The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ara h 6

Sequence 5923742

Full FASTA alignment

Sequence name:
Query sequence:
AHASAMRRERGRQGDSSSCERQVDGVNLKPCEQHIMQRIMGEQEQYDSYN
FGSTRSSDQQQRCCDELNEMENTQRCMCEALQQIMENQCDGLQDRQMVQH
FKRELMNLPQQCNFGAPQRCDLDVSGGRC

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ara h 6AAD56337Go!129140.21.7e-35
2Ara h 2.01019186485Go!15766.04.4e-13
3Ara h 2.0201AAN77576Go!17265.38.2e-13
4Ara h 2.0101AAK96887Go!15665.18.6e-13
5Ara h 7.0201B4XID4Go!16453.13.6e-09
6Cor a 14.0101ACO56333Go!14741.59.7e-06
7Ses i 1AAK15088Go!15338.96.2e-05
8Lin u 1.01Q8LPD3Go!16837.32.1e-04
9Lin u 1.01Q8LPD3Go!16837.32.1e-04
10Ara h 7AAD56719Go!16036.04.8e-04
11Ara h 7.0101Q9SQH1Go!16036.04.8e-04
12Pis v 1.0101DQ631675Go!14935.85.2e-04
13Cuc ma 5.0101Q39649Go!14135.56.1e-04
14Ses i 2AAD42943Go!14833.32.9e-03
15Fag e 8kDBAB79444Go!13333.13.1e-03
16Fag e 2.0101Q2PS07Go!14933.23.3e-03
17Ber e 1CAA38363Go!15432.55.4e-03
18Fag t 2.0101ADW27428Go!14932.35.8e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ara h 6, Sequence: AAD56337
Sequence identity: 100.00 (129/129)
Sequence 1 AHASAMRRERGRQGDSSSCERQVDGVNLKPCEQHIMQRIMGEQEQYDSYN
           AHASAMRRERGRQGDSSSCERQVDGVNLKPCEQHIMQRIMGEQEQYDSYN
Sequence 2 AHASAMRRERGRQGDSSSCERQVDGVNLKPCEQHIMQRIMGEQEQYDSYN

Sequence 1 FGSTRSSDQQQRCCDELNEMENTQRCMCEALQQIMENQCDGLQDRQMVQH
           FGSTRSSDQQQRCCDELNEMENTQRCMCEALQQIMENQCDGLQDRQMVQH
Sequence 2 FGSTRSSDQQQRCCDELNEMENTQRCMCEALQQIMENQCDGLQDRQMVQH

Sequence 1 FKRELMNLPQQCNFGAPQRCDLDVSGGRC
           FKRELMNLPQQCNFGAPQRCDLDVSGGRC
Sequence 2 FKRELMNLPQQCNFGAPQRCDLDVSGGRC



Alignment 2
Sequence 1:
Sequence 2: Allergen Ara h 2.0101, Sequence: 9186485
Sequence identity: 61.24 (79/129)
Sequence 1 -------------AHASAMRRERGRQGDSSSCERQVDGVNLKPCEQHIMQ
           -------------AHASA-R-----QGD---C--Q----NL-PCEQH-MQ
Sequence 2 LTILVALALFLLAAHASA-RQQWELQGDRR-CQSQLERANLRPCEQHLMQ

Sequence 1 RIMGEQEQYDSYNFGSTR--------------SSDQQQRCCDELNEMENT
           -I------Y-----------------------SS--Q-RCC-ELNE-EN-
Sequence 2 KIQRDEDSYERDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENN

Sequence 1 QRCMCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCNFGAPQRCDLD
           QRCMCEALQQIMENQ-D-LQ-RQ--Q-FKREL-NLPQQC---APQRCDLD
Sequence 2 QRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLD

Sequence 1 V-SGGRC--
           V-SGGR---
Sequence 2 VESGGRDRY



Alignment 3
Sequence 1:
Sequence 2: Allergen Ara h 2.0201, Sequence: AAN77576
Sequence identity: 62.02 (80/129)
Sequence 1 ----------------AHASAMRRERGRQGDSSSCERQVDGVNLKPCEQH
           ----------------AHASA-R-----QGD---C--Q----NL-PCEQH
Sequence 2 MAKLTILVALALFLLAAHASA-RQQWELQGDRR-CQSQLERANLRPCEQH

Sequence 1 IMQRIMGEQEQY--DSYN-----FGSTR-------------------SSD
           -MQ-I------Y--D-Y------------------------------SS-
Sequence 2 LMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQ

Sequence 1 QQQRCCDELNEMENTQRCMCEALQQIMENQCDGLQDRQMVQHFKRELMNL
           -Q-RCC-ELNE-EN-QRCMCEALQQIMENQ-D-LQ-RQ--Q-FKREL-NL
Sequence 2 HQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNL

Sequence 1 PQQCNFGAPQRCDLDV-SGGRC--
           PQQC---APQRCDL-V-SGGR---
Sequence 2 PQQCGLRAPQRCDLEVESGGRDRY



Alignment 4
Sequence 1:
Sequence 2: Allergen Ara h 2.0101, Sequence: AAK96887
Sequence identity: 60.47 (78/129)
Sequence 1 ----------------AHASAMRRERGRQGDSSSCERQVDGVNLKPCEQH
           ----------------AHASA-R-----QGD---C--Q----NL-PCEQH
Sequence 2 MAKLTILVALALFLLAAHASA-RQQWELQGDRR-CQSQLERANLRPCEQH

Sequence 1 IMQRIMGEQEQYDSYNFGSTR--------------SSDQQQRCCDELNEM
           -MQ-I------Y-----------------------SS--Q-RCC-ELNE-
Sequence 2 LMQKIQRDEDSYERDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEF

Sequence 1 ENTQRCMCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCNFGAPQRC
           EN-QRCMCEALQQIMENQ-D-LQ-RQ--Q-FKREL-NLPQQC---APQRC
Sequence 2 ENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRC

Sequence 1 DLDV-SGGRC
           DLDV-SGG--
Sequence 2 DLDVESGG--



Alignment 5
Sequence 1:
Sequence 2: Allergen Ara h 7.0201, Sequence: B4XID4
Sequence identity: 49.61 (64/129)
Sequence 1 --------------------AHASAMRRERGRQGDSSS-----CERQVDG
           --------------------------R--RG---D--S-----C-RQ---
Sequence 2 MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQR

Sequence 1 VNLKPCEQHIMQRIMGEQEQ-YDSYNF---GST------RSSDQQQRCCD
           -NL-PCE-HI-QR---EQEQ--D-Y-----GS----------DQ-QRCC-
Sequence 2 ANLRPCEEHIRQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCN

Sequence 1 ELNEMENTQRCMCEALQQIMENQCDGLQ-DRQMVQHFKRELMNLPQQCNF
           ELN---N-QRCMC-ALQQI--NQ----Q-DR-------REL-NLPQ-C-F
Sequence 2 ELNRFQNNQRCMCQALQQILQNQSFRFQQDRSQLHQMERELRNLPQNCGF

Sequence 1 GAPQRCDLDVSGGRC
           --P-RCDL-------
Sequence 2 RSPSRCDLSSRTPY-



Alignment 6
Sequence 1:
Sequence 2: Allergen Cor a 14.0101, Sequence: ACO56333
Sequence identity: 33.33 (43/129)
Sequence 1 ------------------------------AHASAMRRERGRQGDSSSCE
           ----------------------------------------GR-G-S--C-
Sequence 2 MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGES--CR

Sequence 1 RQVD-GVNLKPCEQHIMQRIMGEQEQYDSYNFGSTRSSDQQ-QRCCDELN
           -Q-----NL--C-----QR-M--Q-QY-SY--GS-----Q----CC--L-
Sequence 2 EQAQRQQNLNQC-----QRYMRQQSQYGSYD-GSNQQQQQELEQCCQQLR

Sequence 1 EMENTQRCMCEALQQIMENQCDGLQDRQMVQHFKRELM----NLPQQCNF
           -M----RC-CE-L-Q----Q--------M-----RE-M-----LP-QC--
Sequence 2 QMD--ERCRCEGLRQAVMQQQGEMRGEEM-----REVMETARDLPNQCRL

Sequence 1 GAPQRCDLDVSGGRC
           --PQRC---------
Sequence 2 -SPQRCEIRSARF--



Alignment 7
Sequence 1:
Sequence 2: Allergen Ses i 1, Sequence: AAK15088
Sequence identity: 27.91 (36/129)
Sequence 1 ---------------------------AHASAMRRERGRQGDSSSCERQV
           -------------------------------A---E---Q--S--C--Q-
Sequence 2 MAKKLALAAVLLVAMVALASATTYTTTVTTTAIDDEANQQ--SQQCRQQL

Sequence 1 DGVNLKPCEQHIMQR---IMGEQEQYDSYNFGSTRSSDQQQRCCDELNEM
           -G-----C-----Q------GE---------G---S------CC--L---
Sequence 2 QGRQFRSCQRYLSQGRSPYGGEEDEVLEMSTGNQQSEQSLRDCCQQLRNV

Sequence 1 ENTQRCMCEALQQIM--ENQCDGLQDRQMVQHFKRELMNLPQQCNFGAPQ
           ----RC-CEA--Q------Q--G-Q--Q--Q---R----LP--CN---PQ
Sequence 2 D--ERCRCEAIRQAVRQQQQEGGYQEGQSQQVYQRA-RDLPRRCNM-RPQ

Sequence 1 RCDLDVSGGRC
           -C---V-----
Sequence 2 QCQFRVIFV--



Alignment 8
Sequence 1:
Sequence 2: Allergen Lin u 1.01, Sequence: Q8LPD3
Sequence identity: 27.91 (36/129)
Sequence 1 -------------------------------AHASAMRRERGRQGDSSSC
           -------------------------------------R---G-QG----C
Sequence 2 MAKLMSLAAVATAFLFLIVVDASVRTTVIIDEDTNQGRGGQGGQGQQQQC

Sequence 1 ERQVDGVN-LKPCEQHIMQRIM-GEQEQYDSYNFGSTRSSDQQQRCCDEL
           E-Q------L--C-Q--------G----Y-----G----S-----CCD-L
Sequence 2 EKQIQEQDYLRSCQQFLWEKVQKGGRSYYYNQGRGGGQQSQHFDSCCDDL

Sequence 1 NEMENTQRCMCEALQ----QIMEN-QCDGLQDR--QMVQHFKRELMNLPQ
           --------C-C--L-----Q-----Q--G-Q------VQ--K-----LP-
Sequence 2 KQLRS--ECTCRGLERAIGQMRQDIQQQGQQQEVERWVQQAKQVARDLPG

Sequence 1 QCNFGAPQRCDLDVSGGRC--
           QC----P-RC-L---------
Sequence 2 QCGT-QPSRCQLQGQQQSAWF



Alignment 9
Sequence 1:
Sequence 2: Allergen Lin u 1.01, Sequence: Q8LPD3
Sequence identity: 27.91 (36/129)
Sequence 1 -------------------------------AHASAMRRERGRQGDSSSC
           -------------------------------------R---G-QG----C
Sequence 2 MAKLMSLAAVATAFLFLIVVDASVRTTVIIDEDTNQGRGGQGGQGQQQQC

Sequence 1 ERQVDGVN-LKPCEQHIMQRIM-GEQEQYDSYNFGSTRSSDQQQRCCDEL
           E-Q------L--C-Q--------G----Y-----G----S-----CCD-L
Sequence 2 EKQIQEQDYLRSCQQFLWEKVQKGGRSYYYNQGRGGGQQSQHFDSCCDDL

Sequence 1 NEMENTQRCMCEALQ----QIMEN-QCDGLQDR--QMVQHFKRELMNLPQ
           --------C-C--L-----Q-----Q--G-Q------VQ--K-----LP-
Sequence 2 KQLRS--ECTCRGLERAIGQMRQDIQQQGQQQEVERWVQQAKQVARDLPG

Sequence 1 QCNFGAPQRCDLDVSGGRC--
           QC----P-RC-L---------
Sequence 2 QCGT-QPSRCQLQGQQQSAWF



Alignment 10
Sequence 1:
Sequence 2: Allergen Ara h 7, Sequence: AAD56719
Sequence identity: 36.43 (47/129)
Sequence 1 ---------------------AHASAMRRERGRQGDSSS-----CERQVD
           ---------------------------R--RG---D--S-----C-RQ--
Sequence 2 MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQ

Sequence 1 GVNLKPCEQHIMQRIMGEQEQ-YDSYNFGSTRSS----------DQQQRC
           --NL-PCE-H---R---EQEQ--D-Y---S-R-S-----------Q-QRC
Sequence 2 RANLRPCEEHMRRRVEQEQEQEQDEYPY-SRRGSRGRQPGESDENQEQRC

Sequence 1 CDELNEMENTQRCMCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCN
           C-ELN---N-QRCMC-ALQQI--NQ-------Q-------E---------
Sequence 2 CNELNRFQNNQRCMCQALQQILQNQSFWVPAGQEPVASDGEGAQELAPEL

Sequence 1 FGAPQRCDLDVSGGRC
           ----------------
Sequence 2 RVQVTKPLRPL-----



Alignment 11
Sequence 1:
Sequence 2: Allergen Ara h 7.0101, Sequence: Q9SQH1
Sequence identity: 36.43 (47/129)
Sequence 1 ---------------------AHASAMRRERGRQGDSSS-----CERQVD
           ---------------------------R--RG---D--S-----C-RQ--
Sequence 2 MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQ

Sequence 1 GVNLKPCEQHIMQRIMGEQEQ-YDSYNFGSTRSS----------DQQQRC
           --NL-PCE-H---R---EQEQ--D-Y---S-R-S-----------Q-QRC
Sequence 2 RANLRPCEEHMRRRVEQEQEQEQDEYPY-SRRGSRGRQPGESDENQEQRC

Sequence 1 CDELNEMENTQRCMCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCN
           C-ELN---N-QRCMC-ALQQI--NQ-------Q-------E---------
Sequence 2 CNELNRFQNNQRCMCQALQQILQNQSFWVPAGQEPVASDGEGAQELAPEL

Sequence 1 FGAPQRCDLDVSGGRC
           ----------------
Sequence 2 RVQVTKPLRPL-----



Alignment 12
Sequence 1:
Sequence 2: Allergen Pis v 1.0101, Sequence: DQ631675
Sequence identity: 26.36 (34/129)
Sequence 1 -----------------AHASAMRRERGRQGDS----SSCERQVD-GVNL
           -----------------A-AS--R------G-------SC--Q-------
Sequence 2 MAKLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQKF

Sequence 1 KPCEQHIMQRIMGEQEQYDSYNFGSTRSSDQQ--QRCCDELNEMENTQRC
           K-C-----Q-----Q---D-----------QQ----CC-EL-E------C
Sequence 2 KHCQMYVQQEV---QKSQDGHSLTARINQRQQCFKQCCQELQEVD--KKC

Sequence 1 MCEALQQIMENQCDGLQDR-QMVQHFKRELMNLPQQCNFGAPQRCDLDVS
           -C--L-Q----Q----Q-R----Q--------LP--CN----Q-C-----
Sequence 2 RCQNLEQMVKRQQQQGQFRGEKLQELYETASELPRMCNISPSQGCQFSSP

Sequence 1 GGRC
           ----
Sequence 2 YWSY



Alignment 13
Sequence 1:
Sequence 2: Allergen Cuc ma 5.0101, Sequence: Q39649
Sequence identity: 27.13 (35/129)
Sequence 1 ------------------------AHASAMRRERGRQGDSSSCERQVDGV
           --------------------------------E--RQG----C-------
Sequence 2 MARLTSIIALFAVALLVADAYAYRTTITTVEVEENRQGREERCRQMSARE

Sequence 1 NLKPCEQHIMQRIMGEQEQYDSYNFGSTRSSDQQQRCCDELNEMENTQRC
           -L--CEQ---Q------------N----R-------CC-EL-------RC
Sequence 2 ELRSCEQYLRQQSRDVLQMRGIEN-PWRREGGSFDECCRELKNVDEECRC

Sequence 1 -MCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCNFGAPQRCDLDVS
           -M-E--------Q--G---RQM-Q-------NLP--C----PQRCD----
Sequence 2 DMLEEIAREEQRQARGQEGRQMLQKAR----NLPSMCGI-RPQRCDF---

Sequence 1 GGRC
           ----
Sequence 2 ----



Alignment 14
Sequence 1:
Sequence 2: Allergen Ses i 2, Sequence: AAD42943
Sequence identity: 22.48 (29/129)
Sequence 1 -----------------------AHASAMRRERGRQGDSSSCERQVDGVN
           -------------------------------E-G-------CE-------
Sequence 2 MARFTIVLAVLFAAALVSASAHKTVVTTSVAEEGEEENQRGCEWESRQCQ

Sequence 1 LKPCEQHIMQRIMGEQEQYDSYNFGSTRSSDQQQ-----RCCDELNEMEN
           ---C-Q--M----G--E------F-------Q-Q------CC-EL-----
Sequence 2 MRHCMQW-MRSMRGQYEE----SFLRSAEANQGQFEHFRECCNELRDVKS

Sequence 1 TQRCMCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCNFGAPQRCDL
           ---C-CEAL---M----------Q--Q--------LP--C----P--C--
Sequence 2 --HCRCEALRCMMRQMQQEYGMEQEMQQMQQMMQYLPRMCGMSYPTECRM

Sequence 1 DVSGGRC
           -------
Sequence 2 RPIFA--



Alignment 15
Sequence 1:
Sequence 2: Allergen Fag e 8kD, Sequence: BAB79444
Sequence identity: 27.13 (35/129)
Sequence 1 --------AHASAMRRERGRQGDSSSCERQVDGVN--LKPCEQHIMQRIM
           --------A---------------S-C--Q-------L--CE-------M
Sequence 2 MKLFLILAAASLLIVASHADSQMRSKCRKQMRMMEPQLEQCEGYMTMDMM

Sequence 1 GEQEQYDSYNFGSTRSSDQQQR-CCDELNEMENTQRCMCEALQQIMENQC
           ------DS------RS-----R-CC----EM-----CMCE--------Q-
Sequence 2 DD----DSMRGRECRSEESCMRGCCLAMKEMDD--ECMCEWMKMMVQQQR

Sequence 1 D--GLQDRQMVQHFKRELMNLPQQCNFGAPQRCDLDVSGGRC--
           ---G--D--MV----R----LP--C--G---RC-----G-R---
Sequence 2 GEMGEEDMRMVM---RKMKQLPNKCGMGH-MRCHMGI-GTRDYE



Alignment 16
Sequence 1:
Sequence 2: Allergen Fag e 2.0101, Sequence: Q2PS07
Sequence identity: 24.03 (31/129)
Sequence 1 -------------------AHASAMRRERGRQGDSSSCERQV--DGVNLK
           -----------------------------G----SS-C-RQV------LK
Sequence 2 MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLK

Sequence 1 PCEQHIMQRIMGEQ--EQYDSYNFGSTRSSDQQQR-CCDELNEMENTQRC
           -C---I---I------E-----------S-----R-CC----EM-----C
Sequence 2 KCNRYIAMDILDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDD--EC

Sequence 1 MCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCNFGAPQRCDLDVSG
           -CE------ENQ------R-------R-L--LP--C--------------
Sequence 2 VCEWMKMMVENQKGRIGER-LIKEGVRDLKELPSKCGLSELECGSRGNRY

Sequence 1 GRC
           ---
Sequence 2 FV-



Alignment 17
Sequence 1:
Sequence 2: Allergen Ber e 1, Sequence: CAA38363
Sequence identity: 25.58 (33/129)
Sequence 1 ------------------------------AHASAMRRERGRQGDSSSCE
           ---------------------------------------RGR------C-
Sequence 2 MAKMSVVAAALLALLVLGQATAFRTTVTTTLEEEQEENPRGRS--EQQCR

Sequence 1 RQVD-GVNLKPCEQHIMQRIMGEQEQYDSYNFGSTRSSDQQQRCCDELNE
           -Q------L--C-----Q----E---Y----------------CC--L--
Sequence 2 EQMERQQQLNHCRMYLRQQM--EESPYQNPRPLRRGEEPHLDECCEQLER

Sequence 1 MENTQRCMCEALQQIMENQCDG--LQDRQMVQHFKRELMNLPQQCNFGAP
           M-----C-CE-L------Q-----LQ--QM-Q---R---NL---CN---P
Sequence 2 MD--EMCRCEGLRMMLRRQREEMELQGEQM-QRIMRKAENLLSRCNL-SP

Sequence 1 QRCDLDVSGGRC
           QRC---------
Sequence 2 QRCPMGGYTAWL



Alignment 18
Sequence 1:
Sequence 2: Allergen Fag t 2.0101, Sequence: ADW27428
Sequence identity: 26.36 (34/129)
Sequence 1 -------------------AHASAMRRERGRQGDSSSCERQVDGV--NLK
           -----------------------------G----SS-C-RQV------L-
Sequence 2 MKLFIILATATLLIAATQAKYLRDEGFDLGETQMSSKCTRQVKMMEPELV

Sequence 1 PCEQHIMQRIMGEQ-EQYDSYNFGSTRSSDQQ--QRCCDELNEMENTQRC
           -C---I---IM----E---S---G----S-------CC----EME----C
Sequence 2 KCNRYIAMDIMDDKYEEALSRIQGEGCESEEKFLRGCCVAMKEMED--EC

Sequence 1 MCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCNFGAPQRCDLDVSG
           -CE------ENQ--G-----------R-L--LP--C-------C------
Sequence 2 VCEWMKMMVENQ-KGRIGETLMRKGIRDLKELPNKCGI-SEMECHSRGNW

Sequence 1 GRC
           ---
Sequence 2 YYV


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.