-A-P-GKATTEEQKLIEKIN-GFKAA-AAAA-VPPADKYKTFV
Sequence 2 ATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV

Sequence 1 ETFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGAT
           -TFG-A-NKAF-EGL-----G-A--S-K--LTSKLDAA-KLAY--A-GAT
Sequence 2 ATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGAT

Sequence 1 PEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDK
           PEAKYDAYVATL-EALR-IAGTLEVHAVKPAAEEVKV--IPA-E-Q-I-K
Sequence 2 PEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEK

Sequence 1 VDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLV
           VD-A---AATAANAAPANDKFTVFE--FNNAIK-S-G-AY-SYKFIP-L-
Sequence 2 VDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALE

Sequence 1 AAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATP
           AAVKQAYAA--ATAPEVKYTV-ETALKKA-TAMSEA-K-A-PA--ATAT-
Sequence 2 AAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPATEATATA

Sequence 1 TPAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           T-A---AT----AA------------------------------
Sequence 2 TAAVGAATGAATAATGGYKV------------------------



Alignment 9
Sequence 1:
Sequence 2: Allergen Phl p 5.0108, Sequence: AAC16528
Sequence identity: 59.29 (201/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------------------------------P
Sequence 2 ------------------------------------------ADLGYGGP

Sequence 1 ATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFV
           ATPA-PA-A-P-GKATTEEQKLIEKIN-GFKAA-AAAA-VPPADKYKTFV
Sequence 2 ATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV

Sequence 1 ETFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGAT
           -TFG-A-NKAF-EGL-----G-A--S-K--LTSKLDAA-KLAY--A-GAT
Sequence 2 ATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGAT

Sequence 1 PEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDK
           PEAKYDAYVATL-EALR-IAGTLEVHAVKPAAEEVKV--IPA-E-Q-I-K
Sequence 2 PEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEK

Sequence 1 VDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLV
           VD-A---AATAANAAPANDKFTVFE--FNNAIK-S-G-AY-SYKFIP-L-
Sequence 2 VDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALE

Sequence 1 AAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATP
           AAVKQAYAA--ATAPEVKYTV-ETALKKA-TAMSEA-K-A-PA--ATAT-
Sequence 2 AAVKQAYAATVATAPEVKYTVFETALKKAFTAMSEAQKAAKPATEATATA

Sequence 1 TPAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           T-A---AT----AA------------------------------
Sequence 2 TAAVGAATGAATAATGGYKV------------------------



Alignment 10
Sequence 1:
Sequence 2: Allergen Phl p 5.0105, Sequence: AAC16525
Sequence identity: 58.70 (199/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------------------------------P
Sequence 2 ------------------------------------------ADLGYGGP

Sequence 1 ATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFV
           ATPA-PA-A-P-GKATTEEQKLIEKIN-GFKAA-AAAA-VPPADKYKTFV
Sequence 2 ATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV

Sequence 1 ETFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGAT
           -TFG-A-NKAF-EGL-----G-A--S-K--LTSKLDAA-KLAY--A-GAT
Sequence 2 ATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGAT

Sequence 1 PEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDK
           PEA-YDAYVATL-EALR-IAGTLEVHAVKPAAEEVKV--IPA-E-Q-I-K
Sequence 2 PEAEYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEK

Sequence 1 VDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLV
           VD-A---AATAANAAPANDKFTVFE--FNNAIK-S-G-AY-SYKFIP-L-
Sequence 2 VDSALKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALE

Sequence 1 AAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATP
           AAVKQAYAA--ATAPEVKYTV-ETALKKA-TA-SEA-K-A-PA--ATAT-
Sequence 2 AAVKQAYAATVATAPEVKYTVFETALKKAITATSEAQKAAKPATEATATA

Sequence 1 TPAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           T-A---AT----AA------------------------------
Sequence 2 TAAVGAATGAATAATGGYKV------------------------



Alignment 11
Sequence 1:
Sequence 2: Allergen Phl p 5.0104, Sequence: CAB05372
Sequence identity: 58.11 (197/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------------------------------P
Sequence 2 ------------------------------------------ADLGYGGP

Sequence 1 ATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFV
           ATPA-PA-A-P-GKATTEEQKLIEKIN-GFKAA-AAAA-VPPADKYKTFV
Sequence 2 ATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV

Sequence 1 ETFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGAT
           -TFG-A-NKAF-EGL-----G-A--S-K--LTSKL-AA-KLAY----GAT
Sequence 2 ATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGAT

Sequence 1 PEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDK
           PEAKYDAYVATL-EALR-IAGTLEVHAVKPAAEEVKV--IPA-E-Q-I-K
Sequence 2 PEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEK

Sequence 1 VDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLV
           VD-A---AATAANAA-ANDKFTVFE--FN-AIK-S-G-AY-SYKFIP-L-
Sequence 2 VDSALKVAATAANAAAANDKFTVFEAAFNHAIKASTGGAYESYKFIPALE

Sequence 1 AAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATP
           AAVKQAYAA--ATAPEVKYTV-ETALKKA-TAMSEA-K-A-PA--ATAT-
Sequence 2 AAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPATEATATA

Sequence 1 TPAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           T-A---AT----AA------------------------------
Sequence 2 TAAVGAATGAATAATGGYKV------------------------



Alignment 12
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22284
Sequence identity: 60.77 (206/339)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSGPDAVGFAKK

Sequence 1 --------MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPAT--PAA
           ------------K-----------V----------AG---A-PA---PA-
Sequence 2 LDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKAPPASKFPAK

Sequence 1 PATAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVP
           PA------TPA-PA---A-P--KATT-EQKLIEKIN-GFKAAVAAAA-VP
Sequence 2 PAPKVAAYTPAAPA--GAAP--KATTDEQKLIEKINVGFKAAVAAAAGVP

Sequence 1 PADKYKTFVETFGTATNKAFVEGLAS---GYA-DQSKNQLTSKLDAALKL
           -A-KYKTFV-TFG-A-NKAF-E-L-----G-A---SK--LTSKLDAA-KL
Sequence 2 AASKYKTFVATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKL

Sequence 1 AYEAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIP
           AY--A-GATPEAKYDAYVATL-EALR-IAGTLEVH-VKPAAEEVK--AIP
Sequence 2 AYKSAEGATPEAKYDAYVATLSEALRIIAGTLEVHGVKPAAEEVK--AIP

Sequence 1 AAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYD
           A-E-Q-IDKVDAA---AATAANAAPANDKFTVFE--FN-AIK-S-G-AY-
Sequence 2 AGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQ

Sequence 1 SYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEAT
           SYKFIP-L-AAVKQ-YAA--ATAP-VKYTV-ETALKKA-TAMS-A-K-A-
Sequence 2 SYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAK

Sequence 1 PAAAATATPTPA--AATATATPAAAYATATPAAATATATPAAATATPAAA
           PAAA-T-T-T-A--AAT--AT-AA--------------------------
Sequence 2 PAAAVTGTATSAVGAATGAATAAAGGYKV---------------------

Sequence 1 GGYKV
           -----
Sequence 2 -----



Alignment 13
Sequence 1:
Sequence 2: Allergen Phl p 5, Sequence: AAK25823
Sequence identity: 54.28 (184/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           ------------------------------------------TA--P--P
Sequence 2 --------------------------------------PISVTAPPPQLP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           --PATP---P---------KL--------KA-----A-VPPADKY-TFV-
Sequence 2 RPPATPPPPPPPQLGASPYKL----GPSPKARSERPAIVPPADKYRTFVA

Sequence 1 TFGTATNKAFVEGLAS----GYADQSKNQLTSKLDAALKLAYEAAQGATP
           TFG-A-NKAF-EGL------G----SK--LTSKLDAA-KLAY--A-GATP
Sequence 2 TFGAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAYKTAEGATP

Sequence 1 EAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKV
           EAKYDAYVATL-EALR-IAGTLEVHAVKPAAEEVKV--IPA-E-Q-I-KV
Sequence 2 EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKV

Sequence 1 DAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVA
           DAA---AATAANAAPANDKFTVFE--FNNAIK---G-AY-SYKFIP-L-A
Sequence 2 DAAFKVAATAANAAPANDKFTVFEAAFNNAIKAGTGGAYESYKFIPALEA

Sequence 1 AVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPT
           AVKQAYAA--ATAPEVKYTV-ETALKKA-TAMSEA-K-A-PAAAATAT-T
Sequence 2 AVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATAT

Sequence 1 PAAATAT-ATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           -A----T-AT-AAA------------------------------
Sequence 2 SAVGAPTGATTAAAGGYKV-------------------------



Alignment 14
Sequence 1:
Sequence 2: Allergen Dac g 5.02, Sequence: AAK62277
Sequence identity: 52.51 (178/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------------------------A----TP
Sequence 2 -------------------------------------------ADAGYTP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           A--ATPAA---GKA-TEEQKLIE--NAGFKAAVAAA---PPADK-KTF--
Sequence 2 AAAATPAAA-GGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           TF-TA--KA-----A-------------KLDAA---AY--A-G-TPEAKY
Sequence 2 TF-TAACKANIAAAATKVP-----LFVAKLDAAYAVAYKTAAGPTPEAKY

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           DA-VA-LTEALRVIAG-LEVHAVKPAAEEV----IPA-E-Q--DK-DAAY
Sequence 2 DAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAY

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAANAAPANDKFTVFE--FN-AIK-S-G-AY-SYKFIPTL-AAVKQ
Sequence 2 KIAATAANAAPANDKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           AYAA--A-APEVKY-V-E-AL-KA-TAMSEA-K-ATPAAAAT---T-AA-
Sequence 2 AYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAAATGAATAAAS

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           -AT----AA------------------------------
Sequence 2 AATGAATAAAGGYKV------------------------



Alignment 15
Sequence 1:
Sequence 2: Allergen Hol l 5.0101, Sequence: CAB10765
Sequence identity: 51.33 (174/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           --------------------------------------------------
Sequence 2 ----------------------------------------------ADAG

Sequence 1 ATPATPAAVPSG-KATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFV
           -TPA-PAA---G-KATT-EQKL-E--NAGFK-AVAAAA-VPPADKYKTF-
Sequence 2 YTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFE

Sequence 1 ETFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAK
           --F-TA--KA-----A----------L---L-AA---AY-AAQGATPEAK
Sequence 2 AAF-TASSKASIAAAAT-----KAPGLIPQLNAATNTAYAAAQGATPEAK

Sequence 1 YDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAA
           YDA-V-TLTEALRVIAG-LEVHAVKPA-EEV----IPA-E-Q--DK-DAA
Sequence 2 YDAFVTTLTEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAA

Sequence 1 YRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVK
           -R-AATAANAAP-NDKFTVFE--FN-AIK-S-G-AY--YKFIP-L--AVK
Sequence 2 FRIAATAANAAPVNDKFTVFEGAFNKAIKESTGGAYEAYKFIPSLETAVK

Sequence 1 QAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAA
           QAYAA--ATAPEVKYTV-ETALKKA-TAMSEA-KEA-P-AAAT---T-AA
Sequence 2 QAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAAATGAATAAA

Sequence 1 ATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           --A-----AA------------------------------
Sequence 2 GVAAGAATAAAGGYKV------------------------



Alignment 16
Sequence 1:
Sequence 2: Allergen Dac g 5.01, Sequence: AAK62276
Sequence identity: 51.62 (175/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------------------------A----TP
Sequence 2 -------------------------------------------ADAGYTP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           A--ATPA----GKA-TEEQ-LIE--NAGFKAAVAAA---PPADK-KTF--
Sequence 2 AAAATPATA-GGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           TF-TA--KA-----A-------------KLDAA---AY--A-G-TPEAKY
Sequence 2 TF-TAACKANIAAAATKVP-----LFVAKLDAAYAVAYKTATGPTPEAKY

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           DA-VA-LTEALRVIAG-LEVHAVKPAAEEV----IPA-E-Q--DK-DAAY
Sequence 2 DAFVAALTEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAY

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAANAAPANDKFTVFE--FN-AIK-S-G-AY-SYKFIPTL-AAVKQ
Sequence 2 KIAATAANAAPANDKFTVFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           AYAA--A-APEVKY-V-E-AL-KA-TAMSEA-K-ATPAA-AT---T-AA-
Sequence 2 AYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAVATGAATAAAS

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           -AT----AA------------------------------
Sequence 2 AATGAATAAAGGYKV------------------------



Alignment 17
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: AAD20386
Sequence identity: 59.29 (201/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAVQK-TVALFLAVALVAGPAASYAADAGY-PA----------AATPATP
Sequence 2 MAVQKYTVALFLAVALVAGPAASYAADAGYTPAA---------AATPATP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           A--ATPAA---GKATT-EQKL-E--NAGFKAAVAAAA--PPADK-K-F--
Sequence 2 A--ATPAAA-GGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           -F----------GL----A------L--KLD-A---AY-AA-GATPEAKY
Sequence 2 AFSESS-----KGLLATSAAKAPG-LIPKLDTAYDVAYKAAEGATPEAKY

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           DA-V--LTEALRVIAG-LEVHAVKPA-EEV----IP--E-Q--DK-DAA-
Sequence 2 DAFVTALTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAANAAP-NDKFTVFE--FN-A-----G-AY--YKFIP-L-AAVKQ
Sequence 2 KIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           AYAA--A-APEVKY-V-E-AL-KA-TAM--A-K---PAAAA-AT-----A
Sequence 2 AYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAA-ATGAATVA

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           T--AT-AA--ATA------A-------------------
Sequence 2 TGAATAAAGAATAAAGGYKA-------------------



Alignment 18
Sequence 1:
Sequence 2: Allergen Sec c 5.0101, Sequence: CBG76811
Sequence identity: 53.69 (182/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAVQ--TVALFLAVALVAGPA-SY-----YAPA-P-T---P---------
Sequence 2 MAVQQYTVALFLAVALVAGPAVSYGT---YAPAAPGTQ--P---------

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ------------KATT-EQKL-E-IN-GFKAAV-AAA-V-PADKYKTF--
Sequence 2 ------------KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQT

Sequence 1 TFGTATNKAFVEGLASGYADQ------SKNQLTSKLDAALKLAYEAAQGA
           TF----NKAF---L------Q------S---L---L----KLAY--A-GA
Sequence 2 TFIKGSNKAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGA

Sequence 1 TPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLID
           TPE-KYD-YVA-LTE-LRVI-G--EVHAVKPA-EEVK----PA------D
Sequence 2 TPETKYDTYVASLTESLRVISGAFEVHAVKPASEEVK--GVPAPQLKVVD

Sequence 1 KVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTL
           --DAAYRTAATAANAAP-NDKF-VFE--FN-AIK---G-AY-SY-F-P-L
Sequence 2 QIDAAYRTAATAANAAPTNDKFNVFESSFNKAIKENTGGAYASYTFVPAL

Sequence 1 VAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATAT
           --AVKQAYAA--A-APEVKY-V---AL-KA--AM-EAEK-A-PAAAA-AT
Sequence 2 ESAVKQAYAATVASAPEVKYAVFQAALSKAINAMVEAEKDAKPAAAAAAT

Sequence 1 PTPAAATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           -T--A----A--AAA------------------------------
Sequence 2 ATATATVGAAAGAAAGGYKA-------------------------



Alignment 19
Sequence 1:
Sequence 2: Allergen Poa p 5.0101, Sequence: Q9FPR0
Sequence identity: 57.23 (194/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAVQK-TVALFL-VALVAGPAASYAADAGYAPATPA---A-A---TP---
Sequence 2 MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITP---

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ---------------T-EQKL-E-IN-GFKAAVAAAA--PPADK-KTF--
Sequence 2 ---------------TQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           -F--A---A----L----A-----------DA-----Y-AA-GATPEAK-
Sequence 2 AF-SASVEASAAKLNAAQAPGFVSHVAATSDAT----YKAAVGATPEAKF

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           D--VA--TEALR-IAG-L-VHAVKP--EE-----IPA-E-Q-IDK-DAA-
Sequence 2 DSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAANAAPANDKFTVFE--FNNAIK-S-G-AYD-YK-IP-L-AAVKQ
Sequence 2 KVAATAANAAPANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           AYAA--A-APEVK--V---AL-KA-TAM-E--K---P-A-A---------
Sequence 2 AYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPVAGA---------

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           ---AT-AA--ATA---AAT--A--A---AT---AGGYKV
Sequence 2 ---ATVAAGAATAATGAATGAAGAATGAAT-VSAGGYKV



Alignment 20
Sequence 1:
Sequence 2: Allergen Hol l 5.0201, Sequence: CAB10766
Sequence identity: 44.84 (152/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ------------------QKL-E--NA-FKAAVAAAA-VPPADKYKTF--
Sequence 2 ------------------QKLLEDVNASFKAAVAAAAKVPPADKYKTFLR

Sequence 1 TFGTATNKAFVEGLASGYADQSKN-QLTSKLDAALKLAYEAAQGATPEAK
           -F-T-------E------A---K---L-SKL--A---A--A--G-T-EAK
Sequence 2 AF-TVLDRGSTE---QSKAEETKMPELSSKLVDAYMAAFKASTGGTQEAK

Sequence 1 YDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAA
           YDA-V-TLTEALRVIAG-LEVHAVKPA-EEV----IPA---Q--DK-DA-
Sequence 2 YDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQVVDKIDAS

Sequence 1 YRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVK
           ---AATAANAAPANDKFTVFE--FN-A-K-S-G-AY-SYKFIP-L-AAVK
Sequence 2 FKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVK

Sequence 1 QAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAA
           QAYA---A-APEVKY-V-E-AL-KA-TAMS-A-K-A-PAAAAT---T-AA
Sequence 2 QAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAA

Sequence 1 ATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           --AT-T-A--Y-----------------------------
Sequence 2 GAAT-TAAGGYKV---------------------------



Alignment 21
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56164
Sequence identity: 49.85 (169/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAVQK-T-ALFLAVALVAGPAA---------P--P----------TP-TP
Sequence 2 MAVQKYTMALFLAVALVAGPAA---------PTPP----------TPRTP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           --P--P------KAT-------E-INA-------A---VPPADK-KTF--
Sequence 2 --PLLPPPRARDKATLTSRS-VEDINAASRRPWWAS--VPPADKFKTFAD

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           ------N-A-V---A---------QL--KLDAA---AYEAA-G-TPEAKY
Sequence 2 HVLCVPN-ADVTSAAT-----KAPQLKAKLDAAYRVAYEAAEGSTPEAKY

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           DA--A-LTEALRVIAG--EVHAVKPA-EEV---A-P--E-Q--DK-DAA-
Sequence 2 DAFIAALTEALRVIAGAFEVHAVKPATEEVV--ADPVGELQIVDKIDAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAAN-APANDKFTVFE--FN-AIK-S---AY--YKFIP-L-AAVKQ
Sequence 2 KIAATAANSAPANDKFTVFEGAFNKAIKESTAGAYETYKFIPSLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPT-PAA
           AY-A--A-APEVKY-V-E--L-KA-TAMSEA-K-A-P----------P-A
Sequence 2 AYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPPLSPQPPQVLPLA

Sequence 1 ATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV----------
           A---AT-AAA----------------------------------------
Sequence 2 AGGAATVAAASDVRVCRSHGTLQDACLLRCRGGCQPVVWRGGSHRARGGY

Sequence 1 --
           --
Sequence 2 KV



Alignment 22
Sequence 1:
Sequence 2: Allergen Hor v 5.0101, Sequence: U57845
Sequence identity: 41.30 (140/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -----------------------------------------A--------
Sequence 2 -MANSGREHSAVPRRRNLVALVPRHGCYAEFSLYVCVGNINAPFPVFNRT

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ---A------------------------F----------------K----
Sequence 2 TFIANAGIEAELEPHFLLLLFTFSSSSSFFTLLKTMIHFTDRSDNKNKAM

Sequence 1 TFGTATNKAFVE---GLASGY-ADQSKN--QLTSKLDAALKLAYEAAQGA
           --G----KAF-E---G-A-G--A-QS-----L-S-L----KLAY--AQGA
Sequence 2 MRGREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGA

Sequence 1 TPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLID
           TPEAKYDAYVATLTE-LRVI-GTLEVH-VKPAAEEVK----PA-E---ID
Sequence 2 TPEAKYDAYVATLTESLRVISGTLEVHSVKPAAEEVK--GVPAGELKAID

Sequence 1 KVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTL
           -VDAA-RTAATAA-AAPANDKFTVFE-----------G-AY-SYKFIP-L
Sequence 2 QVDAAFRTAATAADAAPANDKFTVFESLQQGPSRKPRGGAYESYKFIPAL

Sequence 1 VAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATAT
           -AAVKQAYAA--A-APEVK-TV--TAL-KA--AM--A-K-A-PAAAATAT
Sequence 2 EAAVKQAYAATVAAAPEVKFTVFQTALSKAINAMTQAGKVAKPAAAATAT

Sequence 1 PTPAA-ATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           -T-AA-A-ATA-----------------------------------
Sequence 2 ATVAAGAAATAGNYKV------------------------------



Alignment 23
Sequence 1:
Sequence 2: Allergen Phl p 5.0201, Sequence: Q40963
Sequence identity: 54.28 (184/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           --------A---------GP--SY-ADAGYAPATPA---A-A--------
Sequence 2 ------AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAA--------

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           -----------GKATTEEQKLIE-IN-GFKAAVAAAA-VP-ADK-KTF--
Sequence 2 -----------GKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           -F-T---KA-----A-G--------L--KLDAA---AY-AA-GATPEAK-
Sequence 2 AF-TSSSKA-AAAKAPG--------LVPKLDAAYSVAYKAAVGATPEAKF

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           D--VA-LTEALRVIAG-LEVHAVKP--EE-----IPA-E-Q-IDK-DAA-
Sequence 2 DSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAA--APA-DKFTVFE--FN-AIK-S-G-AYD-YK-IP-L-AAVKQ
Sequence 2 KVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           AYAA--A-AP-VKY-V-E-AL-KA-TAMSE--K---PA--A---------
Sequence 2 AYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGA---------

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           ---AT-AA--AT----AA---AT---------AAGGYKV
Sequence 2 ---ATVAAGAATTAAGAASGAAT--------VAAGGYKV



Alignment 24
Sequence 1:
Sequence 2: Allergen Phl p 5.0202, Sequence: CAB05371
Sequence identity: 53.98 (183/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           ------------------GP--SYAADAGYAPATPA---A-A--------
Sequence 2 ---------AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEA--------

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           -----------GKATTEEQKLIE-IN-GFKAAVAAAA-VP--DK-KTF--
Sequence 2 -----------GKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           -F------A-----A-G--------L--KLDAA---AY-AA-GATPEAK-
Sequence 2 AFTSSSKAATAK--APG--------LVPKLDAAYSVAYKAAVGATPEAKF

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           D--VA-LTEALRVIAG-LEVHAVKP--EE-----IPA-E-Q-IDK-DAA-
Sequence 2 DSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAA--APA-DKFTVFE--FN-AIK-S-G-AYD-YK-IP-L-AAVKQ
Sequence 2 KVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           AYAA--A-AP-VKY-V-E-AL-KA-TAMSE--K---PA--A---------
Sequence 2 AYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGA---------

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           ---AT-AA--AT--------TAT-AA--A---AAGGYKV
Sequence 2 ---ATVAAGAAT--------TATGAASGAATVAAGGYKV



Alignment 25
Sequence 1:
Sequence 2: Allergen Phl p 5.0204, Sequence: AAC25996
Sequence identity: 52.21 (177/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------ADAGYAPATPA---A-A--------
Sequence 2 -------------------------ADAGYAPATPAAAGAEA--------

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           -----------GKATTEEQKLIE-IN-GFKAAVAAAA-VP-ADK-KTF--
Sequence 2 -----------GKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           -F------A-----A-G--------L--KLDAA---AY-AA-GATPEAK-
Sequence 2 AFTSSSKAATAK--APG--------LVPKLDAAYSVAYKAAVGATPEAKF

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           D--VA-LTEALRVIAG-LEVHAVKP--EE-----IPA-E-Q-IDK-DAA-
Sequence 2 DSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAA--APA-DKFTVFE--FN-AIK-S-G-AYD-YK-IP-L-AAVKQ
Sequence 2 KVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           AYAA--A-AP-VKY-V-E-AL-KA-TAMSE--K---PA--A---------
Sequence 2 AYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGA---------

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           ---AT-AA--AT----AA---AT---------AAGGYKV
Sequence 2 ---ATVAAGAATTAAGAASGAAT--------VAAGGYKV



Alignment 26
Sequence 1:
Sequence 2: Allergen Phl p 5.0205, Sequence: 9249029
Sequence identity: 51.62 (175/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -------------------------ADAGYAPATPA---A-A--------
Sequence 2 -------------------------ADAGYAPATPAAAGAEA--------

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           -----------GKATTEEQKLIE-IN-GF-AAVAAAA-VP-ADK-KTF--
Sequence 2 -----------GKATTEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           -F------A-----A-G--------L--KLDAA---AY-AA-GATPEAK-
Sequence 2 AFTSSSKAATAK--APG--------LVPKLDAAYSVAYKAAVGATPEAKF

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           D--VA-LTEALRVIAG-LEVHAVKP--EE-----IPA-E-Q-IDK-DAA-
Sequence 2 DSLVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAA--APA-DKFTVFE--FN-AIK-S-G-AYD-YK-IP-L-AAVKQ
Sequence 2 KVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           -YAA--A-AP-VKY-V-E-AL-KA-TAMSE--K---PA--A---------
Sequence 2 PYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGA---------

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           ---AT-AA--AT----AA---AT---------AAGGYKV
Sequence 2 ---ATVAAGAATTAAGAASGAAT--------VAAGGYKV



Alignment 27
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56167
Sequence identity: 33.92 (115/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           -----------------------------------------------AKY
Sequence 2 -----------------------------------------------AKY

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           DA--A-LTEALRVIAG--EVHAVKPA-EEV----IPA-E-Q--DK-DAA-
Sequence 2 DAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAA-VK
           --AATAAN-APANDKFTVFE--FN-AIK---G-AY--YKFIP-L-A---K
Sequence 2 KIAATAANSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSK

Sequence 1 QAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAA
           QAY-A--A-APEVKY-V-E--L-KA-TAMSEA-K-A-P----TA----AA
Sequence 2 QAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPVRSVTA----AA

Sequence 1 ATATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           A-A--------ATA---AAT--A--------P--AGGYKV
Sequence 2 AGA--------ATAAGGAATVAAS------RPTSAGGYKV



Alignment 28
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56165
Sequence identity: 52.21 (177/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAVQK-TVALFLAVALVAGPAA-YA-D-GYAPATPA--A---------T-
Sequence 2 MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASA---------TL

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ATPATPAA-P----TTE------K--AG------AA------D--K---E
Sequence 2 ATPATPAASPQHAGTTEYH-IVRK--AGLNEEKNAARQTD--DEQKRSDE

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           ------NK-------------S-----SK-D-A--L-Y---QG-------
Sequence 2 INCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           DA-V--------VI----EV-------EEVKV--IPA-EV--I-KV-AA-
Sequence 2 DASVGSVSSEFHVIESAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           -TAATAA--APANDKFTVF---FN-AIK---G-AY--YKFIPTL-AAVKQ
Sequence 2 STAATAADEAPANDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQ

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           AYAA--ATAPEVKY-V-ETALKKA--AMSEA-KEA-PAAA--A--T---A
Sequence 2 AYAASSATAPEVKYAVFETALKKAISAMSEAQKEAKPAAAISAATTTISA

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           --TATPAA------P-----TATPAA-------AGGYKV
Sequence 2 S-TATPAAP-----PPPQLGTATPAAV------AGGYKV



Alignment 29
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40240
Sequence identity: 39.23 (133/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAVQK-TVALFL------GP--SYAADAGY---------------TPA--
Sequence 2 MAVQKYTVALFLRRGPRGGPGRSYAADAGY---------------TPAAA

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ATPATPAA-P-G----------E---AG-----A-----PP---------
Sequence 2 ATPATPAATPAGGWREGDDRRAEA--AGGRQRLASRQPWPPLPTPLRRTS

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           ---------------S---------L--KLD-A---AY-AA--A-P----
Sequence 2 SRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQV

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           ----------LRVIAG-LEVHAVKPA-EEV----IP--E-Q--DK-DAA-
Sequence 2 RRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAF

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --AATAANAAP-NDKFTVFE--FN-A-----G-A-------P--------
Sequence 2 KIAATAANAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSR

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           --------APEVKY-V-E-AL-KA-TAM--A-K---PAAAA-AT-----A
Sequence 2 PTPPPSPAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAA-ATAAATVA

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           TA-AT-AA-------------------------------
Sequence 2 TAAATAAAVLPPPLLVVQSLISLLIYY------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56166
Sequence identity: 52.51 (178/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           MAVQK-TVALFLA-ALVAGPAASYAADAG----------------TP-TP
Sequence 2 MAVQKYTVALFLAMALVAGPAASYAADAG----------------TPPTP

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ATPA-P-A---GKATT-EQKLIE-INA-FK---A-A---PPADKYKTF--
Sequence 2 ATPAVPGAA-AGKATTHEQKLIEDINAAFKWWPASA---PPADKYKTFE-

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           ---TA--KA---G-AS----------T--LDAA----Y--A-GATPEAKY
Sequence 2 ---TAFSKANIAG-AS----------TKGLDAAYSVVYNTAAGATPEAKY

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLID------
           D--V--LTEALR--AGTLEVHAVKPA-EE------P-A------------
Sequence 2 DSFVTALTEALRIMAGTLEVHAVKPATEE----EVPSAKILRANSRSSTR

Sequence 1 ----KVDAAYRTA---ATAANAAPANDKFTVFENTFNNAIKVSLGAAYDS
           ----K--A---T-----TAAN-APANDKFTVFE--FN-AIK---G-----
Sequence 2 SSRFKIAATVATPLSHSTAANSAPANDKFTVFEGAFNKAIKERHGGPTET

Sequence 1 YKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATP
           YKFIP-L-AAVKQAY-A--A-APEVKY-V-E--L-KA-TAMSEA-K-A-P
Sequence 2 YKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKP

Sequence 1 AAAATATP--TPAAATATATPAAAYATATPAAATATATPAAATATPAAAG
           -------P---P-AA---AT-AAA--------------------------
Sequence 2 VRLSPQPPQVLPLAAGGAATVAAASDSRGGYKV-----------------

Sequence 1 GYKV
           ----
Sequence 2 ----



Alignment 31
Sequence 1:
Sequence 2: Allergen Phl p 6.0101, Sequence: P43215
Sequence identity: 19.47 (66/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -----------------------------------------A-----A--
Sequence 2 ---------------------------------------MVAMFLAVAVV

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ---AT------GKATTEEQKLIE--NA-F-AA-A--A-VPPADKYKTF--
Sequence 2 LGLATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           -F----------------------QL--KLD-----AY-AA--A-PE-KY
Sequence 2 AFTVSSKRNLADAVSKA------PQLVPKLDEVYNAAYNAADHAAPEDKY

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           -A-V----EALR-IAGT-EVHAVKP-A-----------------------
Sequence 2 EAFVLHFSEALRIIAGTPEVHAVKPGA-----------------------

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           ---------------------------------------
Sequence 2 ---------------------------------------



Alignment 32
Sequence 1:
Sequence 2: Allergen Phl p 6.0102, Sequence: CAA76556
Sequence identity: 19.76 (67/339)
Sequence 1 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP
           -----------------------------------A-----A-----A--
Sequence 2 ---------------------------------MAAHKFMVAMFLAVAVV

Sequence 1 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE
           ---AT------GKATTEEQKLIE-INA-F-AA-A--A-VPPADKYKTF--
Sequence 2 LGLATSPTAEGGKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEA

Sequence 1 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY
           -F----------------------QL--KLD-----AY-AA--A-PE-KY
Sequence 2 AFTVSSKRNLADAVSKA------PQLVPKLDEVYNAAYNAADHAAPEDKY

Sequence 1 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY
           -A-V----EAL--IAGT-EVHAVKP-A-----------------------
Sequence 2 EAFVLHFSEALHIIAGTPEVHAVKPGA-----------------------

Sequence 1 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV
           ---------------------------------------
Sequence 2 ---------------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.