The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ara h 3

Sequence O82580

Full FASTA alignment

Sequence name:
Query sequence:
RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD
VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY
SPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQ
AFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQA
GSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGR
AHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS
RPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQ
QSPRAVA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ara h 3O82580Go!507572.12.6e-164
2Ara h 3AAC63045Go!510572.12.6e-164
3Ara h 4AAD47382Go!530518.92.7e-148
4Gly m 6.0301P11828Go!481193.03.3e-50
5Gly m 6.0101P04776Go!495191.21.2e-49
6Gly m glycinin G1AAA33966Go!495191.21.2e-49
7Gly m 6.0501Q7GC77Go!517189.73.3e-49
8Gly m 6.0201P04405Go!485188.19.8e-49
9Gly m glycinin G2CAA68460Go!485188.19.8e-49
10Cor a 9AAL73404Go!515148.39.6e-37
11Pru du 6.0101ADN39440Go!551146.43.9e-36
12Pru du 63EHK_AGo!531145.66.7e-36
13Car i 4.0101ABW86978Go!505145.47.3e-36
14Jug n 4.0101A0A1L6K371Go!510142.65.0e-35
15Jug r 4.0101Q2TPW5Go!507139.34.8e-34
16Pru du 6.0201ADN39441Go!504127.02.5e-30
17Ana o 2AAN76862Go!457119.93.1e-28
18Pis v 5.0101EU410073Go!473114.51.3e-26
19Pis v 2.0101DQ631676Go!496105.76.1e-24
20Cuc ma 4.0101P13744Go!480101.31.3e-22
21Fag e 1BAA21758Go!565100.92.0e-22
22Pis v 2.0201DQ631677Go!47299.44.8e-22
23Fag e 1Q9XFM4Go!53899.35.9e-22
24Ses i 7.0101Q9AUD2Go!49798.49.8e-22
25Zan b 2.0102QYU76046Go!38898.01.0e-21
26Zan b 2.0101QYU76045Go!38998.01.0e-21
27Fag e 1BAA21760Go!50496.83.1e-21
28Zan b 2.03QYS16039Go!38995.75.1e-21
29Gly m 6.0401Q9SB11Go!56396.25.2e-21
30Ber e 2AAO38859Go!46590.13.0e-19
31Zan b 2.02QYU76044Go!38388.29.1e-19
32Sin a 2.0101Q2TLW0Go!51086.24.8e-18
33Ses i 6.0101Q9XHP0Go!45985.85.6e-18
34Coc n 1.0101A0A0S3B0K0Go!49039.94.1e-04
35Jug n 2AAM54366Go!48137.61.9e-03
36Car i 2.0101B3STU4Go!79237.82.7e-03
37Jug r 2AAF18269Go!59337.03.5e-03
38Gly m 5.0101O22120Go!54336.83.7e-03
39Gly m conglycininCAA35691Go!60536.65.0e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 100.00 (507/507)
Sequence 1 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
           RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
Sequence 2 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL

Sequence 1 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
           VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
Sequence 2 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ

Sequence 1 SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD
           SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD
Sequence 2 SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD

Sequence 1 VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY
           VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY
Sequence 2 VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY

Sequence 1 SPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQ
           SPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQ
Sequence 2 SPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQ

Sequence 1 AFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
           AFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
Sequence 2 AFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD

Sequence 1 EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQA
           EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQA
Sequence 2 EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQA

Sequence 1 GSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGR
           GSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGR
Sequence 2 GSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGR

Sequence 1 AHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS
           AHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS
Sequence 2 AHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS

Sequence 1 RPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQ
           RPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQ
Sequence 2 RPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQ

Sequence 1 QSPRAVA
           QSPRAVA
Sequence 2 QSPRAVA



Alignment 2
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 100.00 (507/507)
Sequence 1 ---RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVAL
           ---RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVAL
Sequence 2 ISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVAL

Sequence 1 SRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGR
           SRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGR
Sequence 2 SRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGR

Sequence 1 RSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDH
           RSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDH
Sequence 2 RSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDH

Sequence 1 DTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRS
           DTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRS
Sequence 2 DTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRS

Sequence 1 LPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEF
           LPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEF
Sequence 2 LPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEF

Sequence 1 LEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEE
           LEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEE
Sequence 2 LEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEE

Sequence 1 EYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYN
           EYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYN
Sequence 2 EYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYN

Sequence 1 PQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRL
           PQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRL
Sequence 2 PQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRL

Sequence 1 RGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK
           RGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK
Sequence 2 RGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK

Sequence 1 TDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVP
           TDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVP
Sequence 2 TDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVP

Sequence 1 PSQQSPRAVA
           PSQQSPRAVA
Sequence 2 PSQQSPRAVA



Alignment 3
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 91.32 (463/507)
Sequence 1 -----------------------RQQPEENACQFQRLNAQRPDNRIESEG
           -----------------------RQQPEENACQFQRLNAQRPDNRIESEG
Sequence 2 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
Sequence 2 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY

Sequence 1 FGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRF
           FGLIFPGCP--YEEP--QGRR-QSQRPPRRLQ-EDQSQQQ-DSHQKVHRF
Sequence 2 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF

Sequence 1 DEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
Sequence 2 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG

Sequence 1 NTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRER
           N-EQEFLRYQQQSRQSRRRSLPYSPYSP-S-PR-EEREF-PRGQHSRRER
Sequence 2 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER

Sequence 1 AGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVT
           AGQEEE-EGGNIFSGFTPEFLEQAFQVDDRQIVQNL-GE-ESEEEGAIVT
Sequence 2 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT

Sequence 1 VRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEET
           VRGGLRILSPD--R-ADEEEEYDED-YEY-E-D-RRGRGSRG-GNGIEET
Sequence 2 VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET

Sequence 1 ICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLY
           ICTA--KKNIG-NRSP-IY-PQ--------DLNLLILRWLG-SAEYGNLY
Sequence 2 ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY

Sequence 1 RNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
           RNALFV-HYNTNAHSIIY-LRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
Sequence 2 RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP

Sequence 1 QNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYG
           QNFAVAGKSQSENFEYVAFKTDSRPSIAN-AGENS-IDNLPEEVVANSYG
Sequence 2 QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG

Sequence 1 LQREQARQLKNNNPFKFFVPPSQQSPRAVA
           L-REQARQLKNNNPFKFFVPP-QQSPRAVA
Sequence 2 LPREQARQLKNNNPFKFFVPPFQQSPRAVA



Alignment 4
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 58.19 (295/507)
Sequence 1 ----------------------RQQPEENACQFQRLNAQRPDNRIESEGG
           ----------------------R-QP--N-CQ-QRLNA--PDNRIESEGG
Sequence 2 MAKLVLSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGG

Sequence 1 YIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYF
           -IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-NAPQEI-IQQG-G-F
Sequence 2 FIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIF

Sequence 1 GLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFD
           G-IFPGCP---EEP---G---QS-RP--------------D-HQK---F-
Sequence 2 GMIFPGCPSTFEEPQQKG---QSSRP-------------QDRHQKIYHFR

Sequence 1 EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN
           EGDLIAVPTG-A-W-YN--DT-VVAVSL-DTN---NQLDQ-PRRF-LAGN
Sequence 2 EGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGN

Sequence 1 TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERA
           -EQEFL-YQ-Q--Q---------------------------G--S-----
Sequence 2 QEQEFLQYQPQKQQG--------------------------GTQSQKGKR

Sequence 1 GQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTV
           -QEEENEGG-I-SGF-PEFLE-AF-VD-RQIV--L-GE-E-EE-GAIVTV
Sequence 2 QQEEENEGGSILSGFAPEFLEHAFVVD-RQIVRKLQGENEEEEKGAIVTV

Sequence 1 RGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETI
           -GGL---SP---------EE--E-----DE-D------SR---NGI-ETI
Sequence 2 KGGLSVISPPTEEQQQRPEE--EEKPDCDEKDKHCQSQSR---NGIDETI

Sequence 1 CTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYR
           CT-----NIG---SPDI-NPQAGS--TA--L----L-WL--SA--G-L--
Sequence 2 CTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRK

Sequence 1 NALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQ
           NA-FV-HYN-NA-SIIY-L-GRA-VQVV--NG-RV-D-ELQEG-VL-VPQ
Sequence 2 NAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQ

Sequence 1 NFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL
           NFAVA--SQS-NFEYV-FKT--RPSI-NLAG-NS----LPEEV------L
Sequence 2 NFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNL

Sequence 1 QREQARQLKNNNPFKFFVPPSQQSPRAVA
           -R-QARQ-KNNNPF-F-VPP-----R-VA
Sequence 2 RRQQARQVKNNNPFSFLVPPKESQRRVVA



Alignment 5
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 58.19 (295/507)
Sequence 1 ----------------------RQQPEENACQFQRLNAQRPDNRIESEGG
           ----------------------R-QP--N-CQ-Q-LNA--PDNRIESEGG
Sequence 2 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG

Sequence 1 YIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYF
           -IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-G-F
Sequence 2 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF

Sequence 1 GLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFD
           G-I-PGCP---EEP-----R-QS-RP--------------D-HQK---F-
Sequence 2 GMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDRHQKIYNFR

Sequence 1 EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN
           EGDLIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-LAGN
Sequence 2 EGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGN

Sequence 1 TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERA
           -EQEFL-YQQ-----------------QSQ-----------G-H------
Sequence 2 QEQEFLKYQQEQG------------GHQSQ----------KGKHQ-----

Sequence 1 GQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTV
           -QEEENEGG-I-SGFT-EFLE-AF-VD--QI--NL-GE-E-E--GAIVTV
Sequence 2 -QEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAIVTV

Sequence 1 RGGLRILSP---DRKRRADEEEEYDEDEYEY----DEE-DRRRGRGSRGR
           -GGL----P-------R--EEEE--EDE-------D----R-RG--S--R
Sequence 2 KGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSR

Sequence 1 GNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPS
           -NGI-ETICT-----NIG---SPDIYNPQAGS--TA--L----L-WL--S
Sequence 2 RNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLS

Sequence 1 AEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE
           AE-G-L--NA-FV-HYN-NA-SIIY-L-GRA--QVV--NG-RV-D-ELQE
Sequence 2 AEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQE

Sequence 1 GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEE
           G-VL-VPQNF-VA--SQS-NFEYV-FKT---P-I--LAG-NS----LPEE
Sequence 2 GRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEE

Sequence 1 VVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA
           V------L---QARQ-KNNNPFKF-VPP-----RAVA
Sequence 2 VIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA



Alignment 6
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 58.19 (295/507)
Sequence 1 ----------------------RQQPEENACQFQRLNAQRPDNRIESEGG
           ----------------------R-QP--N-CQ-Q-LNA--PDNRIESEGG
Sequence 2 MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGG

Sequence 1 YIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYF
           -IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-G-F
Sequence 2 LIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIF

Sequence 1 GLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFD
           G-I-PGCP---EEP-----R-QS-RP--------------D-HQK---F-
Sequence 2 GMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDRHQKIYNFR

Sequence 1 EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN
           EGDLIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-LAGN
Sequence 2 EGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGN

Sequence 1 TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERA
           -EQEFL-YQQ-----------------QSQ-----------G-H------
Sequence 2 QEQEFLKYQQEQG------------GHQSQ----------KGKHQ-----

Sequence 1 GQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTV
           -QEEENEGG-I-SGFT-EFLE-AF-VD--QI--NL-GE-E-E--GAIVTV
Sequence 2 -QEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAIVTV

Sequence 1 RGGLRILSP---DRKRRADEEEEYDEDEYEY----DEE-DRRRGRGSRGR
           -GGL----P-------R--EEEE--EDE-------D----R-RG--S--R
Sequence 2 KGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSR

Sequence 1 GNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPS
           -NGI-ETICT-----NIG---SPDIYNPQAGS--TA--L----L-WL--S
Sequence 2 RNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLS

Sequence 1 AEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE
           AE-G-L--NA-FV-HYN-NA-SIIY-L-GRA--QVV--NG-RV-D-ELQE
Sequence 2 AEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQE

Sequence 1 GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEE
           G-VL-VPQNF-VA--SQS-NFEYV-FKT---P-I--LAG-NS----LPEE
Sequence 2 GRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEE

Sequence 1 VVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA
           V------L---QARQ-KNNNPFKF-VPP-----RAVA
Sequence 2 VIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA



Alignment 7
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 42.60 (216/507)
Sequence 1 ------------------------RQQPEENACQFQRLNAQRPDNRIESE
           ------------------------------N-CQ---LNA--PD-R-ESE
Sequence 2 MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESE

Sequence 1 GGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRG
           GG-IETWN----E--CAGV--S---L-RN-L--P-YS--PQ-I---QG-G
Sequence 2 GGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKG

Sequence 1 YFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHR
           --G--FPGCP---E-P--Q--R-----------G----QQ--DSHQK---
Sequence 2 AIGFAFPGCPETFEKPQQQSSR----------RGSRSQQQLQDSHQKIRH

Sequence 1 FDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLA
           F-EGD----P-GV--W-YN--D--VVA-SL-DT-N--NQLDQ-PR-F-LA
Sequence 2 FNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLA

Sequence 1 GNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRE
           GN---E-------------------P---Q-Q--Q--------GQH----
Sequence 2 GNPDIEH------------------PETMQQQQQQKSHGGRKQGQH----

Sequence 1 RAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIV
           ---Q--E-EGG---SGF---FL-Q-F----------LR------E---IV
Sequence 2 ---QQQEEEGGSVLSGFSKHFLAQSFNTNE-DTAEKLR--SPDDERKQIV

Sequence 1 TVRGGLRILSPDRKRRADEEEEYDE--------------------DEYEY
           TV-GGL---SP------DE-E--DE--------------------DE-E-
Sequence 2 TVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRPSHGKHEDDEDED

Sequence 1 DEEDRRRG-----RGSR-------GRG----NGIEETICTASAKKNIGRN
           -EED--R------R-SR-------GRG----NG-EE-ICT-----NI-R-
Sequence 2 EEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARP

Sequence 1 RSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNA
           ---D-YNP-AG---T-N-L-L--LR--G-SA-Y--LYRN-----H-N-NA
Sequence 2 SRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNA

Sequence 1 HSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSEN
           -S-IY--RG---V-VV---GN-V-D-EL--G--LVVPQNF-VA-------
Sequence 2 NSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQG

Sequence 1 FEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLK---
           -EYV-FKT--------------V----P-EV--NSY-L---Q-RQLK---
Sequence 2 LEYVVFKTHHNAVSSYI---KDVFRAIPSEVLSNSYNLGQSQVRQLKYQG

Sequence 1 NNNPFKFFVPPSQQSPRAVA
           N--P----------------
Sequence 2 NSGPLVNP------------



Alignment 8
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 58.58 (297/507)
Sequence 1 -------------------RQQPEENACQFQRLNAQRPDNRIESEGGYIE
           -------------------R-Q---N-CQ-Q-LNA--PDNRIESEGG-IE
Sequence 2 MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIE

Sequence 1 TWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLI
           TWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-G-FG-I
Sequence 2 TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMI

Sequence 1 FPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGD
           FPGCP--Y-EP-----R--SQRP--------------D-HQKVHRF-EGD
Sequence 2 FPGCPSTYQEPQESQQRGRSQRP-------------QDRHQKVHRFREGD

Sequence 1 LIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ
           LIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-LAGN-EQ
Sequence 2 LIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQ

Sequence 1 EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQE
           EFL-YQQQ----------------QSQ-----------G---------QE
Sequence 2 EFLKYQQQQQGGS-----------QSQ----------KGKQ-------QE

Sequence 1 EENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGG
           EENEG-NI-SGF-PEFL--AF-V---QIV-NL-GE-E-E--GAIVTV-GG
Sequence 2 EENEGSNILSGFAPEFLKEAFGVN-MQIVRNLQGENEEEDSGAIVTVKGG

Sequence 1 LRILSPDRKRRADEEEEYDEDEY-EYDEEDRRRGRGSRGRGNGIEETICT
           LR---P-------EE---DE-E-----E-D----R-S----NGI-ETICT
Sequence 2 LRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICT

Sequence 1 ASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNA
           -----NIG-N-SPDIYNPQAGS--TA--L----L--L--SA-YG-L--NA
Sequence 2 MRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNA

Sequence 1 LFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNF
           -FV-HY--NA-SIIY-L-GRA-VQVV--NG-RV-D-ELQEG-VL-VPQNF
Sequence 2 MFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNF

Sequence 1 AVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR
           AVA-KSQS-NFEYV-FKT--RPSI-NLAG-NS----LPEEV------L--
Sequence 2 AVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKS

Sequence 1 EQARQLKNNNPFKFFVPPSQQSPRAVA
           -QARQ-KNNNPF-F-VPP-----RAVA
Sequence 2 QQARQVKNNNPFSFLVPPQESQRRAVA



Alignment 9
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 58.58 (297/507)
Sequence 1 -------------------RQQPEENACQFQRLNAQRPDNRIESEGGYIE
           -------------------R-Q---N-CQ-Q-LNA--PDNRIESEGG-IE
Sequence 2 MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIE

Sequence 1 TWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLI
           TWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-G-FG-I
Sequence 2 TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMI

Sequence 1 FPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGD
           FPGCP--Y-EP-----R--SQRP--------------D-HQKVHRF-EGD
Sequence 2 FPGCPSTYQEPQESQQRGRSQRP-------------QDRHQKVHRFREGD

Sequence 1 LIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ
           LIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-LAGN-EQ
Sequence 2 LIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQ

Sequence 1 EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQE
           EFL-YQQQ----------------QSQ-----------G---------QE
Sequence 2 EFLKYQQQQQGGS-----------QSQ----------KGKQ-------QE

Sequence 1 EENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGG
           EENEG-NI-SGF-PEFL--AF-V---QIV-NL-GE-E-E--GAIVTV-GG
Sequence 2 EENEGSNILSGFAPEFLKEAFGVN-MQIVRNLQGENEEEDSGAIVTVKGG

Sequence 1 LRILSPDRKRRADEEEEYDEDEY-EYDEEDRRRGRGSRGRGNGIEETICT
           LR---P-------EE---DE-E-----E-D----R-S----NGI-ETICT
Sequence 2 LRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICT

Sequence 1 ASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNA
           -----NIG-N-SPDIYNPQAGS--TA--L----L--L--SA-YG-L--NA
Sequence 2 MRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNA

Sequence 1 LFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNF
           -FV-HY--NA-SIIY-L-GRA-VQVV--NG-RV-D-ELQEG-VL-VPQNF
Sequence 2 MFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNF

Sequence 1 AVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR
           AVA-KSQS-NFEYV-FKT--RPSI-NLAG-NS----LPEEV------L--
Sequence 2 AVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKS

Sequence 1 EQARQLKNNNPFKFFVPPSQQSPRAVA
           -QARQ-KNNNPF-F-VPP-----RAVA
Sequence 2 QQARQVKNNNPFSFLVPPQESQRRAVA



Alignment 10
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 45.96 (233/507)
Sequence 1 -----------------------------RQQPEENACQFQRLNAQRPDN
           ------------------------------QQ-----C---RLNA--P-N
Sequence 2 MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTN

Sequence 1 RIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFI
           RIE-E---IE-W--N-Q-F-CAGVA--R-----N-L--P-YSNAP--I-I
Sequence 2 RIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYI

Sequence 1 QQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSH
           --GRG--G--FPGCP---E-P-------QSQ---R--QG--Q---Q-D-H
Sequence 2 ERGRGITGVLFPGCPETFEDPQ-----QQSQQGQRQGQGQSQRSEQ-DRH

Sequence 1 QKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPR
           QK---F-EGD-IA-P-GVA-W-YND-D--VV-VSL--TNN--NQLD--PR
Sequence 2 QKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPR

Sequence 1 RFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQ
           -F-LAGN---E--R--QQ----RRR--------------Q---------Q
Sequence 2 HFYLAGNPDDEHQRQGQQQFGQRRR--------------QQ--------Q

Sequence 1 HSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEE
           HS--E---QE---EG-N-FSGF--EFL--AF-VD--------R-------
Sequence 2 HSHGEQGEQEQQGEGNNVFSGFDAEFLADAFNVD---VDTARRLQSNQDK

Sequence 1 EGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRG
           ---IV-V-G-L----P-R-R---E--E--E-E-E---E--RR--G-RGR-
Sequence 2 RRNIVKVEGRLQVVRPERSRQEWERQERQERESEQERERQRR-QGGRGRD

Sequence 1 -NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPS
           -NG-EETIC------NI------DIY--Q-G---T-N---L--LRWL--S
Sequence 2 VNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLS

Sequence 1 AEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE
           AE-G-L-R--L-V-H-N-NAHS--Y--RGRA-VQVVD-NGN-V-D-EL--
Sequence 2 AERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQ

Sequence 1 GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEE
           G-VL--PQNFAVA----SE-FE-VAFKT-----I--LAG--S-I--LP--
Sequence 2 GQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDD

Sequence 1 VVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA----------
           V-AN-----RE-AR-LK-N------V--S--S---------------
Sequence 2 VLANAFQISREEARRLKYNRQETTLVRSSRSSSERKRRSESEGRAEA



Alignment 11
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 45.36 (230/507)
Sequence 1 -----------------------RQQPEENACQFQRLNAQRPDNRIESEG
           ------------------------Q----N-CQ---L-A--PDNRI--E-
Sequence 2 MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEA

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G-IETWN-N---F-CAGVA-SR----RN-L--P-YSNAPQ-I-I-QGRG-
Sequence 2 GQIETWNFNQEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV

Sequence 1 FGLIFPGCPRHYEEPHT---QGR-------RSQSQRPPR-RLQGEDQSQQ
           -G--F-GCP---EE------QGR-------R-Q-Q-----R-QG----QQ
Sequence 2 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ

Sequence 1 QR-----------------------------------DSHQKVHRFDEGD
           -R-----------------------------------D-HQK--R--EGD
Sequence 2 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDRHQKTRRIREGD

Sequence 1 LIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ
           --A-P-GVA-W-YND-D---VAV-L-------NQLDQ-PR-F-LAGN-E-
Sequence 2 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN

Sequence 1 EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSR---RERA
           EF----QQ----------------QSQPRQ------P-GQH-----R-R-
Sequence 2 EF---NQQG---------------QSQPRQQGEQGRP-GQHQQPFGRPRQ

Sequence 1 GQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTV
           -QE----G-N-FSGF----L-QA--V-------NL-G---------I--V
Sequence 2 -QEQQGSGNNVFSGFNTQLLAQALNVNE-ETARNLQGQNDNRNQ--IIRV

Sequence 1 RGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETI
           RG-L----P-R-R---E-EE-------------R---G-----NG-EET-
Sequence 2 RGNLDFVQPPRGRQEREHEERQQEQLQQE----RQQQGGQLMANGLEETF

Sequence 1 CTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYR
           C----K-NIG-----DI--P-AG---T-N--NL-ILR-L--SAE-G--YR
Sequence 2 CSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYR

Sequence 1 NALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQ
           N-----H-N-NAHS--Y--RG-A-VQVV--NG----D-E-Q-G----VPQ
Sequence 2 NGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQ

Sequence 1 NFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL
           N--V--------FEY-AFKT-----I--LAG--S----LP-EV-AN-Y--
Sequence 2 NHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQI

Sequence 1 QREQARQLKNNNPFKFFVPPSQQSPRAVA
           -REQARQLK-N---------SQQ--RAV-
Sequence 2 SREQARQLKYNRQETIALSSSQQR-RAVV



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 45.36 (230/507)
Sequence 1 ---RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVAL
           ----Q----N-CQ---L-A--PDNRI--E-G-IETWN-N---F-CAGVA-
Sequence 2 ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAA

Sequence 1 SRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHT---
           SR----RN-L--P-YSNAPQ-I-I-QGRG--G--F-GCP---EE------
Sequence 2 SRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ

Sequence 1 QGR-------RSQSQRPPR-RLQGEDQSQQQR------------------
           QGR-------R-Q-Q-----R-QG----QQ-R------------------
Sequence 2 QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQ

Sequence 1 -----------------DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDV
           -----------------D-HQK--R--EGD--A-P-GVA-W-YND-D---
Sequence 2 QQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQEL

Sequence 1 VAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYS
           VAV-L-------NQLDQ-PR-F-LAGN-E-EF----QQ------------
Sequence 2 VAVNLFHVSSDHNQLDQNPRKFYLAGNPENEF---NQQG-----------

Sequence 1 PYSPQSQPRQEEREFSPRGQHSR---RERAGQEEENEGGNIFSGFTPEFL
           ----QSQPRQ------P-GQH-----R-R--QE----G-N-FSGF----L
Sequence 2 ----QSQPRQQGEQGRP-GQHQQPFGRPRQ-QEQQGNGNNVFSGFNTQLL

Sequence 1 EQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEE
           -QA--V-------NL-G---------I--VRG-L----P-R-R---E-EE
Sequence 2 AQALNVNE-ETARNLQGQNDNRNQ--IIQVRGNLDFVQPPRGRQEREHEE

Sequence 1 YDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNP
           -------------R---G-----NG-EET-C----K-NIG-----DI--P
Sequence 2 RQQEQLQQE----RQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSP

Sequence 1 QAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLR
           -AG---T-N--NL-ILR-L--SAE-G--YRN-----H-N-NAHS--Y--R
Sequence 2 RAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIR

Sequence 1 GRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKT
           G-A-VQVV--NG----D-E-Q-G----VPQN--V--------FEY-AFKT
Sequence 2 GNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKT

Sequence 1 DSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPP
           -----I--LAG--S----LP-EV-AN-Y---REQARQLK-N---------
Sequence 2 EENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSS

Sequence 1 SQQSPRAVA
           SQQ--RAV-
Sequence 2 SQQR-RAVV



Alignment 13
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 45.96 (233/507)
Sequence 1 ----------------------------RQQPEENACQFQRLNAQRPDNR
           ----------------------------RQQ-----CQ--RL-A--P-NR
Sequence 2 MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNR

Sequence 1 IESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQ
           IE-E-G-IE-W-PN-Q---CAGVA--R-----N-L--P-YSNAPQ---I-
Sequence 2 IEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIA

Sequence 1 QGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQ
           -GRG--G--FPGCP---EE---Q-----SQ---RR---------Q-D-HQ
Sequence 2 RGRGITGVLFPGCPETFEESQRQ-----SQQGQRR-------EFQQDRHQ

Sequence 1 KVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRR
           K---F-EGD-IA-P-GVA-W-YND----VVA--L-DT-NN-NQLDQ-PR-
Sequence 2 KIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNPRN

Sequence 1 FNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQH
           F-LAGN---EF----QQ-----RR---------Q-Q--Q-------RG-H
Sequence 2 FYLAGNPDDEFRPQGQQEYEQHRR---------QQQHQQR------RGEH

Sequence 1 SRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEE
           ------G------G-N-FSGF--EFL--AF-VD--------R---E----
Sequence 2 ------GEQQRDLGNNVFSGFDAEFLADAFNVDTETAR---RLQSENDHR

Sequence 1 GAIVTVRG-GLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRG
           G-IV-V-G--L----P---R---E-EE--E-E-E---E--RR-----GR-
Sequence 2 GSIVRVEGRQLQVIRPRWSREEQEHEERKERERERESESERRQSRRGGRD

Sequence 1 -NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPS
           -NG-EETICT-S---NIG-----DIY---AG---T-N--NL-ILRWL--S
Sequence 2 DNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNSHNLPILRWLQLS

Sequence 1 AEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE
           AE-G-LY--AL-V-H-N-NAHS--Y-LRGRA-VQVVD--G--V-D-EL-E
Sequence 2 AERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELRE

Sequence 1 GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEE
           G--L--PQNFAV------E-FE-V-FKT--------LAG--S-I--LPEE
Sequence 2 GQLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEE

Sequence 1 VVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA----
           V--N-----RE-AR-LK-N------V-----S-R-------
Sequence 2 VLVNAFQIPREDARRLKFNRQESTLVRSRSRSSRSERRAEV



Alignment 14
Sequence 1:
Sequence 2: Allergen Jug n 4.0101, Sequence: A0A1L6K371
Sequence identity: 46.94 (238/507)
Sequence 1 --------------------------RQQPEENACQFQRLNAQRPDNRIE
           --------------------------RQQP----C---RL-A--P-NRIE
Sequence 2 MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIE

Sequence 1 SEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQG
           -E-G-IE-W-PNNQ-F-CAGVA--R-----N-L--P-YSNAPQ---I--G
Sequence 2 AEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKG

Sequence 1 RGYFGLIFPGCPRHYEEPHTQGRRSQSQ-RPPRRLQGEDQSQQQRDSHQK
           RG--G--FPGCP---EE---QG---QS--RP--R---------QRD-HQK
Sequence 2 RGITGVLFPGCPETFEESQ-QG---QSRIRPSLR-----SASFQRDRHQK

Sequence 1 VHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRF
           ---F-EGD-IA-P-GVA-W-YND-DT-VVAV-L-DT-NN-NQLDQ-PR-F
Sequence 2 IRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNNANQLDQNPRNF

Sequence 1 NLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHS
           -LAGN---EF----QQ-----RR-----------Q-----R---P-----
Sequence 2 YLAGNPDDEFRPQGQQEYEQHRR-----------QQQHQQRHGEP-----

Sequence 1 RRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEG
           -----GQ-----G-N-FSGF---FL--AF-VD--------R---E-----
Sequence 2 -----GQQQRGSGNNVFSGFDADFLADAFNVDTETAR---RLQSENDHRR

Sequence 1 AIVTVRG-GLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRG-
           -IV-V-G--L----P---R---E-EE--E-E-E---E--RR-----GR--
Sequence 2 SIVRVEGRQLQVIRPRWSREEQEREERKERERERESESERRQSRRGGRDD

Sequence 1 NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSA
           NG-EETICT-----NIG-----DIY---AG---TAN---L--LRWL--SA
Sequence 2 NGLEETICTLRLRENIGDPSRADIYTEEAGRISTANSHTLPVLRWLQLSA

Sequence 1 EYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEG
           E-G-LY--AL-V-H-N-NAHS--Y-LRGRA-VQVVD--G--V-D-EL-EG
Sequence 2 ERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREG

Sequence 1 HVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEV
           --L--PQNFAV------E-FE-V-FKT--------LAG--S-I--LPEEV
Sequence 2 QLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEV

Sequence 1 VANSYGLQREQARQLKNNNPFKFFV---PPSQQSPRAVA----
           -AN-----RE-AR-LK-N------V---P-S--S-R-------
Sequence 2 LANALQIPREDARRLKFNRQESTLVRSRPSSSRSSRSERRAEV



Alignment 15
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 46.35 (235/507)
Sequence 1 ---------------------------RQQPEENACQFQRLNAQRPDNRI
           ---------------------------RQQ-----CQ--RL-A--P-NRI
Sequence 2 MAKPILLSIYLFLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRI

Sequence 1 ESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQ
           E-E-G-IE-W-PNNQ-F-CAGVA--R-----N-L--P-YSNAPQ---I--
Sequence 2 EAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIAR

Sequence 1 GRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQK
           GRG--G--FPGCP---EE-----R-SQ--------QG-----QQ-D-HQK
Sequence 2 GRGITGVLFPGCPETFEESQ---RQSQ--------QGQSREFQQ-DRHQK

Sequence 1 VHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRF
           ---F-EGD-IA-P-GVA-W-YND----VVA-SL-DTNNN-NQLDQ-PR-F
Sequence 2 IRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRNF

Sequence 1 NLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHS
           -LAGN---EF----QQ-----RR--------------Q--R---P-G-H-
Sequence 2 YLAGNPDDEFRPQGQQEYEQHRR--------------QQQRQQRP-GEH-

Sequence 1 RRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEG
           -----GQ-----G-N-FSGF---FL--AF-VD--------R---E-----
Sequence 2 -----GQQQRGLGNNVFSGFDADFLADAFNVDTETAR---RLQSENDHRR

Sequence 1 AIVTVRG-GLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRG--RGSRGR
           -IV-V-G--L----P---R---E-EE--E-E-E---E--RR---RG-R--
Sequence 2 SIVRVEGRQLQVIRPRWSREEQEREERKERERERESESERRQSRRGGRD-

Sequence 1 GNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPS
           -NG-EETICT-----NIG-----DIY---AG---T-N---L--LRWL--S
Sequence 2 DNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNSHTLPVLRWLQLS

Sequence 1 AEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE
           AE-G-LY--AL-V-H-N-NAHS--Y-LRGRA-VQVVD--G--V-D-EL-E
Sequence 2 AERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELRE

Sequence 1 GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEE
           G--L--PQNFAV------E-FE-V-FKT--------LAG--S-I--LPEE
Sequence 2 GQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEE

Sequence 1 VVANSYGLQREQARQLKNNNPFKFFV---PPSQQSPRAVA----
           V-A------RE-AR-LK-N------V---P----S-R-------
Sequence 2 VLATAFQIPREDARRLKFNRQESTLVRSRPSRSRSSRSERRAEV



Alignment 16
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 39.64 (201/507)
Sequence 1 --------------RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPN
           -----------------------Q---L-A--PDN-I-SE-G--E-WNP-
Sequence 2 CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPS

Sequence 1 NQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCP
           ---F--AGVA--R-----N-L--P-Y-NAPQ-I-I--GRG--G--FPGC-
Sequence 2 DPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCA

Sequence 1 RHYEEPHTQGRRSQSQ----RPPRRLQGEDQSQ----QQRDSHQKVHRFD
           ---E----Q----Q-Q----RP-R---G--Q-Q-----Q-D-HQK-----
Sequence 2 ETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIR

Sequence 1 EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN
           EGD-IA-P-GVA-W-YN------VAVSL-D-NN--NQLDQ-PRRF-LAGN
Sequence 2 EGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGN

Sequence 1 TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERA
           ---EF---------------------PQ-Q-RQ--------GQ-------
Sequence 2 PQDEF--------------------NPQQQGRQQQQQ--QQGQ-------

Sequence 1 GQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTV
           -------G-NIFSGF----L-QA--V-------NL-G------E--IV-V
Sequence 2 ----QGNGNNIFSGFDTQLLAQALNVNP-ETARNLQGQDDNRNE--IVRV

Sequence 1 RGGLRILSPDRKR---RADEEEEYDEDEYEYDEEDRRR---GRGSRGRGN
           -G-L---SP-------R-D-E----E-------E---R-----G--G--N
Sequence 2 QGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDN

Sequence 1 GIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAE
           G-EET-C-A----NIG-----D-YNPQ-G-----N---L-ILR-L--SAE
Sequence 2 GVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAE

Sequence 1 YGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGH
           -G-LY-NA----H--TNA----Y--RG-A-VQVV--NG----D-E--EG-
Sequence 2 KGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQ

Sequence 1 VLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVV
           ----PQN-AV------E-FEY--F-TD-------LAG--SV---LP-EV-
Sequence 2 LFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVL

Sequence 1 ANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA-----
           -N-----R--AR-LK-N-----------------------
Sequence 2 QNAFRISRQEARNLKYNRQESRLLSATSPPRGRLMSILGY



Alignment 17
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 43.00 (218/507)
Sequence 1 ---------------RQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWN
           ---------------RQ-------CQ--RL-A--PDNR-E-E-G--E-W-
Sequence 2 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD

Sequence 1 PNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPG
           PN---F-CAGVAL-R-----N-L--P-YSNAPQ-I---QG-G--G---PG
Sequence 2 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG

Sequence 1 CPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIA
           CP--Y--P--QGR-----------QG--QS----D-HQK--RF--GD-IA
Sequence 2 CPETYQAPQ-QGRQ----------QG--QSGRFQDRHQKIRRFRRGDIIA

Sequence 1 VPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFL
           -P-GVA-W-YN-----VV-V-L-D--N--NQLD--PR-F-LAGN----F-
Sequence 2 IPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVF-

Sequence 1 RYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEEN
           --QQQ--QSR----------------------------------------
Sequence 2 -QQQQQHQSR----------------------------------------

Sequence 1 EGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGG-LR
           -G-N-FSGF--E-L--AFQVD-R-----L--E------G-IV-V----LR
Sequence 2 -GRNLFSGFDTELLAEAFQVDER-LIKQLKSE---DNRGGIVKVKDDELR

Sequence 1 ILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASA
           ---P-R-------E---E-E-E---E-RR-G-----R-NGIEETICT---
Sequence 2 VIRPSRS----QSERGSESEEESEDEKRRWGQ----RDNGIEETICTMRL

Sequence 1 KKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFV
           K-NI------DIY-P--G-L-T-N-LNL-IL-WL--S-E-G-LY-NAL--
Sequence 2 KENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVL

Sequence 1 AHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVA
           -H-N-N-HSIIY---G---VQVVD--GNRV-D-E--EG--LVVPQNFAV-
Sequence 2 PHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVV

Sequence 1 GKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQA
           -----E-FE---FKT--R-----LAG--SV----PEEV-AN-----RE-A
Sequence 2 KRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDA

Sequence 1 RQLKNNNPFKFFVPPSQQSPRAVA-
           R--K-NN------------------
Sequence 2 RKIKFNNQQTTLTSGESSHHMRDDA



Alignment 18
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 43.00 (218/507)
Sequence 1 -----------------------RQQ-PEENACQFQRLNAQRPDNRIESE
           -----------------------RQQ----N-CQ---L-A--PDNR-E-E
Sequence 2 MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYE

Sequence 1 GGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRG
           -G--ETW-PN---F-CAGVA--R-----N-LR-P-YSNAP----I--G-G
Sequence 2 AGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEG

Sequence 1 YFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHR
           --G---PGCP--Y--P--QG------------Q---QS----D-HQK--R
Sequence 2 MTGTLIPGCPETYQAPQ-QG------------QQHGQSSRFQDKHQKIQR

Sequence 1 FDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLA
           F--GD-IA-P-GVA-W-YN-----VV-V-L-D--N--NQLD--PR-FNLA
Sequence 2 FRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLA

Sequence 1 GNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRE
           GN-E-EF---QQQ----RR----------QSQ------------------
Sequence 2 GNPEDEFQQQQQQQSRGRR----------QSQ------------------

Sequence 1 RAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIV
           ---Q---N---NIF-GF----L---FQV-----V--L----E----GAIV
Sequence 2 ---QKSCN---NIFCGFDTKILAEVFQVE-QSLVKQL--QNEKDNRGAIV

Sequence 1 TVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEE
           -V-G-L----P-R-------E---E-EYE---------RG-RGR-NG-EE
Sequence 2 KVKGDLQVIRPPRRQSERGFESEEESEYE---------RGRRGRDNGLEE

Sequence 1 TICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNL
           TICT---K-NI------DIY-P--G-----N-LNL-IL-WL--SAE-G-L
Sequence 2 TICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVL

Sequence 1 YRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVV
           --NAL-V-H-N-NAHSI-Y---G-A-VQVVD--GN-V-D-E--EG---VV
Sequence 2 QNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVV

Sequence 1 PQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSY
           PQNFAV--------FE---FKT--R--I--LAG--SV----PEEV-AN--
Sequence 2 PQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAF

Sequence 1 GLQREQARQLKNNNPFKFFVPPSQQSPRAVA-
           ---RE-AR--K-NN------------------
Sequence 2 QISREDARKIKFNNEQPTLSSGQSSQQMRDDA



Alignment 19
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 40.83 (207/507)
Sequence 1 ----------------------------------RQQPEENACQFQRLNA
           -----------------------------------QQ-----CQ-Q-LNA
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 QRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAP
           --P--RIESE-G--E-W--N-----CA-VA--R-------L--P-Y-NAP
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAP

Sequence 1 QEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQ
           ------QG-G--G--FPGCP----E---Q-R-S-S-R----------SQQ
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQE-ESQSR-SRSER----------SQQ

Sequence 1 QRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQL
           ----HQKV----EGD-IA-P-GVA-W-YN------V-V-L-D--N--NQL
Sequence 2 SGEQHQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQL

Sequence 1 DQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREF
           DQ--R-F-L-G---QE-----Q-S-QSR-RS--------QSQ--------
Sequence 2 DQYLRKFVLGGSPQQEI----QGSGQSRSRS--------QSQS-------

Sequence 1 SPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGE
           ------SRR---GQ-------NI-S-F--E-L-Q-F--D--Q----L---
Sequence 2 ------SRRGQQGQQ----SNNILSAFDEEILAQSFNIDT-QLARRL--Q

Sequence 1 TESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRG
           -E----G-IV-V---L--LSP-R-----------E-E-EY-EE--RR-R-
Sequence 2 KEKRQRGIIVRVQEDLEVLSPHRQ----------EQEQEYEEERERRQR-

Sequence 1 SRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRW
           -----NG-EET-CT---K-NI------D-YNP--G-----N-LNL-ILR-
Sequence 2 -----NGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRF

Sequence 1 LGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDE
           L--SA--G-L-R-A----H-N-NAHSI-Y--RG----Q-V--NG--V-DE
Sequence 2 LQLSAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDE

Sequence 1 ELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDN
           E--EG---VVPQNFAV-----S--FE-V-FKT--------LAG--SV---
Sequence 2 EIREGQLVVVPQNFAVVKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRA

Sequence 1 LPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA---------
           LP--V--NS----RE-AR-LK----------P---S-R------------
Sequence 2 LPLDVIKNSFDISREDARRLKESRSETTIFAPGSSSQRKSQSERERQRER

Sequence 1 ------
           ------
Sequence 2 EEREIH



Alignment 20
Sequence 1:
Sequence 2: Allergen Cuc ma 4.0101, Sequence: P13744
Sequence identity: 38.26 (194/507)
Sequence 1 -----------------------------------------RQQPEENAC
           ------------------------------------------Q-P---AC
Sequence 2 MARSSLFTFLCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPR--AC

Sequence 1 QFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRR
           ----L-AQ-P--R-E-E----E-W---N-EF-CAGV---R---R---L--
Sequence 2 RLENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLL

Sequence 1 PFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQ
           P--SNAP--IF--QG-G--G---PGC---Y----T--RRSQS--------
Sequence 2 PGFSNAPKLIFVAQGFGIRGIAIPGCAETYQ---TDLRRSQSA-------

Sequence 1 GEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDT
           ---------D-HQK---F-EGDL--VP-GV--W-YN----D-V-----DT
Sequence 2 ----GSAFKDQHQKIRPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADT

Sequence 1 NNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQP
           -N--NQ-D---R-F-LAG-------------------------------P
Sequence 2 RNVANQIDPYLRKFYLAG------------------------------RP

Sequence 1 RQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQI
           -Q-ER--------SR----G-------GNIFSGF--EFLE-AFQ-D----
Sequence 2 EQVERGVEEWERSSRKGSSGEK----SGNIFSGFADEFLEEAFQIDG-GL

Sequence 1 VQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEE
           V--L-GE----E---IV-V------L-P-------------------DEE
Sequence 2 VRKLKGE--DDERDRIVQVDEDFEVLLPEK-----------------DEE

Sequence 1 DRRRGRGSRGRG---NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTA
           -R-RGR---------NG-EETICT---K-NIGR----D--NP--G---TA
Sequence 2 ERSRGRYIESESESENGLEETICTLRLKQNIGRSVRADVFNPRGGRISTA

Sequence 1 NDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVV
           N---L-ILR----SAE-G-LY-NA----HY--N-HS--Y--RG-A-VQVV
Sequence 2 NYHTLPILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVV

Sequence 1 DSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN
           D--G--V-D-E--EG-VL--PQNF-V--------FE--AFKT--------
Sequence 2 DNFGQSVFDGEVREGQVLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNL

Sequence 1 LAGENSVIDNLPEEVVANSYGLQREQARQLK-NNNPFKFFVPPSQQSPRA
           LAG--S----LP--V--N-Y---RE-A--LK----------P---Q--R-
Sequence 2 LAGRVSQMRMLPLGVLSNMYRISREEAQRLKYGQQEMRVLSPGRSQGRRE

Sequence 1 VA
           --
Sequence 2 --



Alignment 21
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 38.46 (195/507)
Sequence 1 -----------------------------------RQQPEENACQFQRLN
           -------------------------------------Q-----C--QRL-
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT

Sequence 1 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PQEIFIQQGRGYFGLIFPGCPR------HYEEPHTQ----GRRSQSQRPP
           P---F--QGRG--G---PGCP---------E-P--Q-----R-S-S----
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS

Sequence 1 RRLQ---------------------------GEDQSQQ----------QR
           R--Q---------------------------G-----Q----------QR
Sequence 2 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR

Sequence 1 ------------DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSL
           ------------D-HQK--R---GD-I--P-GV--W--ND-D-D-----L
Sequence 2 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL

Sequence 1 TDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQ
           -D-N---NQLD---R-F-LAG-----------QSR--RR-----------
Sequence 2 YDANSFQNQLDGNVRNFFLAGQS--------KQSREDRR-----------

Sequence 1 SQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDD
           SQ-RQ---E-S-R-----RE----E---E--NI--GF--E-L---F---D
Sequence 2 SQ-RQTREEGSDR---QSRESDDDEALLEA-NILTGFQDEILQEIFRNVD

Sequence 1 RQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEY
           ------LRG-------G-IV--R--------D-K-R--EE-E----E---
Sequence 2 QETISKLRGD--NDQRGFIVQAR--------DLKLRVPEEYE---EELQR

Sequence 1 DEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTA
           ---DR-RG-GS-GR-NG-E---C----K-N--R----D--NP-AG---T-
Sequence 2 ERGDRKRG-GS-GRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTV

Sequence 1 NDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVV
           N--NL-IL-----SA----LY-NA------N-NAHS--Y--RG---VQVV
Sequence 2 NSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVV

Sequence 1 DSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN
           ---G--V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-D-------
Sequence 2 GDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSP

Sequence 1 LAGENSVIDNLPEEVVANSYGLQREQARQLKNN-NPFKFFVPPSQQSPRA
           -AG--SV----P-EV-ANSY------A--LKN-------F-P--------
Sequence 2 IAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKE

Sequence 1 VA--
           ----
Sequence 2 RERF



Alignment 22
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 39.05 (198/507)
Sequence 1 ----------------------------------RQQPEENACQFQRLNA
           -----------------------------------QQ-----CQ-Q-LNA
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 QRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAP
           --P--RIESE-G--E-W--N-----CA-VA--R-------L--P-Y-NAP
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAP

Sequence 1 QEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQ
           ------QG-G--G--FPGCP----E------RSQ--R--R-------SQQ
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQSQSRSQHSRSER-------SQQ

Sequence 1 QRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQL
           ----HQKV----EGD-IA-P-GVA-W-YN------V-V-L-D--N--NQL
Sequence 2 SGEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQL

Sequence 1 DQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREF
           DQ--R-F-L-G---QE-----Q---QS-------------SQ--------
Sequence 2 DQYLRKFVLGGSPQQEI----QGGGQS------------WSQ--------

Sequence 1 SPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGE
           ------SR--R-GQ-------NI-S-F--E-L-Q-F--D--Q-V--L---
Sequence 2 ------SRSSRKGQQ----SNNILSAFDEEILAQSFNIDT-QLVKKL--Q

Sequence 1 TESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRG
           -E----G-IV-V---L--LSP-R------E-EY-----------------
Sequence 2 REEKQRGIIVRVKEDLQVLSPQRQ-----EKEYSD---------------

Sequence 1 SRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRW
           -----NG-EET-CT---K-NI------D-YNP--G-----N-LNL-ILR-
Sequence 2 -----NGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRF

Sequence 1 LGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDE
           L--S-E-G-LY-NA----H-N-NAHSI-Y--RG----Q-V--NG--V-DE
Sequence 2 LQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDE

Sequence 1 ELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDN
           E--EG---VVPQNFAV-----S--FE-V-FKT-----I--LAG--SV---
Sequence 2 EIREGQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRG

Sequence 1 LPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA
           LP--V--NS----RE-A--LK----------P---S-R---
Sequence 2 LPLDVIQNSFDISREDAWNLKESRSEMTIFAPGSRSQRQRN



Alignment 23
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 37.28 (189/507)
Sequence 1 -----------------------------------RQQPEENACQFQRLN
           -------------------------------------Q-----C--QRL-
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT

Sequence 1 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PQEIFIQQGRGYFGLIFPGCPR------HYEEPHTQ--------------
           P---F--QGRG--G---PGCP---------E-P--Q--------------
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS

Sequence 1 -----GRRSQSQRPPRRLQGEDQSQQQR----DSHQKVHRFDEGDLIAVP
           ------R-S-S----R--Q---QS--------D-HQK--R---GD-I--P
Sequence 2 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP

Sequence 1 TGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRY
           -GV--W--N--D-D-----L-D-N---NQLD---R-F-LAG---------
Sequence 2 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQS-------

Sequence 1 QQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENE-
           --QSR--RR----------Q-Q-R-E-----------R--R--Q--E---
Sequence 2 -KQSREDRRS---------QRQTREEGSD--------RQSRESQDDEALL

Sequence 1 GGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRIL
           --NI-SGF--E-L---F---D------LRGE------G-IV--R--L---
Sequence 2 EANILSGFEDEILQEIFRNVDQETISKLRGE--NDQRGFIVQARD-LKLR

Sequence 1 SPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKK
           -P---------EEY-E-E------DR-RG-GS-GR-NG-E---C------
Sequence 2 VP---------EEYEE-ELQRERGDRKRG-GS-GRSNGLEQAFCNLKFRQ

Sequence 1 NIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAH
           N--R----D--NP-AG---T----NL-IL-----SA----LY-NA-----
Sequence 2 NVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPR

Sequence 1 YNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGK
           -N-NAHS--Y--RG---VQVV---G--V-D---Q-G--LVVPQ-FAV--K
Sequence 2 WNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLK

Sequence 1 SQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQ
           ---E--E-V--K-D--------AG--SV----P-EV-ANSY------A--
Sequence 2 AGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFR

Sequence 1 LKNN-NPFKFFVPPSQQSPRAVA-----
           LKN-------F-P---------------
Sequence 2 LKNGRQEVEVFRPFQSRDEKERERFSIV



Alignment 24
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 37.87 (192/507)
Sequence 1 ----------------------------------------RQQPEENACQ
           ------------------------------------------------C-
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR

Sequence 1 FQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP
           --RL-AQ-P--R-ESE-G--E-W--NNQ-FECAGVA--R-V-----L--P
Sequence 2 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP

Sequence 1 FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQG
           -Y-NAPQ------GRG--G---PGC----E------R--Q----PR----
Sequence 2 HYNNAPQLLYVVRGRGIQGTVIPGCAETFE------RDTQ----PR----

Sequence 1 EDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTN
           -D------D-HQKV--F--GD--A-P-G---W-YN--------V-L-DT-
Sequence 2 QDRRRRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTG

Sequence 1 NNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPR
           N--NQLDQ--R-F-LAGN---------Q--RQS-----------PQ----
Sequence 2 NAANQLDQTFRHFFLAGNP--------QGGRQSYFGR-------PQTEKQ

Sequence 1 QEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIV
           Q-E------------------------NIF-GF--E-L--AF-VD--Q--
Sequence 2 QGETK----------------------NIFNGFDDEILADAFGVD-VQTA

Sequence 1 QNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEED
           --L-G-------G-IV-----L-I--P-------EEE----D-Y------
Sequence 2 RRLKGQ--DDLRGRIVRAER-LDIVLPGE----EEEERWERDPYS-----

Sequence 1 RRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN
           -----G-----NG-EET-CTA----N-------D-YNP--G-----N-L-
Sequence 2 -----GA----NGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLT

Sequence 1 LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNG
           L--L-WL--SAE-G-LYRN-L---H-N-NAHSIIY--RG----QVV---G
Sequence 2 LPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTG

Sequence 1 NRVYDEELQEGHVLVVPQNFAVAGK-SQSENFEYVAFKTDSRPSIANLAG
           --V-D----EG----VPQN--VA---SQ-E--E---FKT--------LAG
Sequence 2 RSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAG

Sequence 1 ENSVIDNLPEEVVANSYGLQREQARQLK-NNNPFKFFVPPSQQS-PRAVA
           --S-I---PEEVV---Y---R--AR-LK-N------F---S--S-PR---
Sequence 2 RLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSR

Sequence 1 --------------------
           --------------------
Sequence 2 PMSYMPKPFEYVLDVIKSMM



Alignment 25
Sequence 1:
Sequence 2: Allergen Zan b 2.0102, Sequence: QYU76046
Sequence identity: 34.52 (175/507)
Sequence 1 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
           -------------------------E-G--E-W--NN----CA-VA--R-
Sequence 2 -------------------------EAGVTEFWDQNNEQLQCANVAVFRH

Sequence 1 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
           ------L--P-Y-N--------QGRG--G--FPGCP--Y-----Q----Q
Sequence 2 RIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGCPETYQDQQQQ----Q

Sequence 1 SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD
           S-------Q-E----Q--D-HQKV----EGD--A-PTG-A-W-YN-----
Sequence 2 SH------QSEGSRSQ--DQHQKVRQLREGDIVAMPTGSAHWIYNNGQSQ

Sequence 1 VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY
           -V-V-L-D--N-DNQLDQ--R-F---GN--QE---Y-Q-S--SR------
Sequence 2 LVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQ-SQGSRSY----

Sequence 1 SPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQ
           -------Q--Q-E------G--SRR----------GGNIF-GF----L--
Sequence 2 -------QGSQGE------GG-SRR--------SSGGNIFNGFDERLLAD

Sequence 1 AFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
           AF-V----I---L---------G-IV-V---L--L-P-R------E-E--
Sequence 2 AFNVNP-EIIRRL--QKPQLPRGIIVRVEEELEVLRPQRGEQ-EQEQEF-

Sequence 1 EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQA
           -----------------RGR-NG-EET-CT---K-NI------D-YNP--
Sequence 2 -----------------RGRDNGLEETYCTIKLKHNINNPSDADVYNPRG

Sequence 1 GSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGR
           G---T-N--NL--LRW---SAE-GNLY-NA----H-N-N-HS--Y--RG-
Sequence 2 GRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLAPHWNLNSHSVVYVTRGS

Sequence 1 AHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS
           --VQ-V--NGN-VYD----EG---VVPQ--AV--K------E---FKT--
Sequence 2 GRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKKASNQGLEWISFKTND

Sequence 1 RPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQ
           ------LAG-NSVI--LP--V--N--------------------------
Sequence 2 NAETSQLAGRNSVIRALPLDVIQN--------------------------

Sequence 1 QSPRAVA
           -------
Sequence 2 -------



Alignment 26
Sequence 1:
Sequence 2: Allergen Zan b 2.0101, Sequence: QYU76045
Sequence identity: 34.52 (175/507)
Sequence 1 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
           -------------------------E-G--E-W--NN----CA-VA--R-
Sequence 2 -------------------------EAGVTEFWDQNNEQLQCANVAVFRH

Sequence 1 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
           ------L--P-Y-N--------QGRG--G--FPGCP--Y-----Q----Q
Sequence 2 RIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGCPETYQDQQQQ----Q

Sequence 1 SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD
           S-------Q-E----Q--D-HQKV----EGD--AVPTG-A-W-YN-----
Sequence 2 SH------QSEGSRSQ--DQHQKVRQLREGDIVAVPTGSAHWIYNNGQSQ

Sequence 1 VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY
           -V-V-L-D--N-DNQLDQ--R-F---GN--QE---Y-Q-S--SR------
Sequence 2 LVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQ-SQGSRSY----

Sequence 1 SPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQ
           -------Q--Q-E------G--SRR----------GGNIF-GF----L--
Sequence 2 -------QGSQGE------GS-SRR--------SSGGNIFNGFDERLLAD

Sequence 1 AFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
           AF-V----I---L---------G-IV-V---L--L-P-R------E-E--
Sequence 2 AFNVNP-EIIRRL--QKPQLPRGIIVRVEEELEVLRPQRGQEQEQEQEF-

Sequence 1 EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQA
           -----------------RGR-NG-EET-CT---K-NI------D-YNP--
Sequence 2 -----------------RGRDNGLEETYCTIKLKHNINNPSDADVYNPRG

Sequence 1 GSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGR
           G---T-N--NL--LRW---SAE-GNLY-NA----H-N-N-HS--Y--RG-
Sequence 2 GRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLAPHWNLNSHSVVYVTRGS

Sequence 1 AHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS
           --VQ-V--NGN-VYD----EG---VVPQ--AV---------E---FKT--
Sequence 2 GRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKRASNQGLEWISFKTND

Sequence 1 RPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQ
           ------LAG-NSVI--LP--V--N--------------------------
Sequence 2 NAETSQLAGRNSVIRALPLDVIQN--------------------------

Sequence 1 QSPRAVA
           -------
Sequence 2 -------



Alignment 27
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 35.50 (180/507)
Sequence 1 ------------------------------------RQQPE-ENACQFQR
           ------------------------------------RQQ------C--QR
Sequence 2 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR

Sequence 1 LNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYS
           L-A--P--R--SE-G--E-W-----EF-C-G----R-V-----L--P-YS
Sequence 2 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQ
           NAP---F--QGRG--G---PGCP-------------QSQR-----Q-E--
Sequence 2 NAPYITFVEQGRGVQGVVIPGCPETFQSD-SEFEYPQSQRGRHSRQSESE

Sequence 1 SQQQR-DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNN
           ----R-D-HQK--R--EGD-I--P-GV--W--ND---D---V-L-D-N--
Sequence 2 EESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSY

Sequence 1 DNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQE
           --QLD---R-F-LAG----E--R-----RQSR------------------
Sequence 2 HKQLDENVRSFFLAGQSQRE-TREEGSDRQSRE-----------------

Sequence 1 EREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQN
           -------------------E---G-NI-SGF--E-L---F---DR-----
Sequence 2 ---------------SDDDEALLGANILSGFQDEILHELFRDVDRETISK

Sequence 1 LRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRR
           LRGE------G-IV-----------D-K-R-----E----EYE----DRR
Sequence 2 LRGE--NDQRGFIVQAQ--------DLKLRVPQDFE---EEYERERGDRR

Sequence 1 RGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLL
           RG-G--GR-NG-E---C------N----------NP-AG---T-N---L-
Sequence 2 RGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLP

Sequence 1 ILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNR
           IL--L--SA----LY-NA------N-NAHS--Y--RG---VQVV---G--
Sequence 2 ILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKS

Sequence 1 VYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENS
           V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-----------G--S
Sequence 2 VFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTS

Sequence 1 VIDNLPEEVVANSYGLQREQARQLKNN-NPFKFFVPPSQQSPRAVA----
           V----P-EV-ANSY------A--LKN-------F-P--------------
Sequence 2 VLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFSI

Sequence 1 -
           -
Sequence 2 V



Alignment 28
Sequence 1:
Sequence 2: Allergen Zan b 2.03, Sequence: QYS16039
Sequence identity: 34.32 (174/507)
Sequence 1 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
           -------------------------E-G--E-W--NNQ---CA-VA--R-
Sequence 2 -------------------------EAGVTEFWDQNNQQLQCANVAVFRH

Sequence 1 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
           ----N-L--P-Y-N-P------QGRG--G---PGCP--Y-----Q----Q
Sequence 2 RIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGCPETYQDEQQQ---QQ

Sequence 1 SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD
           S---P-------------D-HQKV----EGD-IA-PTG-A-W-YN-----
Sequence 2 SFSYP------SEGSRSQDQHQKVRQIREGDIIALPTGSAHWIYNNGQSQ

Sequence 1 VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY
           -V-V-L-D--N-DNQLDQ--R-F-L-GN---------Q---QS-------
Sequence 2 LVLVALVDVGNSDNQLDQYFRKFYLGGNPQPQL----QGTSQSQ------

Sequence 1 SPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQ
           ---------R--ER-----G--SRR------------NIF-GF----L--
Sequence 2 -------GGRYQERLGG--GDSSRR----------SANIFNGFDERLLAE

Sequence 1 AFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
           AF-V----I----R--------G-I--V----R-L-P-R-------E-Y-
Sequence 2 AFNVNPELIRRLQRPQMQ---RGIIIRVEEEFRVLTPQRG-----QESYE

Sequence 1 EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQA
           -D-Y--------------GR-NG-EET-CT-----NI------D-YNP-A
Sequence 2 SDPY--------------GRYNGVEETLCTMRLRHNINDPSRADVYNPRA

Sequence 1 GSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGR
           G---T-N-LNL--LRWL--SAE-GNLY-NAL---H-N-NAHSI-Y--RG-
Sequence 2 GRVTTVNRLNLPVLRWLQLSAEKGNLYKNALTAPHWNLNAHSIVYITRGN

Sequence 1 AHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS
           --VQ-V--NGN-V-D-E--EG---VVPQ-FAV---------E---FKT--
Sequence 2 GRVQIVSENGNNVFDGEIREGQLIVVPQGFAVVKRASNRGLEWISFKTND

Sequence 1 RPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQ
           ------LAG--SV---LP--V--N--------------------------
Sequence 2 YAMTNQLAGRVSVLRALPLDVIQN--------------------------

Sequence 1 QSPRAVA
           -------
Sequence 2 -------



Alignment 29
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 43.59 (221/507)
Sequence 1 -----------------------RQQPEENACQFQRLNAQRPDNRIESEG
           -----------------------------N-CQ---LNA--PD-R-ESEG
Sequence 2 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G-I-TWN----E--CAGV--S-L-L-RN-L--P-YS--P--I-I-QG-G-
Sequence 2 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA

Sequence 1 FGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRF
           -G---PGCP---EEP--Q--R--S-----------Q-QQ--DSHQK---F
Sequence 2 LGVAIPGCPETFEEPQEQSNRRGSR---------SQKQQLQDSHQKIRHF

Sequence 1 DEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGD----P-GV--W-YN--D--VVA-SL-DT-N--NQLDQ-PR-F-LAG
Sequence 2 NEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAG

Sequence 1 NTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRER
           N---E-------------------P---Q-Q--Q--------GQH-----
Sequence 2 NPDIEY------------------PETMQQQQQQKSHGGRKQGQHQ----

Sequence 1 AGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVT
           --QEEE-EGG---SGF---FL-Q-F------I---L-------E---IVT
Sequence 2 --QEEEEEGGSVLSGFSKHFLAQSFNTNE-DIAEKL--QSPDDERKQIVT

Sequence 1 VRGGLRILSPDRKRRADEEEEYDEDE-----------------YEYDE--
           V-GGL---SP------DE-E--DED-------------------E-DE--
Sequence 2 VEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDE

Sequence 1 ---EDR-RRGRGSRG-----------------------------------
           ---ED--R--R-S-G-----------------------------------
Sequence 2 DEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRP

Sequence 1 -------RG----NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND
           -------RG----NG-EE-ICT-----NI-R----D-YNP-AG---T-N-
Sequence 2 RQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNS

Sequence 1 LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDS
           L-L--LR----SA-Y--LY-N-----H-N-NA-S-IY--RG---V-VV--
Sequence 2 LTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNC

Sequence 1 NGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLA
           -GN-V-D-EL--G--LVVPQNF-VA-------FEY--FKT--------L-
Sequence 2 QGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL-

Sequence 1 GENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFV-PPSQQ-SPRAV
           ----V----P-EV-A-SY-L---Q---LK--------V-P-SQQ-SPR--
Sequence 2 --KDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVK

Sequence 1 A-
           --
Sequence 2 VA



Alignment 30
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 37.87 (192/507)
Sequence 1 ----------------------RQQPEENACQFQRLNAQRPDNRIESEGG
           ------------------------Q-E---C--QRL-AQ-P--R-E-E-G
Sequence 2 MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAG

Sequence 1 YIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYF
           --E-W----Q-F-CAGVA--R---R---L--P-Y-NAP------QGRG--
Sequence 2 VSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGIL

Sequence 1 GLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFD
           G---PGCP------------S-SQ----R-Q-E-----Q-D-HQKVH---
Sequence 2 GVLMPGCPETFQ--------SMSQFQGSREQEEERGRFQ-DQHQKVHHLK

Sequence 1 EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN
           -GD-IA-P-GVA-W-YND-D-D-V-V----T----NQLDQ-PR-F-LAGN
Sequence 2 KGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGN

Sequence 1 TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERA
           ------R-Q-Q-----R--L----------------------------R-
Sequence 2 IQ----RSQKQ--RGERYGL----------------------------RG

Sequence 1 GQEEENEGGNIFSGFTPEFLEQAFQVD-DRQIVQNLRGETESEEEGAIVT
           GQ-------N-F-GF--E-L--------D-------RGE------G-IV-
Sequence 2 GQQILAD--NVFKGFNMEALADVLGFGMDTETARKVRGE--DDQRGHIVR

Sequence 1 VRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEET
           V--GL----P-R-R---E--E---------------G-G-----NG-EET
Sequence 2 VEQGLKVIRPPRIREELEQQE---------------GGGY----NGLEET

Sequence 1 ICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLY
           IC-A----NI------D-YNP-AG-L-T-N-L---IL--L--SA--G-LY
Sequence 2 ICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLY

Sequence 1 RNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
           -NA--------NA-S--Y--RG-A-VQ-VD--G--V-D--L-EG---VVP
Sequence 2 ENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVP

Sequence 1 QNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYG
           QNF-V-----S--FE-V-F-T---------AG--S-----P--V-AN-Y-
Sequence 2 QNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYR

Sequence 1 LQREQARQLK-NNNPFKFFVPPSQQSPRAVA
           L--E-AR--K-N------F-P-S----RA-A
Sequence 2 LSQEEARRIKLNRDEAVLFQPGSRSRGRASA



Alignment 31
Sequence 1:
Sequence 2: Allergen Zan b 2.02, Sequence: QYU76044
Sequence identity: 33.14 (168/507)
Sequence 1 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
           -------------------------E-G--E-W--NN----CA-VA--R-
Sequence 2 -------------------------EAGVTEFWDQNNPQLQCANVAVFRH

Sequence 1 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
           ----N-L--P-Y-N--------QGRG--G--FPGCP--Y-----Q----Q
Sequence 2 RIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGCPETYQDQQQQ----Q

Sequence 1 SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD
           S-----------Q-----D-HQKV----EGD-IA-PTG-A-W-YN-----
Sequence 2 SY--------QSQGSRSQDQHQKVRQIREGDIIALPTGAAHWIYNNGGSQ

Sequence 1 VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY
           -V-V-L-D--N-DNQLDQ--R-F-L-GN---E------Q----R-----Y
Sequence 2 LVLVALVDVGNSDNQLDQYFRKFYLGGNPQPEL-----QGTSQRQQGGGY

Sequence 1 SPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQ
           -------Q--Q--------G--SRR-----------GN-F-GF----L--
Sequence 2 -------QGSQ------GGGGGSRR-----------GNMFNGFDERLLAD

Sequence 1 AFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD
           AF-V----I----R--------G-IV-V----R-LSP-R------E-E-D
Sequence 2 AFNVNPELIRRLQRPQMQ---RGIIVRVEEEFRVLSPQRGQEQEQEQEQD

Sequence 1 EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQA
           -D-------------------NG-EET-CT-----NI------D-YNP--
Sequence 2 CD-------------------NGVEETFCTMKLRHNINDPSRADVYNPRG

Sequence 1 GSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGR
           G---T-N--NL--LRWL--SAE-GNLY-NAL---H-N-N-HSI-Y--RG-
Sequence 2 GRVTTVNRFNLPVLRWLQLSAEKGNLYQNALTSPHWNLNCHSIVYITRGS

Sequence 1 AHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS
           ---Q-V--NGN-V---E--EG---V-PQ-FAV--K------E--AFKT--
Sequence 2 GRMQIVSENGNDVFNGEIREGQLIVIPQGFAVVKKASNRGLEWIAFKTND

Sequence 1 RPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQ
           ------LAG--SV---LP--V-----------------------------
Sequence 2 NAMTNQLAGRVSVMRALPLDV-----------------------------

Sequence 1 QSPRAVA
           -------
Sequence 2 -------



Alignment 32
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 33.14 (168/507)
Sequence 1 ----------------------------RQQPEENACQFQRLNAQRPDNR
           -----------------------------------AC----L----P---
Sequence 2 MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTEV

Sequence 1 IESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQ
           I-SE-G--E-W--N-----CAGV---RLV-----L--P-----P------
Sequence 2 IKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSSPFISYVV

Sequence 1 QGRGYFGLIFPGC--------PRHYEEPHTQGRRSQ----------SQRP
           QG-G--G---PGC--------P--------QG---Q-----------Q--
Sequence 2 QGMGISGRVIPGCAETFMDSQPMQGQQGQQQGQQGQQGQQGQQGQQGQQG

Sequence 1 PRRLQGEDQSQQQ-----------RDSHQKVHRFDEGDLIAVPTGVAFWL
           ----QG----Q-Q-----------RD-HQKV-----GD-IA---G-A-W-
Sequence 2 QQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHGDAIAMTPGSAQWI

Sequence 1 YNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQS
           YN--D-----VSL-D--N--NQLD--PR-F-LAGN--Q-----QQQ--Q-
Sequence 2 YNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQGSSQQQQQQQQ-

Sequence 1 RRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGF
           --------------------------------------------NI-SGF
Sequence 2 --------------------------------------------NILSGF

Sequence 1 TPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRA
           -P--L-QA---D-R---Q-L---------G-IV-V-G------P---R-A
Sequence 2 DPQVLAQALKIDVR-LAQEL--QNQQDKRGNIVRVKGPFQVVRPPL-RQA

Sequence 1 DEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSP
           -E-E---------------RG-------NG-EETIC------NI------
Sequence 2 YESEQWRHP----------RGPPQSPQDNGLEETICSMRTHENIDDPARA

Sequence 1 DIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSI
           DIY-P--G-----N---L-IL-----SA--G-L---A-----YN-NA--I
Sequence 2 DIYKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEI

Sequence 1 IYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEY
           -Y---G-A--QVV--NG--V-D---Q-G---V-PQ-FA----SQ--NFE-
Sequence 2 LYCTQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQSQN-NFEW

Sequence 1 VAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFK
           --FKT-----I--LAG--S----LP-EV--N-Y----E-AR--K-N----
Sequence 2 ISFKTNANAMISTLAGRTSALRALPLEVITNAYQISLEEARKIKFNTLET

Sequence 1 FFVPPSQQSPRAVA------
           --------------------
Sequence 2 TLTRARGGQQPQLIEEIVEV



Alignment 33
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 34.71 (176/507)
Sequence 1 -------------------------RQQPEENACQFQRLNAQRPDNRIES
           ---------------------------------C-FQR-----P--RI-S
Sequence 2 MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQS

Sequence 1 EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGR
           EGG--E-W------F-CAG----R---R-N-L--P-Y---P----I--G-
Sequence 2 EGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQ

Sequence 1 GYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQ--RDSHQK
           G------PGC---Y---H-------SQR---R-----Q------RD-HQK
Sequence 2 GLISIMVPGCAETYQV-H------RSQRTMERTEASEQQDRGSVRDLHQK

Sequence 1 VHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRF
           VHR---GD--A-P-G-A-W-YND---D-VAVS--D-N---NQLDQ--R-F
Sequence 2 VHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAF

Sequence 1 NLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHS
           -LAG-------------------------------PR--E-E-----Q--
Sequence 2 YLAGGV-----------------------------PRSGEQE-----QQA

Sequence 1 RRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEG
           R-------------NIF--F--E-L--AF-V----I----R---E-EE-G
Sequence 2 RQTFH---------NIFRAFDAELLSEAFNVPQETIR---RMQSEEEERG

Sequence 1 AIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNG
           -IV--R-------PD--------EE--E-E---------RGR------NG
Sequence 2 LIVMARERMTFVRPD--------EEEGEQEH--------RGRQL---DNG

Sequence 1 IEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEY
           -EET-CT-----N----R--DI---QAG---------L-IL-----SAE-
Sequence 2 LEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEK

Sequence 1 GNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHV
           GNLY-NAL---------H-I-Y--RG-A-VQVVD-NG----------G--
Sequence 2 GNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEM

Sequence 1 LVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVA
           -VVPQ------------FE-VAFKT---P----LAG--SVI---P--V--
Sequence 2 FVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVIT

Sequence 1 NSYGLQREQARQLK-NNNPFKFFVPPSQQSPRAVA
           NSY-----QA--LK-N-----F---P---------
Sequence 2 NSYQISPNQAQALKMNRGSQSFLLSPGGRRS----



Alignment 34
Sequence 1:
Sequence 2: Allergen Coc n 1.0101, Sequence: A0A0S3B0K0
Sequence identity: 15.38 (78/507)
Sequence 1 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
           --------------------------------------------------
Sequence 2 ------------------------------------------------MV

Sequence 1 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
           ----------------------------------------E---------
Sequence 2 SAMGDRTASAILALLLLSSWSLMVVMAYQGRGMEGREKRVEEKAPRSPED

Sequence 1 SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD
           ------R---E------------------G-------G------N-----
Sequence 2 RGLFILRRSKEVLKTDAGEVRLMMGYRYRGNHSPMHIGFITMEPNTLYIP

Sequence 1 VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY
           -----------------------N------------------S-------
Sequence 2 QYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYIVNS

Sequence 1 SPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQ
           ----------------S-----------------------SGF----L--
Sequence 2 DKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSA

Sequence 1 AFQVDDRQ---IVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEE
           AF-V---Q---I----RG-------G-----R--L--------R---E-E
Sequence 2 AFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKE

Sequence 1 --EYDEDEYEYDEED----RRRGRGSRGRGNGIEETICTASAKKNIGRNR
           ----D-DE-E--E-D----R-------G-G-------C----K-------
Sequence 2 MDSDDDDEAEQEEDDVWTWRCLLKSLLGKGD------CRVQRKHKLAH--

Sequence 1 SPDIYNPQAGSLKTANDLNLLI---------LRWLGPSAEYGNLYRNALF
           SP--YN---------ND----I---------L----------NL---A--
Sequence 2 SPGSYNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAML

Sequence 1 VAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAV
           --H-N--A------LRG----QVV--NG---------EG-V---P--F--
Sequence 2 SPHVNPTATEYGIILRGSGTIQVVFPNGTAAMNAKVSEGDVFWIPRYFPF

Sequence 1 AG-KSQSENFEYVAFKTDSRPSIAN-LAGENSVIDNLPEEVVANSYGLQR
           ----S-----E---F-T--R------L-G--S----------A---G---
Sequence 2 CQIASDGAPLEFFGFTTSARKNRPQFLVGKSSLLHSMRGPELAAAFGVSE

Sequence 1 EQARQLKNNNPFKFFVPPSQQSPRAVA-------------------
           EQ--------------P-S---------------------------
Sequence 2 EQLERIVKAQREAVILPTSPHREMEEINGKKWKGEEVLVMKRGLFA



Alignment 35
Sequence 1:
Sequence 2: Allergen Jug n 2, Sequence: AAM54366
Sequence identity: 21.89 (111/507)
Sequence 1 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
           ---R------------------Q-----------C-R-Y-E---QGR---
Sequence 2 GRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQ--QGRERG

Sequence 1 SQRPPRRL-QGEDQSQQQRDSH----QKV---HRFDEGDLIAVPTGVAFW
           ----PRR---G----QQ---------Q-----H---EG------------
Sequence 2 PEASPRRESKGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLER-----

Sequence 1 LYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQ
           -----------------N-----LD--P--F-L------E--------R-
Sequence 2 -FAERTELLRGIE----NYRVVILDANPNTFMLPHHKDAESVIVVTRGRA

Sequence 1 SRRRSLPYSPYSPQSQPRQEERE-FSPRGQHSRRERAGQEEENEGGNIFS
           ------------------QE-RE-F--------R--AG--E---------
Sequence 2 T------------LTLVSQETRESFNLECGDVIRVPAGATEY-----VIN

Sequence 1 GFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKR
           ----E-LE----V---Q-V-N-----E----GA-------LR--S-D---
Sequence 2 QDSNERLEM---VKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSND-IL

Sequence 1 RADEEEEYDEDEYEYDEEDRRRG---RGSRGRGNGIEETICTAS----AK
           -A------D--E---D----R-G---R-S-------------A-------
Sequence 2 VAALNTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWGR

Sequence 1 KNIG-----RNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRN
           ---G---------P--Y--Q-G----A-------L--------Y----R-
Sequence 2 RSSGGPISLKSERPS-YSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRG

Sequence 1 ALFVAHYNTNAHSIIYRLRGRA-------HV--QVVDSNGNRVYDEE---
           A--V-HYN--A----Y---G---------HV--Q-----G-R---EE---
Sequence 2 AMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFEDQGRREQEEEEST

Sequence 1 ---------LQEGHVLVVPQNFAVA-GKSQSENFEYVAFKTDSRPSIAN-
           ---------L--G---V-P-----A---SQ-EN-----F---------N-
Sequence 2 GRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQRNF

Sequence 1 LAGENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAV
           LAG-NS-I--L--E----S----RE-------------FVP---QS-R--
Sequence 2 LAGQNSIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQ

Sequence 1 A--------------
           ---------------
Sequence 2 GRDHPLASILGFAFF



Alignment 36
Sequence 1:
Sequence 2: Allergen Car i 2.0101, Sequence: B3STU4
Sequence identity: 25.25 (128/507)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVTKAKIPLFLFLSALFLALVCSSLALETEDLSNELNPHHDPESHRWEFQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCQERCQHEERGQRQAQQCQRRCEEQLREREREREREEIVDPREPRKQYE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCRETCEKQDPRQQPQCERRCERQFQEQQERERRERRRGRDDDDKENPRD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PREQYRQCEEHCRRQGQGQRQQQQCQSRCEERFEEEQRRQEERERRRGRD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NDDEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQE

Sequence 1 --------------------------------RQQPEENACQFQRLNAQR
           --------------------------------R---E---C---R---QR
Sequence 2 ERERRRGRDEDDQNPRDPEQRYEQCQQQCERQRRGQEQQLCR-RRCEQQR

Sequence 1 PDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQE
           -----E---G------P--Q---C----------RR-----------P--
Sequence 2 QQEERERQRGR-DRQDPQQQYHRCQ---------RRCQTQE----QSPER

Sequence 1 IFIQQGRGYFGLIFPGCPRHYEEPHTQGRR-SQSQRPPRRLQGEDQSQQQ
           ----Q-R---------C-R-Y-E---QGR-----Q--PRR--------QQ
Sequence 2 QRQCQQR---------CERQYKEQ--QGREWGPDQASPRRESRGREEEQQ

Sequence 1 RDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLD
           R--H--------G-------G-----Y----T----------N-----L-
Sequence 2 R--HNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILE

Sequence 1 QFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFS
           --P--F-L------E--------R------L--------SQ-R-E---F-
Sequence 2 ANPNTFVLPYHKDAESVIVVTRGRAT----LTFV-----SQERRES--FN

Sequence 1 PRGQHSRRERAGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGET
           -------R--AG--E-------------E-LE----V---Q-V-N-----
Sequence 2 LEYGDVIRVPAGATEY-----VINQDSNERLEM---VKLLQPVNNPGQFR

Sequence 1 ESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRG---
           E----GA--T----LR--S-D----A------D--E---D----R-G---
Sequence 2 EYYAAGAQST-ESYLRVFSND-ILVAALNTPRDRLERFFDQQEQREGVII

Sequence 1 RGSRGRGNGIEETICTASAKKNIGRNRS--P-------DIYNPQAGSLKT
           R-S-------------A------GR--S--P---------Y--Q-G----
Sequence 2 RASQEKLRALSQHAMSAG-QRPWGRRSSGGPISLKSQRSSYSNQFGQFFE

Sequence 1 ANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHV--
           A-------L--------Y----R-A--V-HYN--A----Y---G------
Sequence 2 ACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEM

Sequence 1 --------QVVDSNGNRVYDEE-------------LQEGHVLVVPQNFAV
           --------Q-----G-R---EE-------------L--G---V-P-----
Sequence 2 ACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPI

Sequence 1 A-GKSQSENFEYVAFKTDSRPSIAN-LAGENSVIDNLPEEVVANSYGLQR
           A---SQ-EN---V-F---------N-LAG-N--I--L--E----S----R
Sequence 2 AITASQNENLRLVGFGINGKNNQRNFLAGQNNIINQLEREAKELSFNMPR

Sequence 1 EQARQLKNNNPFKFFVPPSQQSPRAVA---------------
           E-------------FVP---QS-R------------------
Sequence 2 EEIEEIFERQVESYFVPMERQSRRGQGRDHPLASILDFAGFF



Alignment 37
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 24.26 (123/507)
Sequence 1 ---------------------------------RQQPEENACQFQRLNAQ
           ----------------------------------QQ-----C-------Q
Sequence 2 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ

Sequence 1 RP-DNRIESEGGYIETWNPNN--QEFE-CAG-VALSRLVLRRNALRRPFY
           R----R----G------NP----Q--E-C-------R--------RR---
Sequence 2 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE

Sequence 1 SNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQS------QRPPR
           ----QE----Q-RG----------R----P--Q--R-Q-------Q-P-R
Sequence 2 QRRQQEERERQ-RG----------RDRQDPQQQYHRCQRRCQIQEQSPER

Sequence 1 RLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSL
           --Q-------Q----Q---R--E--------G----------------S-
Sequence 2 QRQCQQRCERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSI

Sequence 1 TDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPYSPYSPQ
           ---------------RF--------E-LR-----R-------P-----P-
Sequence 2 RSRHESEEGEVKYLERFT----ERTELLRGIENYRVVILDANPNTSMLPH

Sequence 1 SQPRQEEREFSPRGQHSRRERAGQEEEN---EGGNIF---SGFTPEFLEQ
           -----E------RG------------E----E-G-------G-T-----Q
Sequence 2 HKD-AESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQ

Sequence 1 AFQ-----VDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADE
           --------V---Q-V-N-----E----GA-------LR--S-D----A--
Sequence 2 DSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSND-ILVAAL

Sequence 1 EEEYDEDEYEYDEEDRRRG---RGSRGRGNGIEETICTAS----AKKNIG
           ----D--E---D----R-G---R-S-------------A----------G
Sequence 2 NTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSG

Sequence 1 -----RNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFV
           --------SP--Y--Q-G----A-------L--------Y----R-A--V
Sequence 2 GPISLKSESPS-YSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMV

Sequence 1 AHYNTNAHSIIYRLRGRA-------HV--QVVDSNGNRVYDEE-------
           -HYN--A----Y---G---------HV--Q-----G-R---EE-------
Sequence 2 PHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQ

Sequence 1 -----LQEGHVLVVPQNFAVA-GKSQSENFEYVAFKTDSRPSIAN-LAGE
           -----L--G---V-P-----A---SQ-EN-----F-----------LAG-
Sequence 2 KVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ

Sequence 1 NSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA---
           N--I--L--E----S----RE-------------FVP---QS-R------
Sequence 2 NNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGRDH

Sequence 1 -----------
           -----------
Sequence 2 PLASILDFAFF



Alignment 38
Sequence 1:
Sequence 2: Allergen Gly m 5.0101, Sequence: O22120
Sequence identity: 14.20 (72/507)
Sequence 1 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLPY
           -------------------------------------------R-R--P-
Sequence 2 -------------------------------VEKEECEEGEIPRPRPRPQ

Sequence 1 SPYSPQSQP--RQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFL
           -P-----QP----E-----PR-----R----QEEE-E-------------
Sequence 2 HPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHE----------QRE

Sequence 1 EQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEE
           EQ-------------RGE--SEEE----------R-----R-----EE--
Sequence 2 EQEWPRKEEK-----RGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEERK

Sequence 1 YDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKN---IGRNRSPDI
           --EDE---DEE--R----S-------E---------KN----G-NR----
Sequence 2 QEEDE---DEEQQRESEES-------EDSELRRHKNKNPFLFGSNRFETL

Sequence 1 YNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNT-------
           ---Q-G--------N--------P-------YR---F----NT-------
Sequence 2 FKNQYGRIRVLQRFN-----QRSPQLQNLRDYRILEFNSKPNTLLLPNHA

Sequence 1 NAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQ--NFAVAGKS
           -A---I--L-G-A----V-------Y---LQ-G--L-VP------V----
Sequence 2 DADYLIVILNGTAILSLVNNDDRDSY--RLQSGDALRVPSGTTYYVVNPD

Sequence 1 QSENFEYVAFKTD-SRPS------IANLAGENSVIDNLPEEVVANSYGLQ
           --EN------------P---------------S------------SY---
Sequence 2 NNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTK

Sequence 1 REQARQLKNNNPFKFFVPPSQQSPRAVA----------------------
           -E------------------------------------------------
Sequence 2 FEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 IPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSS

Sequence 1 ------
           ------
Sequence 2 ILRAFY



Alignment 39
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: CAA35691
Sequence identity: 16.17 (82/507)
Sequence 1 RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIAVPTGVAFWLY-NDHDT
           ----------------------------------V--G-A-W---N----
Sequence 2 --------------MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHN

Sequence 1 DVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRYQQQSRQSRRRSLP
           --------------NQ------R-NL------E-----------R-R--P
Sequence 2 KCLQSCNSERDSYRNQACH--ARCNLLKVEKEEC----EEGEIPRPRPRP

Sequence 1 YSPYSPQSQP--RQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEF
           --P-----QP----E-----PR-----R----QEEE-E------------
Sequence 2 QHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHE----------QR

Sequence 1 LEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILS----PDRKRRA
           -EQ-------------RGE--SEEE----------R-------P--K---
Sequence 2 EEQEWPRKEEK-----RGEKGSEEEDEDEDEEQDERQFPFPRPPHQKEER

Sequence 1 DEEEEYDEDEYEYDEED------RRRGRGSRGRGNGIEETICTASAKKNI
           -EEE--DE------EE-------R---------G----ET------K---
Sequence 2 NEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFETLF----KNQY

Sequence 1 GRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYN
           GR-R-----N-----L----D---L---------E--N---N-L------
Sequence 2 GRIRVLQRFNQRSPQLQNLRDYRIL---------EF-NSKPNTLLLPNH-

Sequence 1 TNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQN--FAVAGK
           --A---I--L-G-A----V-------Y---LQ-G--L-VP------V---
Sequence 2 ADADYLIVILNGTAILSLVNNDDRDSY--RLQSGDALRVPSGTTYYVVNP

Sequence 1 SQSENFEYVAFKTD-SRPS------IANLAGENSVIDNLPEEVVANSYGL
           ---EN------------P---------------S------------SY--
Sequence 2 DNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDT

Sequence 1 QREQARQLKNNNPFKFFVPPSQQSPRAVA---------------------
           --E-----------------------------------------------
Sequence 2 KFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVIS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLS

Sequence 1 -------
           -------
Sequence 2 SILRAFY


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.