The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ara h 4

Sequence 5712199

Full FASTA alignment

Sequence name:
Query sequence:
MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET
ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY
RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG
LPREQARQLKNNNPFKFFVPPFQQSPRAVA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ara h 4AAD47382Go!530609.71.3e-175
2Ara h 3AAC63045Go!510523.98.9e-150
3Ara h 3O82580Go!507520.96.8e-149
4Gly m 6.0501Q7GC77Go!517188.76.9e-49
5Gly m 6.0301P11828Go!481182.74.3e-47
6Gly m 6.0101P04776Go!495179.53.9e-46
7Gly m glycinin G1AAA33966Go!495179.53.9e-46
8Gly m 6.0201P04405Go!485178.67.5e-46
9Gly m glycinin G2CAA68460Go!485178.67.5e-46
10Pru du 63EHK_AGo!531141.71.0e-34
11Pru du 6.0101ADN39440Go!551141.41.3e-34
12Car i 4.0101ABW86978Go!505141.11.5e-34
13Cor a 9AAL73404Go!515137.91.3e-33
14Jug n 4.0101A0A1L6K371Go!510136.63.3e-33
15Jug r 4.0101Q2TPW5Go!507135.38.1e-33
16Pru du 6.0201ADN39441Go!504122.75.0e-29
17Ana o 2AAN76862Go!457110.71.8e-25
18Pis v 5.0101EU410073Go!473106.82.9e-24
19Pis v 2.0101DQ631676Go!49698.87.9e-22
20Fag e 1BAA21760Go!50494.71.4e-20
21Pis v 2.0201DQ631677Go!47294.51.4e-20
22Ses i 7.0101Q9AUD2Go!49794.41.7e-20
23Zan b 2.0102QYU76046Go!38892.74.2e-20
24Zan b 2.0101QYU76045Go!38991.21.2e-19
25Cuc ma 4.0101P13744Go!48091.31.4e-19
26Zan b 2.03QYS16039Go!38989.34.6e-19
27Fag e 1BAA21758Go!56587.81.8e-18
28Fag e 1Q9XFM4Go!53886.73.8e-18
29Ber e 2AAO38859Go!46586.05.2e-18
30Zan b 2.02QYU76044Go!38383.72.2e-17
31Ses i 6.0101Q9XHP0Go!45982.94.5e-17
32Sin a 2.0101Q2TLW0Go!51081.41.4e-16
33Gly m 6.0401Q9SB11Go!56378.89.1e-16
34Jug n 2AAM54366Go!48139.84.3e-04
35Coc n 1.0101A0A0S3B0K0Go!49039.26.9e-04
36Jug r 2AAF18269Go!59339.28.2e-04
37Car i 2.0101B3STU4Go!79239.49.5e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 100.00 (530/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
Sequence 2 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
Sequence 2 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
Sequence 2 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
Sequence 2 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
Sequence 2 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
Sequence 2 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT

Sequence 1 VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET
           VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET
Sequence 2 VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET

Sequence 1 ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY
           ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY
Sequence 2 ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY

Sequence 1 RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
           RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
Sequence 2 RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP

Sequence 1 QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG
           QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG
Sequence 2 QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG

Sequence 1 LPREQARQLKNNNPFKFFVPPFQQSPRAVA
           LPREQARQLKNNNPFKFFVPPFQQSPRAVA
Sequence 2 LPREQARQLKNNNPFKFFVPPFQQSPRAVA



Alignment 2
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 87.92 (466/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           --------------------ISFRQQPEENACQFQRLNAQRPDNRIESEG
Sequence 2 --------------------ISFRQQPEENACQFQRLNAQRPDNRIESEG

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
Sequence 2 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           FGLIFPGCP--YEEP--QGRR-QSQRPPRRLQ-EDQSQQQ-DSHQKVHRF
Sequence 2 FGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRF

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
Sequence 2 DEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N-EQEFLRYQQQSRQSRRRSLPYSPYSP-S-PR-EEREF-PRGQHSRRER
Sequence 2 NTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRER

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           AGQEEE-EGGNIFSGFTPEFLEQAFQVDDRQIVQNL-GE-ESEEEGAIVT
Sequence 2 AGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVT

Sequence 1 VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET
           VRGGLRILSPD--R-ADEEEEYDED-YEY-E-D-RRGRGSRG-GNGIEET
Sequence 2 VRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEET

Sequence 1 ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY
           ICTA--KKNIG-NRSP-IY-PQ--------DLNLLILRWLG-SAEYGNLY
Sequence 2 ICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLY

Sequence 1 RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
           RNALFV-HYNTNAHSIIY-LRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
Sequence 2 RNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVP

Sequence 1 QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG
           QNFAVAGKSQSENFEYVAFKTDSRPSIAN-AGENS-IDNLPEEVVANSYG
Sequence 2 QNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYG

Sequence 1 LPREQARQLKNNNPFKFFVPPFQQSPRAVA
           L-REQARQLKNNNPFKFFVPP-QQSPRAVA
Sequence 2 LQREQARQLKNNNPFKFFVPPSQQSPRAVA



Alignment 3
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 87.36 (463/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           -----------------------RQQPEENACQFQRLNAQRPDNRIESEG
Sequence 2 -----------------------RQQPEENACQFQRLNAQRPDNRIESEG

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
Sequence 2 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           FGLIFPGCP--YEEP--QGRR-QSQRPPRRLQ-EDQSQQQ-DSHQKVHRF
Sequence 2 FGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRF

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
Sequence 2 DEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N-EQEFLRYQQQSRQSRRRSLPYSPYSP-S-PR-EEREF-PRGQHSRRER
Sequence 2 NTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRER

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           AGQEEE-EGGNIFSGFTPEFLEQAFQVDDRQIVQNL-GE-ESEEEGAIVT
Sequence 2 AGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVT

Sequence 1 VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET
           VRGGLRILSPD--R-ADEEEEYDED-YEY-E-D-RRGRGSRG-GNGIEET
Sequence 2 VRGGLRILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEET

Sequence 1 ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY
           ICTA--KKNIG-NRSP-IY-PQ--------DLNLLILRWLG-SAEYGNLY
Sequence 2 ICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLY

Sequence 1 RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
           RNALFV-HYNTNAHSIIY-LRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
Sequence 2 RNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVP

Sequence 1 QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG
           QNFAVAGKSQSENFEYVAFKTDSRPSIAN-AGENS-IDNLPEEVVANSYG
Sequence 2 QNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYG

Sequence 1 LPREQARQLKNNNPFKFFVPPFQQSPRAVA
           L-REQARQLKNNNPFKFFVPP-QQSPRAVA
Sequence 2 LQREQARQLKNNNPFKFFVPPSQQSPRAVA



Alignment 4
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 41.51 (220/530)
Sequence 1 ---MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIE
           -------L-LS---C-L-L-------------N-CQ---LNA--PD-R-E
Sequence 2 MGKPFFTLSLS-SLCLLLLSSACFAITSS-KFNECQLNNLNALEPDHRVE

Sequence 1 SEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQG
           SEGG-IETWN----E--CAGV--S---L-RN-L--P-YS--PQ-I---QG
Sequence 2 SEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQG

Sequence 1 RGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKV
           -G--G--FPGCP-T-E-P-QQ--R--S-----R-Q-----QQ-QDSHQK-
Sequence 2 KGAIGFAFPGCPETFEKPQQQSSRRGS-----RSQ-----QQLQDSHQKI

Sequence 1 HRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFN
           --FNEGD----P-GV--W-YN--D--VVA-SL-DT-N--NQLDQ-PR-F-
Sequence 2 RHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFY

Sequence 1 LAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSR
           LAGN---E-----QQ--Q-------------H----------R--GQH--
Sequence 2 LAGNPDIEHPETMQQQQQQKS----------HGG--------RKQGQH--

Sequence 1 RERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGA
           -----Q--E-EGG---SGF---FL-Q-F----------L-------E---
Sequence 2 -----QQQEEEGGSVLSGFSKHFLAQSFNTNE-DTAEKL--RSPDDERKQ

Sequence 1 IVTVRGGLRILSPDGTRGADEEEEYDE--------------------DQY
           IVTV-GGL---SP------DE-E--DE--------------------D--
Sequence 2 IVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRPSHGKHEDDED

Sequence 1 EYHEQDGRRG-----RGSR-------GGG----NGIEETICTACVKKNIG
           E--E-D--R------R-SR-------G-G----NG-EE-ICT-----NI-
Sequence 2 EDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIA

Sequence 1 GNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNT
           -------Y-P----------L-L--LR--GLSA-Y--LYRN----PH-N-
Sequence 2 RPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNL

Sequence 1 NAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQS
           NA-S-IY--RG---V-VV---GN-V-D-EL--G--LVVPQNF-VA-----
Sequence 2 NANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGE

Sequence 1 ENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLK-
           ---EYV-FKT--------------F----P-EV--NSY-L---Q-RQLK-
Sequence 2 QGLEYVVFKTHHN-AVSSYI-KDVF-RAIPSEVLSNSYNLGQSQVRQLKY

Sequence 1 --NNNPFKFFVPPFQQSPRAVA
           --N--P----------------
Sequence 2 QGNSGPLVNP------------



Alignment 5
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 57.36 (304/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           MAKL--LS-CF----------SFR-QP--N-CQ-QRLNA--PDNRIESEG
Sequence 2 MAKLV-LSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEG

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G-IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-NAPQEI-IQQG-G-
Sequence 2 GFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGI

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           FG-IFPGCPST-EEP-Q-G---QS-RP-------------QD-HQK---F
Sequence 2 FGMIFPGCPSTFEEPQQKG---QSSRP-------------QDRHQKIYHF

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGDLIAVPTG-A-W-YN--DT-VVAVSL-DTN---NQLDQ-PRRF-LAG
Sequence 2 REGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N-EQEFL-YQ-Q--Q---------------------------G--S----
Sequence 2 NQEQEFLQYQPQKQQG--------------------------GTQSQKGK

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           --QEEE-EGG-I-SGF-PEFLE-AF-VD-RQIV--L-GENE-EE-GAIVT
Sequence 2 RQQEEENEGGSILSGFAPEFLEHAFVVD-RQIVRKLQGENEEEEKGAIVT

Sequence 1 VRGGLRILSP---DGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGI
           V-GGL---SP----------EEE--D-D----H-Q---R--------NGI
Sequence 2 VKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQSR--------NGI

Sequence 1 EETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYG
           -ETICT-----NIG---SP-I--PQ---------L----L-WL-LSA--G
Sequence 2 DETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFG

Sequence 1 NLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVL
           -L--NA-FVPHYN-NA-SIIYAL-GRA-VQVV--NG-RV-D-ELQEG-VL
Sequence 2 SLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVL

Sequence 1 VVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVAN
           -VPQNFAVA--SQS-NFEYV-FKT--RPSI-N-AG-NS----LPEEV---
Sequence 2 IVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQ

Sequence 1 SYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA
           ---L-R-QARQ-KNNNPF-F-VPP-----R-VA
Sequence 2 TFNLRRQQARQVKNNNPFSFLVPPKESQRRVVA



Alignment 6
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 56.04 (297/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISF--RQQPEENACQFQRLNAQRPDNRIES
           MAKL----F--CFL--------F--R-QP--N-CQ-Q-LNA--PDNRIES
Sequence 2 MAKLV---FSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIES

Sequence 1 EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGR
           EGG-IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-
Sequence 2 EGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGK

Sequence 1 GYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVH
           G-FG-I-PGCPST-EEP-Q---R-QS-RP-------------QD-HQK--
Sequence 2 GIFGMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDRHQKIY

Sequence 1 RFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNL
           -F-EGDLIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-L
Sequence 2 NFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYL

Sequence 1 AGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRR
           AGN-EQEFL-YQQ-------------------------------G--S--
Sequence 2 AGNQEQEFLKYQQEQG----------------------------GHQSQK

Sequence 1 ERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAI
           ----QEEE-EGG-I-SGFT-EFLE-AF-VD--QI--NL-GENE-E--GAI
Sequence 2 GKHQQEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAI

Sequence 1 VTVRGGLRILSP---DGTRGADEEEEYDED---QYEYHEQDGRRGRGSRG
           VTV-GGL----P----------EEEE--ED---Q---------R-RGS--
Sequence 2 VTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQS

Sequence 1 GG--NGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWL
           ----NGI-ETICT-----NIG---SP-IY-PQ---------L----L-WL
Sequence 2 KSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWL

Sequence 1 GLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEE
           -LSAE-G-L--NA-FVPHYN-NA-SIIYAL-GRA--QVV--NG-RV-D-E
Sequence 2 RLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGE

Sequence 1 LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNL
           LQEG-VL-VPQNF-VA--SQS-NFEYV-FKT---P-I---AG-NS----L
Sequence 2 LQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNAL

Sequence 1 PEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA
           PEEV------L---QARQ-KNNNPFKF-VPP-----RAVA
Sequence 2 PEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA



Alignment 7
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 56.04 (297/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISF--RQQPEENACQFQRLNAQRPDNRIES
           MAKL----F--CFL--------F--R-QP--N-CQ-Q-LNA--PDNRIES
Sequence 2 MAKLV---FSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIES

Sequence 1 EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGR
           EGG-IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-
Sequence 2 EGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGK

Sequence 1 GYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVH
           G-FG-I-PGCPST-EEP-Q---R-QS-RP-------------QD-HQK--
Sequence 2 GIFGMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDRHQKIY

Sequence 1 RFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNL
           -F-EGDLIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-L
Sequence 2 NFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYL

Sequence 1 AGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRR
           AGN-EQEFL-YQQ-------------------------------G--S--
Sequence 2 AGNQEQEFLKYQQEQG----------------------------GHQSQK

Sequence 1 ERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAI
           ----QEEE-EGG-I-SGFT-EFLE-AF-VD--QI--NL-GENE-E--GAI
Sequence 2 GKHQQEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAI

Sequence 1 VTVRGGLRILSP---DGTRGADEEEEYDED---QYEYHEQDGRRGRGSRG
           VTV-GGL----P----------EEEE--ED---Q---------R-RGS--
Sequence 2 VTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQS

Sequence 1 GG--NGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWL
           ----NGI-ETICT-----NIG---SP-IY-PQ---------L----L-WL
Sequence 2 KSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWL

Sequence 1 GLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEE
           -LSAE-G-L--NA-FVPHYN-NA-SIIYAL-GRA--QVV--NG-RV-D-E
Sequence 2 RLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGE

Sequence 1 LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNL
           LQEG-VL-VPQNF-VA--SQS-NFEYV-FKT---P-I---AG-NS----L
Sequence 2 LQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNAL

Sequence 1 PEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA
           PEEV------L---QARQ-KNNNPFKF-VPP-----RAVA
Sequence 2 PEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA



Alignment 8
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 56.98 (302/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           MAKL--LS-CF----L-------R-Q---N-CQ-Q-LNA--PDNRIESEG
Sequence 2 MAKLV-LSLCF---LLFSGCFALREQAQQNECQIQKLNALKPDNRIESEG

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G-IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-G-
Sequence 2 GFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGI

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           FG-IFPGCPSTY-EP-----R--SQRP-------------QD-HQKVHRF
Sequence 2 FGMIFPGCPSTYQEPQESQQRGRSQRP-------------QDRHQKVHRF

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGDLIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-LAG
Sequence 2 REGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N-EQEFL-YQQQ------------------------------G--S----
Sequence 2 NQEQEFLKYQQQQQG---------------------------GSQSQKGK

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           --QEEE-EG-NI-SGF-PEFL--AF-V---QIV-NL-GENE-E--GAIVT
Sequence 2 Q-QEEENEGSNILSGFAPEFLKEAFGVN-MQIVRNLQGENEEEDSGAIVT

Sequence 1 VRGGLRILSPDGTRGADEEEEYDED-QYEYHEQDGRRGRGSRGGGNGIEE
           V-GGLR---P-------EE---DE--Q----E-D----R-S----NGI-E
Sequence 2 VKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDE

Sequence 1 TICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNL
           TICT-----NIG-N-SP-IY-PQ---------L----L--L-LSA-YG-L
Sequence 2 TICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSL

Sequence 1 YRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVV
           --NA-FVPHY--NA-SIIYAL-GRA-VQVV--NG-RV-D-ELQEG-VL-V
Sequence 2 RKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIV

Sequence 1 PQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSY
           PQNFAVA-KSQS-NFEYV-FKT--RPSI-N-AG-NS----LPEEV-----
Sequence 2 PQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTF

Sequence 1 GLPREQARQLKNNNPFKFFVPPFQQSPRAVA
           -L---QARQ-KNNNPF-F-VPP-----RAVA
Sequence 2 NLKSQQARQVKNNNPFSFLVPPQESQRRAVA



Alignment 9
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 56.98 (302/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           MAKL--LS-CF----L-------R-Q---N-CQ-Q-LNA--PDNRIESEG
Sequence 2 MAKLV-LSLCF---LLFSGCFALREQAQQNECQIQKLNALKPDNRIESEG

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G-IETWNPNN--F-CAGVALSR--L-RNALRRP-Y-N-PQEI-IQQG-G-
Sequence 2 GFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGI

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           FG-IFPGCPSTY-EP-----R--SQRP-------------QD-HQKVHRF
Sequence 2 FGMIFPGCPSTYQEPQESQQRGRSQRP-------------QDRHQKVHRF

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGDLIAVPTGVA-W-YN--DT-VVAVS--DTN---NQLDQ-PRRF-LAG
Sequence 2 REGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N-EQEFL-YQQQ------------------------------G--S----
Sequence 2 NQEQEFLKYQQQQQG---------------------------GSQSQKGK

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           --QEEE-EG-NI-SGF-PEFL--AF-V---QIV-NL-GENE-E--GAIVT
Sequence 2 Q-QEEENEGSNILSGFAPEFLKEAFGVN-MQIVRNLQGENEEEDSGAIVT

Sequence 1 VRGGLRILSPDGTRGADEEEEYDED-QYEYHEQDGRRGRGSRGGGNGIEE
           V-GGLR---P-------EE---DE--Q----E-D----R-S----NGI-E
Sequence 2 VKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDE

Sequence 1 TICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNL
           TICT-----NIG-N-SP-IY-PQ---------L----L--L-LSA-YG-L
Sequence 2 TICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSL

Sequence 1 YRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVV
           --NA-FVPHY--NA-SIIYAL-GRA-VQVV--NG-RV-D-ELQEG-VL-V
Sequence 2 RKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIV

Sequence 1 PQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSY
           PQNFAVA-KSQS-NFEYV-FKT--RPSI-N-AG-NS----LPEEV-----
Sequence 2 PQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTF

Sequence 1 GLPREQARQLKNNNPFKFFVPPFQQSPRAVA
           -L---QARQ-KNNNPF-F-VPP-----RAVA
Sequence 2 NLKSQQARQVKNNNPFSFLVPPQESQRRAVA



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 44.15 (234/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           ------------------------Q----N-CQ---L-A--PDNRI--E-
Sequence 2 --------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEA

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G-IETWN-N---F-CAGVA-SR----RN-L--P-YSNAPQ-I-I-QGRG-
Sequence 2 GQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV

Sequence 1 FGLIFPGCPSTYEE---PAQQGR-------RYQSQ---------------
           -G--F-GCP-T-EE-----QQGR-------R-Q-Q---------------
Sequence 2 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ

Sequence 1 -RPPR----------RLQEEDQSQQ----------QQDSHQKVHRFNEGD
           -R--R----------R-QE--Q-QQ----------Q-D-HQK--R--EGD
Sequence 2 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGD

Sequence 1 LIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQ
           --A-P-GVA-W-YND-D---VAV-L-------NQLDQ-PR-F-LAGN-E-
Sequence 2 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN

Sequence 1 EF-LRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQ
           EF----Q-Q-RQ------P-----P--RPR-------------------Q
Sequence 2 EFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQ------------------Q

Sequence 1 EEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRG
           E----G-N-FSGF----L-QA--V-------NL-G-N-------I--VRG
Sequence 2 EQQGNGNNVFSGFNTQLLAQALNVNE-ETARNLQGQNDNRNQ--IIQVRG

Sequence 1 GLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICT
           -L----P---RG---E-E--E-Q-E---Q--R---G-----NG-EET-C-
Sequence 2 NLDFVQPP--RGR-QEREHEERQQEQLQQE-RQQQGEQLMANGLEETFCS

Sequence 1 ACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWLGLSAEYGNLYR
           ---K-NIG------I--P---R--T-N-H--NL-ILR-L-LSAE-G--YR
Sequence 2 LRLKENIGNPERADIFSPRAGRISTLNSH--NLPILRFLRLSAERGFFYR

Sequence 1 NALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQ
           N----PH-N-NAHS--Y--RG-A-VQVV--NG----D-E-Q-G----VPQ
Sequence 2 NGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQ

Sequence 1 NFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGL
           N--V--------FEY-AFKT-----I---AG--SF---LP-EV-AN-Y--
Sequence 2 NHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQI

Sequence 1 PREQARQLKNNNPFKFFVPPFQQSPRAVA
           -REQARQLK-N----------QQ--RAV-
Sequence 2 SREQARQLKYNRQETIALSSSQQR-RAVV



Alignment 11
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 44.91 (238/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           MAK----S-C------G-------Q----N-CQ---L-A--PDNRI--E-
Sequence 2 MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEA

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G-IETWN-N---F-CAGVA-SR----RN-L--P-YSNAPQ-I-I-QGRG-
Sequence 2 GQIETWNFNQEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV

Sequence 1 FGLIFPGCPSTYEEP---AQQGR-----------------RYQSQRPP--
           -G--F-GCP-T-EE-----QQGR-----------------R-Q-Q-----
Sequence 2 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ

Sequence 1 --------RRLQEEDQSQQQQ----------------DSHQKVHRFNEGD
           --------R--QEE---Q-QQ----------------D-HQK--R--EGD
Sequence 2 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDRHQKTRRIREGD

Sequence 1 LIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQ
           --A-P-GVA-W-YND-D---VAV-L-------NQLDQ-PR-F-LAGN-E-
Sequence 2 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN

Sequence 1 EF-LRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQ
           EF----Q-Q-RQ------P-----P--RPR-------------------Q
Sequence 2 EFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQ------------------Q

Sequence 1 EEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRG
           E----G-N-FSGF----L-QA--V-------NL-G-N-------I--VRG
Sequence 2 EQQGSGNNVFSGFNTQLLAQALNVNE-ETARNLQGQNDNRNQ--IIRVRG

Sequence 1 GLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICT
           -L----P---RG---E-E--E-Q-E---Q--R---G-----NG-EET-C-
Sequence 2 NLDFVQPP--RGR-QEREHEERQQEQLQQE-RQQQGGQLMANGLEETFCS

Sequence 1 ACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWLGLSAEYGNLYR
           ---K-NIG------I--P---R--T-N-H--NL-ILR-L-LSAE-G--YR
Sequence 2 LRLKENIGNPERADIFSPRAGRISTLNSH--NLPILRFLRLSAERGFFYR

Sequence 1 NALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQ
           N----PH-N-NAHS--Y--RG-A-VQVV--NG----D-E-Q-G----VPQ
Sequence 2 NGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQ

Sequence 1 NFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGL
           N--V--------FEY-AFKT-----I---AG--SF---LP-EV-AN-Y--
Sequence 2 NHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQI

Sequence 1 PREQARQLKNNNPFKFFVPPFQQSPRAVA
           -REQARQLK-N----------QQ--RAV-
Sequence 2 SREQARQLKYNRQETIALSSSQQR-RAVV



Alignment 12
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 46.23 (245/530)
Sequence 1 MAKLLELSFCFCFLVL----GASSISF-RQQPEENACQFQRLNAQRPDNR
           MAK---LS---C--------G----S--RQQ-----CQ--RL-A--P-NR
Sequence 2 MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNR

Sequence 1 IESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQ
           IE-E-G-IE-W-PN-Q---CAGVA--R-----N-L--P-YSNAPQ---I-
Sequence 2 IEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIA

Sequence 1 QGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQ
           -GRG--G--FPGCP-T-EE---Q-----SQ---RR---------QQD-HQ
Sequence 2 RGRGITGVLFPGCPETFEESQRQ-----SQQGQRR-------EFQQDRHQ

Sequence 1 KVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRR
           K---F-EGD-IA-P-GVA-W-YND----VVA--L-DT-NN-NQLDQ-PR-
Sequence 2 KIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNPRN

Sequence 1 FNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQH
           F-LAGN---EF-R-Q-Q-------------Y--H---RR-------RG-H
Sequence 2 FYLAGNPDDEF-RPQGQQE-----------YEQH---RRQQQHQQRRGEH

Sequence 1 SRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEE
           ------G----D-G-N-FSGF--EFL--AF-VD-------L--EN-----
Sequence 2 ------GEQQRDLGNNVFSGFDAEFLADAFNVDT-ETARRLQSEND--HR

Sequence 1 GAIVTVRG-GLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGG-
           G-IV-V-G--L----P---R---E-EE--E---E--E----R----RGG-
Sequence 2 GSIVRVEGRQLQVIRPRWSREEQEHEERKERERE-RESESERRQSRRGGR

Sequence 1 -GNGIEETICTACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWL
           --NG-EETICT-----NIG------IY-----R--T-N-H--NL-ILRWL
Sequence 2 DDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNSH--NLPILRWL

Sequence 1 GLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEE
           -LSAE-G-LY--AL-VPH-N-NAHS--YALRGRA-VQVVD--G--V-D-E
Sequence 2 QLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDE

Sequence 1 LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNL
           L-EG--L--PQNFAV------E-FE-V-FKT---------AG--S-I--L
Sequence 2 LREGQLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRAL

Sequence 1 PEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA----
           PEEV--N----PRE-AR-LK-N------V-----S-R-------
Sequence 2 PEEVLVNAFQIPREDARRLKFNRQESTLVRSRSRSSRSERRAEV



Alignment 13
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 45.47 (241/530)
Sequence 1 MAKLLELSFCFCFLVL--GASSISF---RQQPEE-NACQFQRLNAQRPDN
           MAKL---SF--C-LVL--G---I-----RQQ------C---RLNA--P-N
Sequence 2 MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTN

Sequence 1 RIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFI
           RIE-E---IE-W--N-Q-F-CAGVA--R-----N-L--P-YSNAP--I-I
Sequence 2 RIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYI

Sequence 1 QQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQ-QQDS
           --GRG--G--FPGCP-T-E-P-QQ----Q-QR-----Q---QSQ---QD-
Sequence 2 ERGRGITGVLFPGCPETFEDPQQQSQ--QGQR-----QGQGQSQRSEQDR

Sequence 1 HQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFP
           HQK---F-EGD-IA-P-GVA-W-YND-D--VV-VSL--TNN--NQLD--P
Sequence 2 HQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENP

Sequence 1 RRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRG
           R-F-LAGN---E--R--QQ----RRR------------------------
Sequence 2 RHFYLAGNPDDEHQRQGQQQFGQRRR----------------------QQ

Sequence 1 QHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESE
           QHS--E---QE---EG-N-FSGF--EFL--AF-VD-------L-------
Sequence 2 QHSHGEQGEQEQQGEGNNVFSGFDAEFLADAFNVD-VDTARRL--QSNQD

Sequence 1 EEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGG
           ----IV-V-G-L----P---R---E--E--E---E--E----R--G-RG-
Sequence 2 KRRNIVKVEGRLQVVRPERSRQEWERQERQERESE-QERERQRRQGGRGR

Sequence 1 G-NGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGL
           --NG-EETIC------NI-------IY--Q-----------L--LRWL-L
Sequence 2 DVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQL

Sequence 1 SAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQ
           SAE-G-L-R--L-VPH-N-NAHS--YA-RGRA-VQVVD-NGN-V-D-EL-
Sequence 2 SAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELR

Sequence 1 EGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPE
           -G-VL--PQNFAVA----SE-FE-VAFKT-----I---AG--S-I--LP-
Sequence 2 QGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPD

Sequence 1 EVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA----------
           -V-AN-----RE-AR-LK-N------V-----S---------------
Sequence 2 DVLANAFQISREEARRLKYNRQETTLVRSSRSSSERKRRSESEGRAEA



Alignment 14
Sequence 1:
Sequence 2: Allergen Jug n 4.0101, Sequence: A0A1L6K371
Sequence identity: 47.55 (252/530)
Sequence 1 MAK--LLELSFCFCFLVLGASSISF-RQQPEENACQFQRLNAQRPDNRIE
           MAK--LL--S-C---LV-G----S--RQQP----C---RL-A--P-NRIE
Sequence 2 MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIE

Sequence 1 SEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQG
           -E-G-IE-W-PNNQ-F-CAGVA--R-----N-L--P-YSNAPQ---I--G
Sequence 2 AEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKG

Sequence 1 RGYFGLIFPGCPSTYEEPAQQGRRYQSQ-RPPRRLQEEDQSQQQQDSHQK
           RG--G--FPGCP-T-EE--QQG---QS--RP--R---------Q-D-HQK
Sequence 2 RGITGVLFPGCPETFEE-SQQG---QSRIRPSLR-----SASFQRDRHQK

Sequence 1 VHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRF
           ---F-EGD-IA-P-GVA-W-YND-DT-VVAV-L-DT-NN-NQLDQ-PR-F
Sequence 2 IRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNNANQLDQNPRNF

Sequence 1 NLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHS
           -LAGN---EF-R-Q-Q-------------Y--H---RR---------QH-
Sequence 2 YLAGNPDDEF-RPQGQQE-----------YEQH---RRQQ-------QHQ

Sequence 1 RRE-RAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEE
           -R----GQ-----G-N-FSGF---FL--AF-VD-------L--EN-----
Sequence 2 QRHGEPGQQQRGSGNNVFSGFDADFLADAFNVDT-ETARRLQSENDHRR-

Sequence 1 GAIVTVRG-GLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGG-
           --IV-V-G--L----P---R---E-EE--E---E--E----R----RGG-
Sequence 2 -SIVRVEGRQLQVIRPRWSREEQEREERKERERE-RESESERRQSRRGGR

Sequence 1 -GNGIEETICTACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWL
           --NG-EETICT-----NIG------IY-----R--T-N-H-L----LRWL
Sequence 2 DDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTANSHTLP--VLRWL

Sequence 1 GLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEE
           -LSAE-G-LY--AL-VPH-N-NAHS--YALRGRA-VQVVD--G--V-D-E
Sequence 2 QLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDE

Sequence 1 LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNL
           L-EG--L--PQNFAV------E-FE-V-FKT---------AG--S-I--L
Sequence 2 LREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRAL

Sequence 1 PEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA-------
           PEEV-AN----PRE-AR-LK-N------V-----S-R----------
Sequence 2 PEEVLANALQIPREDARRLKFNRQESTLVRSRPSSSRSSRSERRAEV



Alignment 15
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 46.04 (244/530)
Sequence 1 MAKLLELSFCFCFLVL----GASSISF-RQQPEENACQFQRLNAQRPDNR
           MAK---LS----FL------G----S--RQQ-----CQ--RL-A--P-NR
Sequence 2 MAKPILLSI-YLFLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNR

Sequence 1 IESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQ
           IE-E-G-IE-W-PNNQ-F-CAGVA--R-----N-L--P-YSNAPQ---I-
Sequence 2 IEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIA

Sequence 1 QGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQ
           -GRG--G--FPGCP-T-EE---Q----QS---------------QQD-HQ
Sequence 2 RGRGITGVLFPGCPETFEESQRQSQQGQSR------------EFQQDRHQ

Sequence 1 KVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRR
           K---F-EGD-IA-P-GVA-W-YND----VVA-SL-DTNNN-NQLDQ-PR-
Sequence 2 KIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRN

Sequence 1 FNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQH
           F-LAGN---EF----QQ-----RR-----------------R--RP-G-H
Sequence 2 FYLAGNPDDEFRPQGQQEYEQHRR--------------QQQRQQRP-GEH

Sequence 1 SRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEE
           ------GQ-----G-N-FSGF---FL--AF-VD-------L--EN-----
Sequence 2 ------GQQQRGLGNNVFSGFDADFLADAFNVDT-ETARRLQSENDHRR-

Sequence 1 GAIVTVRG-GLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGG-
           --IV-V-G--L----P---R---E-EE--E---E--E----R----RGG-
Sequence 2 -SIVRVEGRQLQVIRPRWSREEQEREERKERERE-RESESERRQSRRGGR

Sequence 1 -GNGIEETICTACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWL
           --NG-EETICT-----NIG------IY-----R--T-N-H-L----LRWL
Sequence 2 DDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNSHTLP--VLRWL

Sequence 1 GLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEE
           -LSAE-G-LY--AL-VPH-N-NAHS--YALRGRA-VQVVD--G--V-D-E
Sequence 2 QLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDE

Sequence 1 LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNL
           L-EG--L--PQNFAV------E-FE-V-FKT---------AG--S-I--L
Sequence 2 LREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRAL

Sequence 1 PEEVVANSYGLPREQARQLKNNNPFKFFV---PPFQQSPRAVA----
           PEEV-A-----PRE-AR-LK-N------V---P----S-R-------
Sequence 2 PEEVLATAFQIPREDARRLKFNRQESTLVRSRPSRSRSSRSERRAEV



Alignment 16
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 39.43 (209/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQ--PEENACQFQRLNAQRPDNRIES
           -----------C-L-L-------RQ---------Q---L-A--PDN-I-S
Sequence 2 -----------CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQS

Sequence 1 EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGR
           E-G--E-WNP----F--AGVA--R-----N-L--P-Y-NAPQ-I-I--GR
Sequence 2 EAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGR

Sequence 1 GYFGLIFPGCPSTYEE--PAQ-QGRRYQSQ-RPPRRL----QEEDQSQQQ
           G--G--FPGC--T-E---P-Q-Q----Q-Q-RP-R------Q---Q---Q
Sequence 2 GVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQ

Sequence 1 QDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLD
           QD-HQK-----EGD-IA-P-GVA-W-YN------VAVSL-D-NN--NQLD
Sequence 2 QDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLD

Sequence 1 QFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR
           Q-PRRF-LAGN---EF---QQQ-RQ-------------------------
Sequence 2 QVPRRFYLAGNPQDEF-NPQQQGRQQQQQQ--------------------

Sequence 1 PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGEN
           --GQ--------------G-NIFSGF----L-QA--V-------NL-G--
Sequence 2 -QGQQG-----------NGNNIFSGFDTQLLAQALNVNP-ETARNLQGQD

Sequence 1 ESEEEGAIVTVRGGLRILSP----DGTRGADEEEEYDEDQYEYHEQDGRR
           ----E--IV-V-G-L---SP-----G-RG-D-E----E-Q---------R
Sequence 2 DNRNE--IVRVQGQLDFVSPFSRSAGGRG-DQERQQEEQQSQREREEKQR

Sequence 1 GRGSRGGG---NGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLN
           -----GGG---NG-EET-C-A----NIG-------Y-PQ-----------
Sequence 2 EQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNH

Sequence 1 LLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNG
           L-ILR-L-LSAE-G-LY-NA---PH--TNA----YA-RG-A-VQVV--NG
Sequence 2 LPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENG

Sequence 1 NRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGE
           ----D-E--EG-----PQN-AV------E-FEY--F-TD--------AG-
Sequence 2 DPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGR

Sequence 1 NSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA---
           -S----LP-EV--N-----R--AR-LK-N---------------------
Sequence 2 TSVLRALPDEVLQNAFRISRQEARNLKYNRQESRLLSATSPPRGRLMSIL

Sequence 1 --
           --
Sequence 2 GY



Alignment 17
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 40.38 (214/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQ-PEENACQFQRLNAQRPDNRIESE
           -----------CFL-L-------RQ-------CQ--RL-A--PDNR-E-E
Sequence 2 --------LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYE

Sequence 1 GGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRG
           -G--E-W-PN---F-CAGVAL-R-----N-L--P-YSNAPQ-I---QG-G
Sequence 2 AGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEG

Sequence 1 YFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHR
           --G---PGCP-TY--P-QQGR---------------QS---QD-HQK--R
Sequence 2 MTGISYPGCPETYQAP-QQGR------------QQGQSGRFQDRHQKIRR

Sequence 1 FNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLA
           F--GD-IA-P-GVA-W-YN-----VV-V-L-D--N--NQLD--PR-F-LA
Sequence 2 FRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLA

Sequence 1 GNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRE
           GN----F---QQQ--QSR--------------------------------
Sequence 2 GNPKDVF--QQQQQHQSR--------------------------------

Sequence 1 RAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIV
           ---------G-N-FSGF--E-L--AFQVD-R-----L--E------G-IV
Sequence 2 ---------GRNLFSGFDTELLAEAFQVDER-LIKQLKSEDN---RGGIV

Sequence 1 TVRGG-LRILSPD---GTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGN
           -V----LR---P------RG---EEE-----------D-----------N
Sequence 2 KVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRD-----------N

Sequence 1 GIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAE
           GIEETICT---K-NI-------IY-P----------LNL-IL-WL-LS-E
Sequence 2 GIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVE

Sequence 1 YGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGH
           -G-LY-NAL--PH-N-N-HSIIY---G---VQVVD--GNRV-D-E--EG-
Sequence 2 KGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQ

Sequence 1 VLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVV
           -LVVPQNFAV------E-FE---FKT--R------AG--S-----PEEV-
Sequence 2 MLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVL

Sequence 1 ANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA-
           AN-----RE-AR--K-NN------------------
Sequence 2 ANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA



Alignment 18
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 42.45 (225/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQ-PEENACQFQRLNAQRPDNRIESE
           MA----LS---C-L-L-------RQQ----N-CQ---L-A--PDNR-E-E
Sequence 2 MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYE

Sequence 1 GGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRG
           -G--ETW-PN---F-CAGVA--R-----N-LR-P-YSNAP----I--G-G
Sequence 2 AGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEG

Sequence 1 YFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHR
           --G---PGCP-TY--P-QQG------------Q---QS---QD-HQK--R
Sequence 2 MTGTLIPGCPETYQAP-QQG------------QQHGQSSRFQDKHQKIQR

Sequence 1 FNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLA
           F--GD-IA-P-GVA-W-YN-----VV-V-L-D--N--NQLD--PR-FNLA
Sequence 2 FRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLA

Sequence 1 GNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRE
           GN-E-EF---QQQ-----------------SR-RR---------------
Sequence 2 GNPEDEFQQQQQQ----------------QSRGRR---------------

Sequence 1 RAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIV
           ---Q-------NIF-GF----L---FQV-----V--L---NE----GAIV
Sequence 2 ---QSQQKSCNNIFCGFDTKILAEVFQVE-QSLVKQL--QNEKDNRGAIV

Sequence 1 TVRGGLRILSP---DGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNG
           -V-G-L----P------RG---EEE-----YE-----GRRGR------NG
Sequence 2 KVKGDLQVIRPPRRQSERGFESEEE---SEYER----GRRGRD-----NG

Sequence 1 IEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEY
           -EETICT---K-NI-------IY-P----------LNL-IL-WL-LSAE-
Sequence 2 LEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAER

Sequence 1 GNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHV
           G-L--NAL-VPH-N-NAHSI-Y---G-A-VQVVD--GN-V-D-E--EG--
Sequence 2 GVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQI

Sequence 1 LVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVA
           -VVPQNFAV--------FE---FKT--R--I---AG--S-----PEEV-A
Sequence 2 FVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLA

Sequence 1 NSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA-
           N-----RE-AR--K-NN------------------
Sequence 2 NAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA



Alignment 19
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 37.92 (201/530)
Sequence 1 -----------MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNA
           --------------LL-------------S-----QQ-----CQ-Q-LNA
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 QRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAP
           --P--RIESE-G--E-W--N-----CA-VA--R-------L--P-Y-NAP
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAP

Sequence 1 QEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQ
           ------QG-G--G--FPGCP-T--E--Q---R--S-R----------SQQ
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQS--RSRSER----------SQQ

Sequence 1 QQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQL
           ----HQKV----EGD-IA-P-GVA-W-YN------V-V-L-D--N--NQL
Sequence 2 SGEQHQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQL

Sequence 1 DQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREF
           DQ--R-F-L-G---QE-----Q-S-QSR-RS-------------------
Sequence 2 DQYLRKFVLGGSPQQEI----QGSGQSRSRS-------------------

Sequence 1 RPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGE
           ----Q-SRR---GQ-------NI-S-F--E-L-Q-F--D--Q----L---
Sequence 2 --QSQSSRRGQQGQQ----SNNILSAFDEEILAQSFNIDT-QLARRL--Q

Sequence 1 NESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRG
           -E----G-IV-V---L--LSP-------------E---EY-E---RR-R-
Sequence 2 KEKRQRGIIVRVQEDLEVLSP----------HRQEQEQEYEEERERRQR-

Sequence 1 SRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRW
           -----NG-EET-CT---K-NI--------Y-P----------LNL-ILR-
Sequence 2 -----NGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRF

Sequence 1 LGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDE
           L-LSA--G-L-R-A---PH-N-NAHSI-Y--RG----Q-V--NG--V-DE
Sequence 2 LQLSAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDE

Sequence 1 ELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDN
           E--EG---VVPQNFAV-----S--FE-V-FKT---------AG--S----
Sequence 2 EIREGQLVVVPQNFAVVKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRA

Sequence 1 LPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA---------
           LP--V--NS----RE-AR-LK----------P---S-R------------
Sequence 2 LPLDVIKNSFDISREDARRLKESRSETTIFAPGSSSQRKSQSERERQRER

Sequence 1 ------
           ------
Sequence 2 EEREIH



Alignment 20
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 34.72 (184/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISF-------------RQQPE-ENACQFQR
           M---L-LSF--C--VL--S-----------------RQQ------C--QR
Sequence 2 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR

Sequence 1 LNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYS
           L-A--P--R--SE-G--E-W-----EF-C-G----R-V-----L--P-YS
Sequence 2 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPR-RLQEED
           NAP---F--QGRG--G---PGCP-T-----------QSQR----R--E--
Sequence 2 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEF-EYPQSQRGRHSRQSESE

Sequence 1 QSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNN
           ------D-HQK--R--EGD-I--P-GV--W--ND---D---V-L-D-N--
Sequence 2 EESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSY

Sequence 1 DNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRRE
           --QLD---R-F-LAG----E--R-----RQSR------------------
Sequence 2 HKQLDENVRSFFLAGQSQRE-TREEGSDRQSRE-----------------

Sequence 1 EREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQN
           -------------------E---G-NI-SGF--E-L---F---DR-----
Sequence 2 ---------------SDDDEALLGANILSGFQDEILHELFRDVDRETISK

Sequence 1 LWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGR
           L-GEN-----G-IV-----L----P------D-EEEY----------D-R
Sequence 2 LRGEND--QRGFIVQAQD-LKLRVPQ-----DFEEEYERER-----GDRR

Sequence 1 RGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLL
           RG-G--G--NG-E---C------N-----------P------------L-
Sequence 2 RGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLP

Sequence 1 ILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNR
           IL--L-LSA----LY-NA---P--N-NAHS--Y--RG---VQVV---G--
Sequence 2 ILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKS

Sequence 1 VYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENS
           V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-----------G--S
Sequence 2 VFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTS

Sequence 1 FIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA-----
           -----P-EV-ANSY------A--LKN---------PFQ------------
Sequence 2 VLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFSI

Sequence 1 -
           -
Sequence 2 V



Alignment 21
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 36.98 (196/530)
Sequence 1 -----------MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNA
           --------------LL-------------S-----QQ-----CQ-Q-LNA
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 QRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAP
           --P--RIESE-G--E-W--N-----CA-VA--R-------L--P-Y-NAP
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAP

Sequence 1 QEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQ
           ------QG-G--G--FPGCP-T--E--Q---R-Q--R--R-------SQQ
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQSQSRSQHSRSER-------SQQ

Sequence 1 QQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQL
           ----HQKV----EGD-IA-P-GVA-W-YN------V-V-L-D--N--NQL
Sequence 2 SGEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQL

Sequence 1 DQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREF
           DQ--R-F-L-G---QE-----Q---QSR------------SR--------
Sequence 2 DQYLRKFVLGGSPQQEIQGGGQSWSQSRS-----------SR--------

Sequence 1 RPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGE
           ---GQ-S--------------NI-S-F--E-L-Q-F--D--Q-V--L---
Sequence 2 --KGQQS-------------NNILSAFDEEILAQSFNIDT-QLVKKL--Q

Sequence 1 NESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRG
           -E----G-IV-V---L--LSP--------E-EY-----------------
Sequence 2 REEKQRGIIVRVKEDLQVLSPQ-----RQEKEYSD---------------

Sequence 1 SRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRW
           -----NG-EET-CT---K-NI--------Y-P----------LNL-ILR-
Sequence 2 -----NGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRF

Sequence 1 LGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDE
           L-LS-E-G-LY-NA---PH-N-NAHSI-Y--RG----Q-V--NG--V-DE
Sequence 2 LQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDE

Sequence 1 ELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDN
           E--EG---VVPQNFAV-----S--FE-V-FKT-----I---AG--S----
Sequence 2 EIREGQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRG

Sequence 1 LPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA
           LP--V--NS----RE-A--LK----------P---S-R---
Sequence 2 LPLDVIQNSFDISREDAWNLKESRSEMTIFAPGSRSQRQRN



Alignment 22
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 35.47 (188/530)
Sequence 1 -----------------MAKLLELSFCFCFLVLGASSISFRQQPEENACQ
           -----------------------L-----F------S-----------C-
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR

Sequence 1 FQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP
           --RL-AQ-P--R-ESE-G--E-W--NNQ-FECAGVA--R-V-----L--P
Sequence 2 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP

Sequence 1 FYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQE
           -Y-NAPQ------GRG--G---PGC--T-E---Q----------PR----
Sequence 2 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQ----------PR----

Sequence 1 EDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTN
           -D------D-HQKV--F--GD--A-P-G---W-YN--------V-L-DT-
Sequence 2 QDRRRRFMDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTG

Sequence 1 NNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPR
           N--NQLDQ--R-F-LAGN---------Q--RQS--------------RP-
Sequence 2 NAANQLDQTFRHFFLAGN--------PQGGRQSY-----------FGRPQ

Sequence 1 REEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIV
           -E----------------------E--NIF-GF--E-L--AF-VD--Q--
Sequence 2 TEK------------------QQGETKNIFNGFDDEILADAFGVD-VQTA

Sequence 1 QNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQD
           --L-G-------G-IV-----L-I--P----G--EEE----D-Y------
Sequence 2 RRLKGQDDLR--GRIVRAER-LDIVLP----GEEEEERWERDPY------

Sequence 1 GRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLN
           ---------G-NG-EET-CTA----N---------Y-P----------L-
Sequence 2 --------SGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLT

Sequence 1 LLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNG
           L--L-WL-LSAE-G-LYRN-L--PH-N-NAHSIIY--RG----QVV---G
Sequence 2 LPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTG

Sequence 1 NRVYDEELQEGHVLVVPQNFAVAGK-SQSENFEYVAFKTDSRPSIANFAG
           --V-D----EG----VPQN--VA---SQ-E--E---FKT---------AG
Sequence 2 RSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAG

Sequence 1 ENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA--
           --S-I---PEEVV---Y---R--AR-LK-N--------------------
Sequence 2 RLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSR

Sequence 1 --------------------
           --------------------
Sequence 2 PMSYMPKPFEYVLDVIKSMM



Alignment 23
Sequence 1:
Sequence 2: Allergen Zan b 2.0102, Sequence: QYU76046
Sequence identity: 31.89 (169/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           ------------------------------------------------E-
Sequence 2 ------------------------------------------------EA

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G--E-W--NN----CA-VA--R-------L--P-Y-N--------QGRG-
Sequence 2 GVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGI

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           -G--FPGCP-TY----QQ----QS----------------QD-HQKV---
Sequence 2 HGAVFPGCPETYQDQQQQ----QSH--------QSEGSRSQDQHQKVRQL

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGD--A-PTG-A-W-YN------V-V-L-D--N-DNQLDQ--R-F---G
Sequence 2 REGDIVAMPTGSAHWIYNNGQSQLVLVALVDVGNSDNQLDQYLRKFYIGG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N--QE---Y-Q-S--SR--------------------------Q-S--E-
Sequence 2 NPQQELQGYSQ-SQGSRSY------------------------QGSQGE-

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           -G------GGNIF-GF----L--AF-V----I---L---------G-IV-
Sequence 2 -GGSRRSSGGNIFNGFDERLLADAFNVNP-EIIRRL--QKPQLPRGIIVR

Sequence 1 VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET
           V---L--L-P---RG--E-E-------E-------RGR------NG-EET
Sequence 2 VEEELEVLRPQ--RGEQEQEQ------EF------RGRD-----NGLEET

Sequence 1 ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY
           -CT---K-NI--------Y-P-----------NL--LRW--LSAE-GNLY
Sequence 2 YCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLY

Sequence 1 RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
           -NA---PH-N-N-HS--Y--RG---VQ-V--NGN-VYD----EG---VVP
Sequence 2 QNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVP

Sequence 1 QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG
           Q--AV--K------E---FKT---------AG-NS-I--LP--V--N---
Sequence 2 QGYAVLKKASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN---

Sequence 1 LPREQARQLKNNNPFKFFVPPFQQSPRAVA
           ------------------------------
Sequence 2 ------------------------------



Alignment 24
Sequence 1:
Sequence 2: Allergen Zan b 2.0101, Sequence: QYU76045
Sequence identity: 31.89 (169/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           ------------------------------------------------E-
Sequence 2 ------------------------------------------------EA

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G--E-W--NN----CA-VA--R-------L--P-Y-N--------QGRG-
Sequence 2 GVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGI

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           -G--FPGCP-TY----QQ----QS----------------QD-HQKV---
Sequence 2 HGAVFPGCPETYQDQQQQ----QSH--------QSEGSRSQDQHQKVRQL

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGD--AVPTG-A-W-YN------V-V-L-D--N-DNQLDQ--R-F---G
Sequence 2 REGDIVAVPTGSAHWIYNNGQSQLVLVALVDVGNSDNQLDQYLRKFYIGG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N--QE---Y-Q-S--SR--------------------------Q-S--E-
Sequence 2 NPQQELQGYSQ-SQGSRSY------------------------QGSQGE-

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           -G------GGNIF-GF----L--AF-V----I---L---------G-IV-
Sequence 2 -GSSRRSSGGNIFNGFDERLLADAFNVNP-EIIRRL--QKPQLPRGIIVR

Sequence 1 VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET
           V---L--L-P---RG---E-E------E-------RGR------NG-EET
Sequence 2 VEEELEVLRPQ--RGQEQEQEQ-----EF------RGRD-----NGLEET

Sequence 1 ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY
           -CT---K-NI--------Y-P-----------NL--LRW--LSAE-GNLY
Sequence 2 YCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLY

Sequence 1 RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
           -NA---PH-N-N-HS--Y--RG---VQ-V--NGN-VYD----EG---VVP
Sequence 2 QNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVP

Sequence 1 QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG
           Q--AV---------E---FKT---------AG-NS-I--LP--V--N---
Sequence 2 QGYAVLKRASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN---

Sequence 1 LPREQARQLKNNNPFKFFVPPFQQSPRAVA
           ------------------------------
Sequence 2 ------------------------------



Alignment 25
Sequence 1:
Sequence 2: Allergen Cuc ma 4.0101, Sequence: P13744
Sequence identity: 36.23 (192/530)
Sequence 1 ------------------MAKLLELSFCFCFLVLGASSISFRQQPEENAC
           -----------------------E------F-----------Q-P---AC
Sequence 2 MARSSLFTFLCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPR--AC

Sequence 1 QFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRR
           ----L-AQ-P--R-E-E----E-W---N-EF-CAGV---R---R---L--
Sequence 2 RLENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLL

Sequence 1 PFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQ
           P--SNAP--IF--QG-G--G---PGC--TY-------RR-QS--------
Sequence 2 PGFSNAPKLIFVAQGFGIRGIAIPGCAETYQTDL---RRSQSA-------

Sequence 1 EEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDT
           ---------D-HQK---F-EGDL--VP-GV--W-YN----D-V-----DT
Sequence 2 ----GSAFKDQHQKIRPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADT

Sequence 1 NNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRP
           -N--NQ-D---R-F-LAG------------------------------RP
Sequence 2 RNVANQIDPYLRKFYLAG------------------------------RP

Sequence 1 RREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQI
           ---ER--------SR----G-------GNIFSGF--EFLE-AFQ-D----
Sequence 2 EQVERGVEEWERSSRKGSSGEK----SGNIFSGFADEFLEEAFQIDG-GL

Sequence 1 VQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQ
           V--L-GE----E---IV-V------L-P--------EEE-----Y---E-
Sequence 2 VRKLKGEDD--ERDRIVQVDEDFEVLLPE-----KDEEERSRGRYIESES

Sequence 1 DGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQ--RWFTQNCH
           ------------NG-EETICT---K-NIG---------P---R--T-N-H
Sequence 2 ESE---------NGLEETICTLRLKQNIGRSVRADVFNPRGGRISTANYH

Sequence 1 DLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVD
           -L---ILR---LSAE-G-LY-NA---PHY--N-HS--YA-RG-A-VQVVD
Sequence 2 TLP--ILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVD

Sequence 1 SNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANF
           --G--V-D-E--EG-VL--PQNF-V--------FE--AFKT---------
Sequence 2 NFGQSVFDGEVREGQVLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNLL

Sequence 1 AGENSFIDNLPEEVVANSYGLPREQARQLK-NNNPFKFFVPPFQQSPRAV
           AG--S----LP--V--N-Y---RE-A--LK----------P---Q--R--
Sequence 2 AGRVSQMRMLPLGVLSNMYRISREEAQRLKYGQQEMRVLSPGRSQGRRE-

Sequence 1 A
           -
Sequence 2 -



Alignment 26
Sequence 1:
Sequence 2: Allergen Zan b 2.03, Sequence: QYS16039
Sequence identity: 32.26 (171/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           ------------------------------------------------E-
Sequence 2 ------------------------------------------------EA

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G--E-W--NNQ---CA-VA--R-----N-L--P-Y-N-P------QGRG-
Sequence 2 GVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGI

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           -G---PGCP-TY----QQ----QS---P------------QD-HQKV---
Sequence 2 HGAVIPGCPETYQDEQQQ---QQSFSYP------SEGSRSQDQHQKVRQI

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGD-IA-PTG-A-W-YN------V-V-L-D--N-DNQLDQ--R-F-L-G
Sequence 2 REGDIIALPTGSAHWIYNNGQSQLVLVALVDVGNSDNQLDQYFRKFYLGG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N---------Q---QS----------------R--ER-----G--SRR--
Sequence 2 NPQPQL----QGTSQSQG-------------GRYQERL--GGGDSSRR--

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           ----------NIF-GF----L--AF-V--------L---------G-I--
Sequence 2 --------SANIFNGFDERLLAEAFNVNP-ELIRRL--QRPQMQRGIIIR

Sequence 1 VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET
           V----R-L-P---RG----E-Y--D-Y------GR---------NG-EET
Sequence 2 VEEEFRVLTPQ--RG---QESYESDPY------GRY--------NGVEET

Sequence 1 ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY
           -CT-----NI--------Y-P----------LNL--LRWL-LSAE-GNLY
Sequence 2 LCTMRLRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKGNLY

Sequence 1 RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
           -NAL--PH-N-NAHSI-Y--RG---VQ-V--NGN-V-D-E--EG---VVP
Sequence 2 KNALTAPHWNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIREGQLIVVP

Sequence 1 QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG
           Q-FAV---------E---FKT---------AG--S----LP--V--N---
Sequence 2 QGFAVVKRASNRGLEWISFKTNDYAMTNQLAGRVSVLRALPLDVIQN---

Sequence 1 LPREQARQLKNNNPFKFFVPPFQQSPRAVA
           ------------------------------
Sequence 2 ------------------------------



Alignment 27
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 36.04 (191/530)
Sequence 1 MAKLLELSFCFCFLVLGASS--ISFRQ----------QPEENACQFQRLN
           M---L-LSF--C--VL--S------R-----------Q-----C--QRL-
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLT

Sequence 1 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PQEIFIQQGRGYFGLIFPGCPST------YEEPA----QQGRRYQSQRPP
           P---F--QGRG--G---PGCP-T-------E-P-----Q--R---S----
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS

Sequence 1 RRLQEEDQSQQQQ-------------------------------------
           R--Q---QS-----------------------------------------
Sequence 2 RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR

Sequence 1 ------------DSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSL
           ------------D-HQK--R---GD-I--P-GV--W--ND-D-D-----L
Sequence 2 TRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITL

Sequence 1 TDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPH
           -D-N---NQLD---R-F-LAG-----------QS-QSR------------
Sequence 2 YDANSFQNQLDGNVRNFFLAG-----------QSKQSRE-----------

Sequence 1 SRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDD
           ---RR--R--R--G-----------E-----NI--GF--E-L---F---D
Sequence 2 --DRRSQRQTREEGSDRQSRESDDDEALLEANILTGFQDEILQEIFRNVD

Sequence 1 RQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEY
           ------L-G-N-----G-IV--R--L----P---------EEY-E---E-
Sequence 2 QETISKLRGDND--QRGFIVQARD-LKLRVP---------EEYEE---EL

Sequence 1 HEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNC
           ----G-R-RG--G--NG-E---C----K-N-----------P--------
Sequence 2 QRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTV

Sequence 1 HDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVV
           ---NL-IL----LSA----LY-NA---P--N-NAHS--Y--RG---VQVV
Sequence 2 NSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVV

Sequence 1 DSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN
           ---G--V-D---Q-G--LVVPQ-FAV--K---E--E-V--K-D-------
Sequence 2 GDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSP

Sequence 1 FAGENSFIDNLPEEVVANSYGLPREQARQLKNN-NPFKFFVPPFQQSPRA
           -AG--S-----P-EV-ANSY------A--LKN-------F-P-FQ-----
Sequence 2 IAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFLP-FQSRDEK

Sequence 1 VA---
           -----
Sequence 2 ERERF



Alignment 28
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 37.17 (197/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISF------RQQPE------ENACQFQRLN
           M---L-LSF--C--VL--S----------R--P----------C--QRL-
Sequence 2 MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLT

Sequence 1 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA
           A--P--R--SE-G--E-W-----EF-CAG----R-V-----L--P-YSNA
Sequence 2 ASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNA

Sequence 1 PQEIFIQQGRGYFGLIFPGCPSTY------EEPAQQ--GRRYQS------
           P---F--QGRG--G---PGCP-T-------E-P--Q---R--QS------
Sequence 2 PYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS

Sequence 1 ---QRPPRRLQEE----DQSQQQQ--------DSHQKVHRFNEGDLIAVP
           ---QR------EE----DQ---Q---------D-HQK--R---GD-I--P
Sequence 2 RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSP

Sequence 1 TGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRY
           -GV--W--N--D-D-----L-D-N---NQLD---R-F-LAG---------
Sequence 2 AGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAG---------

Sequence 1 QQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDE-
           --QS-QSR---------------RR--R--R--G---R--R--Q--E---
Sequence 2 --QSKQSRE-------------DRRSQRQTREEGS-DRQSRESQDDEALL

Sequence 1 GGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRIL
           --NI-SGF--E-L---F---D------L-GEN-----G-IV--R--L---
Sequence 2 EANILSGFEDEILQEIFRNVDQETISKLRGEND--QRGFIVQARD-LKLR

Sequence 1 SPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKK
           -P---------EEY-E---E-----G-R-RG--G--NG-E---C------
Sequence 2 VP---------EEYEE---ELQRERGDRKRGGSGRSNGLEQAFCNLKFRQ

Sequence 1 NIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPH
           N-----------P-----------NL-IL----LSA----LY-NA---P-
Sequence 2 NVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPR

Sequence 1 YNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGK
           -N-NAHS--Y--RG---VQVV---G--V-D---Q-G--LVVPQ-FAV--K
Sequence 2 WNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLK

Sequence 1 SQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQ
           ---E--E-V--K-D--------AG--S-----P-EV-ANSY------A--
Sequence 2 AGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFR

Sequence 1 LKNNNPFKFFVPPFQQSPRAVA------
           LKN---------PFQ-------------
Sequence 2 LKNGRQEVEVFRPFQSRDEKERERFSIV



Alignment 29
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 37.17 (197/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           MAKL--LS-----L------I---Q--E---C--QRL-AQ-P--R-E-E-
Sequence 2 MAKLFLLSLGIFLLFHCCLAIEYEQE-ELYECRIQRLTAQEPQYRLEAEA

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G--E-W----Q-F-CAGVA--R---R---L--P-Y-NAP------QGRG-
Sequence 2 GVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGI

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           -G---PGCP-T-----Q-----Q--R-----QEE-----Q-D-HQKVH--
Sequence 2 LGVLMPGCPETFQSMSQ----FQGSRE----QEEERGRFQ-DQHQKVHHL

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           --GD-IA-P-GVA-W-YND-D-D-V-V----T----NQLDQ-PR-F-LAG
Sequence 2 KKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N------R-Q-Q-----R--L----------------------------R
Sequence 2 NIQ----RSQKQ--RGERYGL----------------------------R

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVD-DRQIVQNLWGENESEEEGAIV
           -GQ-------N-F-GF--E-L--------D--------GE------G-IV
Sequence 2 GGQQILAD--NVFKGFNMEALADVLGFGMDTETARKVRGEDD--QRGHIV

Sequence 1 TVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEE
           -V--GL----P---R---EE-E----------Q-G-------GG-NG-EE
Sequence 2 RVEQGLKVIRPPRIR---EELE---------QQEG-------GGYNGLEE

Sequence 1 TICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNL
           TIC-A----NI--------Y-P----------L---IL--L-LSA--G-L
Sequence 2 TICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVL

Sequence 1 YRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVV
           Y-NA---P----NA-S--YA-RG-A-VQ-VD--G--V-D--L-EG---VV
Sequence 2 YENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVV

Sequence 1 PQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSY
           PQNF-V-----S--FE-V-F-T---------AG--S-----P--V-AN-Y
Sequence 2 PQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAY

Sequence 1 GLPREQARQLK-NNNPFKFFVPPFQQSPRAVA
           -L--E-AR--K-N------F-P------RA-A
Sequence 2 RLSQEEARRIKLNRDEAVLFQPGSRSRGRASA



Alignment 30
Sequence 1:
Sequence 2: Allergen Zan b 2.02, Sequence: QYU76044
Sequence identity: 31.32 (166/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           ------------------------------------------------E-
Sequence 2 ------------------------------------------------EA

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           G--E-W--NN----CA-VA--R-----N-L--P-Y-N--------QGRG-
Sequence 2 GVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGI

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           -G--FPGCP-TY----QQ---YQSQ---------------QD-HQKV---
Sequence 2 HGAVFPGCPETYQDQQQQ-QSYQSQ-----------GSRSQDQHQKVRQI

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           -EGD-IA-PTG-A-W-YN------V-V-L-D--N-DNQLDQ--R-F-L-G
Sequence 2 REGDIIALPTGAAHWIYNNGGSQLVLVALVDVGNSDNQLDQYFRKFYLGG

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           N---E------Q----R-----Y-------------------G--SRR--
Sequence 2 NPQPEL-----QGTSQRQQGGGYQGSQGG-------------GGGSRR--

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
           ---------GN-F-GF----L--AF-V--------L---------G-IV-
Sequence 2 ---------GNMFNGFDERLLADAFNVNP-ELIRRL--QRPQMQRGIIVR

Sequence 1 VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEET
           V----R-LSP---RG---E-E---------EQD-----------NG-EET
Sequence 2 VEEEFRVLSPQ--RGQEQEQE--------QEQDC---------DNGVEET

Sequence 1 ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLY
           -CT-----NI--------Y-P-----------NL--LRWL-LSAE-GNLY
Sequence 2 FCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGNLY

Sequence 1 RNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVP
           -NAL--PH-N-N-HSI-Y--RG----Q-V--NGN-V---E--EG---V-P
Sequence 2 QNALTSPHWNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIREGQLIVIP

Sequence 1 QNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG
           Q-FAV--K------E--AFKT---------AG--S----LP--V------
Sequence 2 QGFAVVKKASNRGLEWIAFKTNDNAMTNQLAGRVSVMRALPLDV------

Sequence 1 LPREQARQLKNNNPFKFFVPPFQQSPRAVA
           ------------------------------
Sequence 2 ------------------------------



Alignment 31
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 33.21 (176/530)
Sequence 1 -MAKLLELSFCFCFLVLGASSISFRQQP---EENACQFQRLNAQRPDNRI
           --A----L------LV-----I-----P-------C-FQR-----P--RI
Sequence 2 MVAFKFLLALSLSLLV--SAAIAQTREPRLTQGQQCRFQRISGAQPSLRI

Sequence 1 ESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQ
           -SEGG--E-W------F-CAG----R---R-N-L--P-Y---P----I--
Sequence 2 QSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIER

Sequence 1 GRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQ--QDSH
           G-G------PGC--TY-----------SQR---R-----Q-------D-H
Sequence 2 GQGLISIMVPGCAETYQV-------HRSQRTMERTEASEQQDRGSVRDLH

Sequence 1 QKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPR
           QKVHR---GD--A-P-G-A-W-YND---D-VAVS--D-N---NQLDQ--R
Sequence 2 QKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFR

Sequence 1 RFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQ
           -F-LAG-------------------------------PR--E-E-----Q
Sequence 2 AFYLAGG-----------------------------VPRSGEQE-----Q

Sequence 1 HSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEE
           --R-------------NIF--F--E-L--AF-V----I--------E-EE
Sequence 2 QARQTFH---------NIFRAFDAELLSEAFNVPQETIRRM---QSEEEE

Sequence 1 EGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGG
           -G-IV--R-------PD-------EEE--------------RGR------
Sequence 2 RGLIVMARERMTFVRPD-------EEEGEQEH---------RGRQL---D

Sequence 1 NGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSA
           NG-EET-CT-----N----R---I---Q-----------L-IL----LSA
Sequence 2 NGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSA

Sequence 1 EYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEG
           E-GNLY-NAL--P------H-I-Y--RG-A-VQVVD-NG----------G
Sequence 2 EKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQG

Sequence 1 HVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEV
           ---VVPQ------------FE-VAFKT---P-----AG--S-I---P--V
Sequence 2 EMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQV

Sequence 1 VANSYGLPREQARQLK-NNNPFKFFVPPFQQSPRAVA
           --NSY-----QA--LK-N-----F---P---------
Sequence 2 ITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS----



Alignment 32
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 32.83 (174/530)
Sequence 1 -----------MAKLLELSFCFCFLVLGASSISFRQQPE-ENACQFQRLN
           --------------LL-L--C-----LG---------P----AC----L-
Sequence 2 MVKLAHLLVATVGVLLVLNGCLARQSLGVP-------PQVKDACNLDNLD

Sequence 1 AQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNA
           ---P---I-SE-G--E-W--N-----CAGV---RLV-----L--P-----
Sequence 2 VLQPTEVIKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSS

Sequence 1 PQEIFIQQGRGYFGLIFPGCPSTY-----------EEPAQQGRRYQSQRP
           P------QG-G--G---PGC--T----------------QQG---Q----
Sequence 2 PFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQGQQQGQQGQQGQQGQQ

Sequence 1 PRRLQEEDQSQQQQ------------------DSHQKVHRFNEGDLIAVP
           ----Q---Q-QQ-Q------------------D-HQKV-----GD-IA--
Sequence 2 GQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHGDAIAMT

Sequence 1 TGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRY
           -G-A-W-YN--D-----VSL-D--N--NQLD--PR-F-LAGN--Q-----
Sequence 2 PGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQGSSQQ

Sequence 1 QQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEG
           QQQ--Q--------------------------------------------
Sequence 2 QQQQQQ--------------------------------------------

Sequence 1 GNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILS
           -NI-SGF-P--L-QA---D-R---Q-L---N-----G-IV-V-G------
Sequence 2 -NILSGFDPQVLAQALKIDVR-LAQEL--QNQQDKRGNIVRVKGPFQVVR

Sequence 1 PDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKN
           P---R-A-----Y---Q---------RG-------NG-EETIC------N
Sequence 2 PP-LRQA-----YESEQWRHP-----RGPPQSPQDNGLEETICSMRTHEN

Sequence 1 IGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHY
           I-------IY-P------------L-IL----LSA--G-L---A---P-Y
Sequence 2 IDDPARADIYKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSAMVLPKY

Sequence 1 NTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKS
           N-NA--I-Y---G-A--QVV--NG--V-D---Q-G---V-PQ-FA----S
Sequence 2 NMNANEILYCTQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQS

Sequence 1 QSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQL
           Q--NFE---FKT-----I---AG--S----LP-EV--N-Y----E-AR--
Sequence 2 QN-NFEWISFKTNANAMISTLAGRTSALRALPLEVITNAYQISLEEARKI

Sequence 1 KNNNPFKFFVPPFQQSPRAVA------
           K-N------------------------
Sequence 2 KFNTLETTLTRARGGQQPQLIEEIVEV



Alignment 33
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 41.89 (222/530)
Sequence 1 MAKLLELSFC-FCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESE
           M-K---LS----C-L-L-------------N-CQ---LNA--PD-R-ESE
Sequence 2 MGKPFTLSLSSLCLLLLSSACFAISSS-KLNECQLNNLNALEPDHRVESE

Sequence 1 GGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRG
           GG-I-TWN----E--CAGV--S-L-L-RN-L--P-YS--P--I-I-QG-G
Sequence 2 GGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKG

Sequence 1 YFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHR
           --G---PGCP-T-EEP--Q--R--S-----------Q-QQ-QDSHQK---
Sequence 2 ALGVAIPGCPETFEEPQEQSNRRGSR---------SQKQQLQDSHQKIRH

Sequence 1 FNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLA
           FNEGD----P-GV--W-YN--D--VVA-SL-DT-N--NQLDQ-PR-F-LA
Sequence 2 FNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLA

Sequence 1 GNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRE
           GN---E-----QQ--Q-------------H----------R--GQH----
Sequence 2 GNPDIEYPETMQQQQQQKS----------HGG--------RKQGQHQ---

Sequence 1 RAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIV
           ---QEEE-EGG---SGF---FL-Q-F------I---L-------E---IV
Sequence 2 ---QEEEEEGGSVLSGFSKHFLAQSFNTNE-DIAEKL--QSPDDERKQIV

Sequence 1 TVRGGLRILSPDGTRGADEEEEYDED----QYEYH----------EQD--
           TV-GGL---SP------DE-E--DED----Q---H----------EQD--
Sequence 2 TVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDED

Sequence 1 -------GRRGRGSRGG---------------------------------
           --------R--R-S-G----------------------------------
Sequence 2 EDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRR

Sequence 1 ---------G----NGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCH
           ---------G----NG-EE-ICT-----NI--------Y-P---------
Sequence 2 PRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLN

Sequence 1 DLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVD
           -L-L--LR---LSA-Y--LY-N----PH-N-NA-S-IY--RG---V-VV-
Sequence 2 SLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVN

Sequence 1 SNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANF
           --GN-V-D-EL--G--LVVPQNF-VA-------FEY--FKT---------
Sequence 2 CQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHN-AVTSY

Sequence 1 AGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQ--SPRA
           ----------P-EV-A-SY-L---Q---LK--------V-P--Q--SPR-
Sequence 2 LKD--VFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRV

Sequence 1 VA-
           ---
Sequence 2 KVA



Alignment 34
Sequence 1:
Sequence 2: Allergen Jug n 2, Sequence: AAM54366
Sequence identity: 19.81 (105/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 FGLIFPGCPSTYEEPAQQGRR------YQSQRPPRRLQEEDQSQQQQDSH
           --------------P-QQ--R-------Q-Q-P-R--Q-------Q----
Sequence 2 --------GRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQ

Sequence 1 QKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPR
           Q---R--E--------G----------------S----------------
Sequence 2 QGRERGPEASPRRESKGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLE

Sequence 1 RFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQ
           RF--------E-LR-----R-------P-----PH-----E------RG-
Sequence 2 RFA----ERTELLRGIENYRVVILDANPNTFMLPHHKDA-ESVIVVTRGR

Sequence 1 HSRRERAGQEEED---EGGNIF---SGFTPEFL-----EQAFQVDDRQIV
           -----------E----E-G-------G-T---------E----V---Q-V
Sequence 2 ATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMVKLLQPV

Sequence 1 QNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQD
           -N-----E----GA-------LR--S-D----A------D--------Q-
Sequence 2 NNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPR-DRLERFFDQQE

Sequence 1 GRRG---RGSRGGGNGIEETICTACVK----KNIGG-----NRSPHIYDP
           -R-G---R-S-------------A----------GG--------P-----
Sequence 2 QREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQ

Sequence 1 QRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALR
           ---F---C-------L--------Y----R-A--VPHYN--A----Y---
Sequence 2 FGQFFEACPEEHRQ-LQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVE

Sequence 1 GRA-------HV--QVVDSNGNRVYDEE------------LQEGHVLVVP
           G---------HV--Q-----G-R---EE------------L--G---V-P
Sequence 2 GTGRYEMACPHVSSQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIP

Sequence 1 QNFAVA-GKSQSENFEYVAFKTDSRPSIANF-AGENSFIDNLPEEVVANS
           -----A---SQ-EN-----F---------NF-AG-NS-I--L--E----S
Sequence 2 AGHPIAITASQNENLRLLGFGINGENNQRNFLAGQNSIINQLEREAKELS

Sequence 1 YGLPREQARQLKNNNPFKFFVPPFQQSPRAVA--------------
           ---PRE-------------FVP---QS-R-----------------
Sequence 2 FNMPREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILGFAFF



Alignment 35
Sequence 1:
Sequence 2: Allergen Coc n 1.0101, Sequence: A0A0S3B0K0
Sequence identity: 13.96 (74/530)
Sequence 1 MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY
           --------------------------------------------------
Sequence 2 ---------------------MVSAMGDRTASAILALLLLSSWSLMVVMA

Sequence 1 FGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRF
           -------------E---------------R---E----------------
Sequence 2 YQGRGMEGREKRVEEKAPRSPEDRGLFILRRSKEVLKTDAGEVRLMMGYR

Sequence 1 NEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
           --G-------G------N----------------------------N---
Sequence 2 YRGNHSPMHIGFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIYKNKLV

Sequence 1 NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER
           ---------------S----------------------------------
Sequence 2 EKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYPQS

Sequence 1 AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQ---IVQNLWGENESEEEGA
           -------------SGF----L--AF-V---Q---I-----G-------G-
Sequence 2 FYVGGGVLPRSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNGE

Sequence 1 IVTVRGGLRILSPDGTRGADEEE--EYDEDQYEYHEQDGRRGRGSRGGGN
           ----R--L--------R---E-E----D-D--E--E-D----R-------
Sequence 2 AAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLL

Sequence 1 GIEETICTACVKKNIGGNR-SPHIYDPQRWFTQNCHDLNLLI-------L
           G-----C----K--------S---YD------QN-------I-------L
Sequence 2 GKGD--CRVQRKHKLAHSPGSYNLYDTEPSY-QNDYGYSIAIDGHDYSAL

Sequence 1 RWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVY
           ----L-----NL---A---PH-N--A------LRG----QVV--NG----
Sequence 2 KHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVFPNGTAAM

Sequence 1 DEELQEGHVLVVPQNFAVAG-KSQSENFEYVAFKTDSRPSIANF-AGENS
           -----EG-V---P--F------S-----E---F-T--R-----F--G--S
Sequence 2 NAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGKSS

Sequence 1 FIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA-----
           ----------A---G---EQ--------------P---------------
Sequence 2 LLHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKKW

Sequence 1 --------------
           --------------
Sequence 2 KGEEVLVMKRGLFA



Alignment 36
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 23.02 (122/530)
Sequence 1 ----------MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQ
           ---------------E------------------QQ-----C-------Q
Sequence 2 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ

Sequence 1 RP-DNRIESEGGYIETWNPNN--QEFE-CAGVALSRLVLRRNAL--RRPF
           R----R----G------NP----Q--E-C--------------L--RR--
Sequence 2 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE

Sequence 1 YSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEE
           ------E---Q-GR----------P-------Q-----Q-Q-P-R--Q--
Sequence 2 QRRQQEERERQRGRDRQD------PQQQYHRCQRRCQIQEQSPERQRQCQ

Sequence 1 DQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNN
           -----Q----Q---R--E--------G----------------S------
Sequence 2 QRCERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHE

Sequence 1 NDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRR
           ----------RF--------E-LR-----R-------P-----PH-----
Sequence 2 SEEGEVKYLERFT----ERTELLRGIENYRVVILDANPNTSMLPHHKDA-

Sequence 1 EEREFRPRGQHSRRERAGQEEED---EGGNIF---SGFTPEFLEQAFQ--
           E------RG------------E----E-G-------G-T-----Q-----
Sequence 2 ESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNER

Sequence 1 ---VDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYD
           ---V---Q-V-N-----E----GA-------LR--S-D----A------D
Sequence 2 LEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPR-D

Sequence 1 EDQYEYHEQDGRRG---RGSRGGGNGIEETICTACVK----KNIGG----
           --------Q--R-G---R-S-------------A----------GG----
Sequence 2 RLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISL

Sequence 1 -NRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNT
           ---SP--------F---C-------L--------Y----R-A--VPHYN-
Sequence 2 KSESPSYSNQFGQFFEACPEEHRQ-LQEMDVLVNYAEIKRGAMMVPHYNS

Sequence 1 NAHSIIYALRGRA-------HV--QVVDSNGNRVYDEE------------
           -A----Y---G---------HV--Q-----G-R---EE------------
Sequence 2 KATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTAR

Sequence 1 LQEGHVLVVPQNFAVA-GKSQSENFEYVAFKTDSRPSIANF-AGENSFID
           L--G---V-P-----A---SQ-EN-----F----------F-AG-N--I-
Sequence 2 LARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQNNIIN

Sequence 1 NLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA--------
           -L--E----S---PRE-------------FVP---QS-R-----------
Sequence 2 QLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASI

Sequence 1 ------
           ------
Sequence 2 LDFAFF



Alignment 37
Sequence 1:
Sequence 2: Allergen Car i 2.0101, Sequence: B3STU4
Sequence identity: 24.15 (128/530)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVTKAKIPLFLFLSALFLALVCSSLALETEDLSNELNPHHDPESHRWEFQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCQERCQHEERGQRQAQQCQRRCEEQLREREREREREEIVDPREPRKQYE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCRETCEKQDPRQQPQCERRCERQFQEQQERERRERRRGRDDDDKENPRD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 PREQYRQCEEHCRRQGQGQRQQQQCQSRCEERFEEEQRRQEERERRRGRD

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NDDEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQE

Sequence 1 ---------MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQR
           --------------------------------R---E---C---R---QR
Sequence 2 ERERRRGRDEDDQNPRDPEQRYEQCQQQCERQRRGQEQQLCR-RRCEQQR

Sequence 1 PDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQE
           -----E---G------P--Q---C----------RR-----------P--
Sequence 2 QQEERERQRGR-DRQDPQQQYHRCQ---------RRCQTQE----QSPER

Sequence 1 IFIQQGRGYFGLIFPGCPSTYEEPAQQGRRY-QSQRPPRRLQEEDQSQQQ
           ----Q-R---------C---Y-E--QQGR-----Q--PRR--E-------
Sequence 2 QRQCQQR---------CERQYKE--QQGREWGPDQASPRR--ESRGREEE

Sequence 1 QDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLD
           Q--H--------G-------G-----Y----T----------N-----L-
Sequence 2 QQRHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILE

Sequence 1 QFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR
           --P--F-L------E--------R------L--------S--RRE---F-
Sequence 2 ANPNTFVLPYHKDAESVIVVTRGRAT----LTFV-----SQERRES--FN

Sequence 1 PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGEN
           -------R--AG--E-------------E-LE----V---Q-V-N-----
Sequence 2 LEYGDVIRVPAGATEY-----VINQDSNERLEM---VKLLQPVNNPGQFR

Sequence 1 ESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRG---
           E----GA--T----LR--S-D----A------D--------Q--R-G---
Sequence 2 EYYAAGAQST-ESYLRVFSNDILVAALNTPR-DRLERFFDQQEQREGVII

Sequence 1 RGSRGGGNGIEETICTACVKKNIGGNRS---PHIYDPQR--------WFT
           R-S-------------A-------G-RS---P-----QR---------F-
Sequence 2 RASQEKLRALSQHAMSAGQRP--WGRRSSGGPISLKSQRSSYSNQFGQFF

Sequence 1 QNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHV
           --C-------L--------Y----R-A--VPHYN--A----Y---G----
Sequence 2 EACPEEHRQ-LQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRF

Sequence 1 ----------QVVDSNGNRVYDEE-------------LQEGHVLVVPQNF
           ----------Q-----G-R---EE-------------L--G---V-P---
Sequence 2 EMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGH

Sequence 1 AVA-GKSQSENFEYVAFKTDSRPSIANF-AGENSFIDNLPEEVVANSYGL
           --A---SQ-EN---V-F---------NF-AG-N--I--L--E----S---
Sequence 2 PIAITASQNENLRLVGFGINGKNNQRNFLAGQNNIINQLEREAKELSFNM

Sequence 1 PREQARQLKNNNPFKFFVPPFQQSPRAVA---------------
           PRE-------------FVP---QS-R------------------
Sequence 2 PREEIEEIFERQVESYFVPMERQSRRGQGRDHPLASILDFAGFF


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.