The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Act d 1

Sequence 166317

Full FASTA alignment

Sequence name:
Query sequence:
MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPYNNEWAL
QTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGG
IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNYP
EPYSSLINPPAFSMSKDGPVGVEDGQRYSA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Act d 1AAA32629Go!380575.51.4e-165
2Act d 1P00785Go!380567.82.9e-163
3Cari p 2.0101P14080Go!352224.65.5e-60
4Ana c 2BAA21849Go!351220.41.0e-58
5Car p papainAAB02650Go!345210.21.1e-55
6Gly m 1AAB09252Go!379182.62.5e-47
7Gly m 1P22895Go!379182.42.9e-47
8Amb a 11.0101V5LU01Go!386171.84.6e-44
9Blo t 1.0201AAQ24541Go!333148.15.5e-37
10Eur m 1.0102AAC82352Go!321122.03.7e-29
11Eur m 1.0101P25780Go!321120.79.4e-29
12Eur m 1.0101AAC82351Go!321120.79.4e-29
13Der f 1.01052428875Go!303120.21.2e-28
14Der f 1.01032428875Go!303120.01.4e-28
15Der f 1.0101BAC53948Go!321120.01.5e-28
16Der f 1.0110ABL84751Go!321120.01.5e-28
17Der f 1.01022428875Go!303119.81.7e-28
18Der f 1.01072428875Go!303119.61.9e-28
19Der f 1.0108ABL84749Go!321118.93.2e-28
20Der f 1.0109ABL84750Go!321118.93.2e-28
21Der f 1P16311Go!321117.86.9e-28
22Der f 1.01042428875Go!303116.51.7e-27
23Der p 1.0124CAQ68250Go!302111.84.1e-26
24Der p 1.0113ABA39435Go!302110.51.0e-25
25Blo t 1.0101AAK58415Go!221109.91.1e-25
26Eur m 1.0101CAA42677Go!211109.71.3e-25
27Der p 1P08176Go!320110.11.5e-25
28Der f 1CAA46316Go!212108.43.2e-25
29Der p 1.01236771329Go!222101.53.8e-23
30Der p 1.01156771329Go!222101.53.8e-23
31Der p 1.01186771329Go!222101.53.8e-23
32Der p 1.01206771329Go!222101.53.8e-23
33Der p 1.01216771329Go!222101.15.1e-23
34Der p 1.01146771329Go!222100.96.0e-23
35Der p 1.01176771329Go!222100.48.1e-23
36Der p 1.01196771329Go!222100.29.5e-23
37Der p 1.01226771329Go!222100.29.5e-23
38Der p 1.01166771329Go!22299.51.5e-22
39Tyr p 1.0101ABM53753Go!33665.73.5e-12
40Der p 1AAA28296Go!9648.21.9e-07

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Act d 1, Sequence: AAA32629
Sequence identity: 100.00 (380/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
Sequence 2 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
Sequence 2 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
Sequence 2 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
Sequence 2 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPYNNEWAL
           QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPYNNEWAL
Sequence 2 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPYNNEWAL

Sequence 1 QTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGG
           QTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGG
Sequence 2 QTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGG

Sequence 1 IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNYP
           IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNYP
Sequence 2 IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNYP

Sequence 1 EPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           EPYSSLINPPAFSMSKDGPVGVEDGQRYSA
Sequence 2 EPYSSLINPPAFSMSKDGPVGVEDGQRYSA



Alignment 2
Sequence 1:
Sequence 2: Allergen Act d 1, Sequence: P00785
Sequence identity: 98.16 (373/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
Sequence 2 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
Sequence 2 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           STYLGFTSGSNKTKVSNRYEPR-GQVLPSYVDWRSAGAVVDIKSQGECGG
Sequence 2 STYLGFTSGSNKTKVSNRYEPRFGQVLPSYVDWRSAGAVVDIKSQGECGG

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
Sequence 2 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPYNNEWAL
           QFIINNGGINTEENYPYTAQDGECN--LQNEKYVTIDTYENVPYNNEWAL
Sequence 2 QFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYENVPYNNEWAL

Sequence 1 QTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGG
           QTAVTYQPVSVALDAAGDAFK-YSSGIFTGPCGTAIDHAVTIVGYGTEGG
Sequence 2 QTAVTYQPVSVALDAAGDAFKHYSSGIFTGPCGTAIDHAVTIVGYGTEGG

Sequence 1 IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNYP
           IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQN-P
Sequence 2 IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNHP

Sequence 1 EPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -PYSSLINPPAFSMSKDGPVGV-DGQRYSA
Sequence 2 KPYSSLINPPAFSMSKDGPVGVDDGQRYSA



Alignment 3
Sequence 1:
Sequence 2: Allergen Cari p 2.0101, Sequence: P14080
Sequence identity: 39.47 (150/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNL--TQRTNDEVKA------MY
           -------------F--T-LI-----------------D------------
Sequence 2 --MATMSSISKIIFLATCLIIHMGLSSADFYTVGYSQDDLTSIERLIQLF

Sequence 1 ESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFA
           -SW--K--K-Y-S--E---RFEIF---L--IDE-N---N-SY--GLN-FA
Sequence 2 DSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNN-SYWLGLNGFA

Sequence 1 DLTDEEFRSTYLGFTSG--SNKTKVSNR-YEPRVGQVLPSYVDWRSAGAV
           DL---EF---Y-GF------------N-----------P---DWR--GAV
Sequence 2 DLSNDEFKKKYVGFVAEDFTGLEHFDNEDFTYKHVTNYPQSIDWRAKGAV

Sequence 1 VDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTR
           ---K-QG-CG-CWAFS-IATVEGINKIVTG-L--LSEQEL-DC-------
Sequence 2 TPVKNQGACGSCWAFSTIATVEGINKIVTGNLLELSEQELVDCDK--HSY

Sequence 1 GCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTY
           GC-GGY-T---Q---NNG---T---YPY-A----C---------V-I--Y
Sequence 2 GCKGGYQTTSLQYVANNG-VHTSKVYPYQAKQYKCRATDKPGPKVKITGY

Sequence 1 ENVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHA
           --VP-N-E-----A---QP-SV---A-G--F--Y-SG-F-GPCGT--DHA
Sequence 2 KRVPSNCETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGA-GTCGIATMP
           VT-VGYGT--G--Y-I-KNSW---WGE-GYMR--R--G---GTCG-----
Sequence 2 VTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSS

Sequence 1 SYPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -YP-K-------------------------------------
Sequence 2 YYPFKGFA----------------------------------



Alignment 4
Sequence 1:
Sequence 2: Allergen Ana c 2, Sequence: BAA21849
Sequence identity: 37.63 (143/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           -----------L-F----L----A----------ND------E-W---YG
Sequence 2 -----MASKVQLVFLFLFLCAMWASPSAASRDEPNDPMMKRFEEWMAEYG

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --Y----E--RRF-IFK-----I---N-----SY--G-NQF-D-T--EF-
Sequence 2 RVYKDDDEKMRRFQIFKNNVKHIETFNSRNENSYTLGINQFTDMTKSEFV

Sequence 1 STYLGFTSGSN--KTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGEC
           --Y-G-----N-----V----------V-P---DWR--GAV---K-Q--C
Sequence 2 AQYTGVSLPLNIEREPVVSFDDVNISAV-PQSIDWRDYGAVNEVKNQNPC

Sequence 1 GGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITD
           G-CW-F-AIATVEGI-KI-TG-L-SLSEQE--DC-------GC-GG----
Sequence 2 GSCWSFAAIATVEGIYKIKTGYLVSLSEQEVLDCAVSY---GCKGGWVNK

Sequence 1 GFQFIINNGGINTEENYPYTAQDGECNVE-LQNEKYVTIDTYENVPYNNE
           ---FII-N-G--TEENYPY-A--G-CN-----N--Y-T---Y--V--N-E
Sequence 2 AYDFIISNNGVTTEENYPYLAYQGTCNANSFPNSAYITGYSY--VRRNDE

Sequence 1 WALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGT
           -----AV--QP-----DA----F--Y--G-F-GPCGT---HA-TI-GYG-
Sequence 2 RSMMYAVSNQPIAALIDAS-ENFQYYNGGVFSGPCGTSLNHAITIIGYGQ

Sequence 1 EG-GIDYWIVKNSWDTTWGEEGYMRILRNVGGA-GTCGIATMPSYPVKYN
           ---G--YWIV-NSW---WGE-GY-R--R-V----G-CGIA--P--P----
Sequence 2 DSSGTKYWIVRNSWGSSWGEGGYVRMARGVSSSSGVCGIAMAPLFPTLQS

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           --N--------------------------------
Sequence 2 GANAEVIKMVSET----------------------



Alignment 5
Sequence 1:
Sequence 2: Allergen Car p papain, Sequence: AAB02650
Sequence identity: 40.00 (152/380)
Sequence 1 -----------MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVK
           -----------------FV-M-L-F---------------LT--------
Sequence 2 MAMIPSISKLLFVAICLFVYMGLSFGDFSIV---GYSQNDLT--STERLI

Sequence 1 AMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLN
           ---ESW--K--K-Y----E---RFEIFK--L--IDE-N---N-SY--GLN
Sequence 2 QLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNN-SYWLGLN

Sequence 1 QFADLTDEEFRSTYLGFTSGSNKTKVSNRYEPRV--GQV-LPSYVDWRSA
           -FAD----EF---Y-G---G-N-T-----YE-----G-V--P-YVDWR--
Sequence 2 VFADMSNDEFKEKYTGSIAG-NYTTTELSYEEVLNDGDVNIPEYVDWRQK

Sequence 1 GAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQ
           GAV---K-QG-CG-CWAFSA--T-EGI-KI-TG-L---SEQEL-DC-R--
Sequence 2 GAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRR-

Sequence 1 NTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTI
           ---GCNGGY-----Q-----G-I-----YPY------C------------
Sequence 2 -SYGCNGGYPWSALQLVAQYG-IHYRNTYPYEGVQRYCRSREKGPYAAKT

Sequence 1 DTYENV-PYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTA
           D----V-PYN-E-AL------QPVSV-L-AAG--F--Y--GIF-GPCG--
Sequence 2 DGVRQVQPYN-EGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNK

Sequence 1 IDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGA-GTCGI
           -DHAV--VGYG------Y---KNSW-T-WGE-GY-RI-R--G---G-CG-
Sequence 2 VDHAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGL

Sequence 1 ATMPSYPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -T---YPVK-------------------------------------
Sequence 2 YTSSFYPVKN------------------------------------



Alignment 6
Sequence 1:
Sequence 2: Allergen Gly m 1, Sequence: AAB09252
Sequence identity: 35.00 (133/380)
Sequence 1 -MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQ-RTNDEVKAMYESWLIK
           ---L-----S---L--S-------------LT---T---V------W---
Sequence 2 MGFLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSE

Sequence 1 YGKSYNSLGEWERRFEIFKETLRFIDEHNAD--TNRSYKVGLNQFADLTD
           -G--Y----E---R-EIFK-----I---NA------S---GLN-FAD-T-
Sequence 2 HGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITP

Sequence 1 EEFRSTYLGFTSG-SNKTKVSNRY---EPRVGQVLPSYVDWRSAGAVVDI
           -EF---YL------S---K--N-----E-------P---DWR--G-----
Sequence 2 QEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCDHPPASWDWRKKGVITQV

Sequence 1 KSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCN
           K-QG-CG--WAFSA----E----I-TG-L-SLSEQEL-DC-------G--
Sequence 2 KYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDC--VEESEGSY

Sequence 1 GGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV
           -G-----F------GGI-T---YPY-A--G-C-------K-VTID-YE--
Sequence 2 NGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDK-VTIDGYETL

Sequence 1 PYNNE-------WALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGP-CGT
           ----E--------A---A---QP-SV--DA----F--Y--GI--G--C--
Sequence 2 IMSDESTESETEQAFLSAILEQPISVSIDAKD--FHLYTGGIYDGENCTS

Sequence 1 --AIDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGA-GT
           ---I-H-V--VGYG---G-DYWI-KNSW---WGE-GY--I-RN-G---G-
Sequence 2 PYGINHFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQRNTGNLLGV

Sequence 1 CGIATMPSYPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           CG-----SYP-K-------------------S-----------------
Sequence 2 CGMNYFASYPTKEESETLVSARVKGHRRVDHSPL---------------



Alignment 7
Sequence 1:
Sequence 2: Allergen Gly m 1, Sequence: P22895
Sequence identity: 35.00 (133/380)
Sequence 1 -MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQ-RTNDEVKAMYESWLIK
           ---L-----S---L--S-------------LT---T---V------W---
Sequence 2 MGFLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSE

Sequence 1 YGKSYNSLGEWERRFEIFKETLRFIDEHNAD--TNRSYKVGLNQFADLTD
           -G--Y----E---R-EIFK-----I---NA------S---GLN-FAD-T-
Sequence 2 HGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITP

Sequence 1 EEFRSTYLGFTSG-SNKTKVSNRY---EPRVGQVLPSYVDWRSAGAVVDI
           -EF---YL------S---K--N-----E-------P---DWR--G-----
Sequence 2 QEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCDHPPASWDWRKKGVITQV

Sequence 1 KSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCN
           K-QG-CG--WAFSA----E----I-TG-L-SLSEQEL-DC-------G--
Sequence 2 KYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDC--VEESEGSY

Sequence 1 GGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV
           -G-----F------GGI-T---YPY-A--G-C-------K-VTID-YE--
Sequence 2 NGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDK-VTIDGYETL

Sequence 1 PYNNE-------WALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGP-CGT
           ----E--------A---A---QP-SV--DA----F--Y--GI--G--C--
Sequence 2 IMSDESTESETEQAFLSAILEQPISVSIDAKD--FHLYTGGIYDGENCTS

Sequence 1 --AIDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGA-GT
           ---I-H-V--VGYG---G-DYWI-KNSW---WGE-GY--I-RN-G---G-
Sequence 2 PYGINHFVLLVGYGSADGVDYWIAKNSWGFDWGEDGYIWIQRNTGNLLGV

Sequence 1 CGIATMPSYPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           CG-----SYP-K-------------------S-----------------
Sequence 2 CGMNYFASYPTKEESETLVSARVKGHRRVDHSPL---------------



Alignment 8
Sequence 1:
Sequence 2: Allergen Amb a 11.0101, Sequence: V5LU01
Sequence identity: 37.11 (141/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSL--AFNAKNLTQRTNDEVKAMYESWLIK
           --------------FS--LIL-L---F---------------MY--W---
Sequence 2 ----MEINKLVCFSFSLVLILGLVESFHYHERELESEEGFMGMYDRWREQ

Sequence 1 YGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEE
           ------S------RF--FK---R-I-E-N------YK---N-FAD-T--E
Sequence 2 HNIEMRS----PERFNVFKYNVRRIHESNK-MDKPYKLKVNEFADMTNLE

Sequence 1 FRSTYL-----------GFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAG
           F--TY------------G---GS--T--------------P--VDWR---
Sequence 2 FVNTYANSKISHFQALRGSAPGSIDTDPNKDFIYANVTKIPDKVDWREKN

Sequence 1 AVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQN
           AV-D-K-QG-CG-CWAF-A----EGIN-I-TG-L---SEQ-L-DC--T--
Sequence 2 AVTDVKGQGGCGSCWAFAAVVALEGINAIRTGKLVKFSEQQLVDCDMTNA

Sequence 1 TRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTID
           --GC-GG-----F---I--GGI--E--YPY------C-----------ID
Sequence 2 --GCDGGLMEPAFTYVIKHGGIAPEASYPYVGKRETCD-KAKIKDVLKID

Sequence 1 TYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAID
           ---NVP---E-AL--AV--QPV-------G-----YS-G--TG-CGT---
Sequence 2 GRQNVPGLDEEALRKAVAHQPVATGIQLSGHGLQFYSEGVYTGDCGTEPN

Sequence 1 HAVTIVGYG-TEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIAT
           H-V-IVGYG--E-GI--W-VKNSW--TWGE-GY----R-----G-CG-A-
Sequence 2 HGVGIVGYGENEKGIKFWTVKNSWGPTWGEKGYIHLQRGARKEGLCGVAM

Sequence 1 MPSYPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA------
           --S-P------N-P-P-----N-P-----KD-P----D------------
Sequence 2 HSSFPI----MNDPNPPKDDPNGP-----KDDPDAPKDPKFKTTQRLQGI

Sequence 1 -------
           -------
Sequence 2 RTKLLEL



Alignment 9
Sequence 1:
Sequence 2: Allergen Blo t 1.0201, Sequence: AAQ24541
Sequence identity: 29.21 (111/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSL-AFNAKNLTQRTNDEVKAMYESWLIKY
           -----------------LL---L-A--A------T--E-K---E------
Sequence 2 --------------MKFLLVAALCALVAIGSCKPTREEIKT-FEQFKKVF

Sequence 1 GKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEF
           GK-Y----E--RR---FKE-L----EHN------Y----N---D----EF
Sequence 2 GKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAI--NEYSDMSEQEF

Sequence 1 RSTYLGFTSGSNKTKVSNRYEPRVGQV--LPSYVDWRSAGAVVDIKSQGE
           -----G--------K-----EP-------LP---DWR-------I--QG-
Sequence 2 SFHLSGGGLNFTYMKMEAAKEPLINTYGSLPQNFDWRQKARLTRIRQQGS

Sequence 1 CGGCWAFSAIATVEGINKIVTGVLISLSEQELIDC--GRTQNTRGCNG--
           CG-CWAF-A----E----I-----I-LSEQEL-DC---R------CNG--
Sequence 2 CGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCG

Sequence 1 -GYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV
           -GY-T--F---I--G----EENYPY------CN-------Y-----Y---
Sequence 2 SGYSTEAFKYMIRTGLVE-EENYPYNMRTQWCNPDVEGQRY-HVSGYQQL

Sequence 1 PY--NNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGPC--GTAIDH
           -Y----E----T-----PV----------F-----G---G--------DH
Sequence 2 RYQSSDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDH

Sequence 1 AVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMP
           AV--VG-GT--G-DYWI--NSW-T-WG--GY----R---G----GI----
Sequence 2 AVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYVER---GHNSLGINNFV

Sequence 1 SYPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -Y----------------------------------------
Sequence 2 TYATL-------------------------------------



Alignment 10
Sequence 1:
Sequence 2: Allergen Eur m 1.0102, Sequence: AAC82352
Sequence identity: 27.89 (106/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------L----LL-LS----A------T--E-K-----------
Sequence 2 --------MKIILAIASLLVLSAVY-ARPASIKTFEEFKKAFN-------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           KSY------E-----F-E-L------------S-K---N---DL---EF-
Sequence 2 KSYATPEKEEVARKNFLESLKYVE--------SNKGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSNKTKV-----SNRYEPRVGQV-LPSYVDWRSAGAVVDIKS
           ---L---------K---------Y------V-LPS--D-RS---V--I--
Sequence 2 NQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRTVTPIRN

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------L-EQEL-DC---QN--GC-G-
Sequence 2 QGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCA-SQN--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--
           -I--G---I--NG----E--YPY-A----C-----N--------Y-----
Sequence 2 TIPRGIEYIQQNGVVQ-EHYYPYVAREQSCHRP--NAQRYGLKNYCQISP

Sequence 1 PYNNEWALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HA
           P--N--------T---V-V--------AF--Y----I-----G-----HA
Sequence 2 PDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY-----N--------------
Sequence 2 VNIVGYGNTQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 L----------------------------------------



Alignment 11
Sequence 1:
Sequence 2: Allergen Eur m 1.0101, Sequence: P25780
Sequence identity: 27.63 (105/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------L----LL-LS----A------T--E-K-----------
Sequence 2 --------MKIILAIASLLVLSAVY-ARPASIKTFEEFKKAFN-------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y------E-----F-E-L------------S-K---N---DL---EF-
Sequence 2 KTYATPEKEEVARKNFLESLKYVE--------SNKGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSNKTKV-----SNRYEPRVGQV-LPSYVDWRSAGAVVDIKS
           ---L---------K---------Y------V-LPS--D-RS---V--I--
Sequence 2 NQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------L-EQEL-DC---QN--GC-G-
Sequence 2 QGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCA-SQN--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--
           -I--G---I--NG----E--YPY-A----C-----N--------Y-----
Sequence 2 TIPRGIEYIQQNGVVQ-EHYYPYVAREQSCHRP--NAQRYGLKNYCQISP

Sequence 1 PYNNEWALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HA
           P--N--------T---V-V--------AF--Y----I-----G-----HA
Sequence 2 PDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY-----N--------------
Sequence 2 VNIVGYGNTQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYVVM

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 L----------------------------------------



Alignment 12
Sequence 1:
Sequence 2: Allergen Eur m 1.0101, Sequence: AAC82351
Sequence identity: 27.63 (105/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------L----LL-LS----A------T--E-K-----------
Sequence 2 --------MKIILAIASLLVLSAVY-ARPASIKTFEEFKKAFN-------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y------E-----F-E-L------------S-K---N---DL---EF-
Sequence 2 KTYATPEKEEVARKNFLESLKYVE--------SNKGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSNKTKV-----SNRYEPRVGQV-LPSYVDWRSAGAVVDIKS
           ---L---------K---------Y------V-LPS--D-RS---V--I--
Sequence 2 NQFLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------L-EQEL-DC---QN--GC-G-
Sequence 2 QGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCA-SQN--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--
           -I--G---I--NG----E--YPY-A----C-----N--------Y-----
Sequence 2 TIPRGIEYIQQNGVVQ-EHYYPYVAREQSCHRP--NAQRYGLKNYCQISP

Sequence 1 PYNNEWALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HA
           P--N--------T---V-V--------AF--Y----I-----G-----HA
Sequence 2 PDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY-----N--------------
Sequence 2 VNIVGYGNTQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYVVM

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 L----------------------------------------



Alignment 13
Sequence 1:
Sequence 2: Allergen Der f 1.0105, Sequence: 2428875
Sequence identity: 25.79 (98/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------------------------------------E-------
Sequence 2 ----------------------------------RPASIKTFEEFKKAFN

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEP---RVGQV-LPSYVDWRSAGAVVDIKS
           --YL---------KT------E----R---V--PS--D-RS---V--I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQEL-DC---Q---GC-G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQH--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYDISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 14
Sequence 1:
Sequence 2: Allergen Der f 1.0103, Sequence: 2428875
Sequence identity: 25.79 (98/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------------------------------------E-------
Sequence 2 ----------------------------------RPASIKTFEEFKKAFN

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEP---RVGQV-LPSYVDWRSAGAVVDIKS
           --YL---------KT------E----R---V--PS--D-RS---V--I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQEL-DC---Q---GC-G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQH--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYGGRTIIQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 15
Sequence 1:
Sequence 2: Allergen Der f 1.0101, Sequence: BAC53948
Sequence identity: 27.89 (106/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------L----LL-LS----A------T--E-K-----------
Sequence 2 --------MKFVLAIASLLVLSTVY-ARPASIKTFEEFKKAFN-------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEP---RVGQV-LPSYVDWRSAGAVVDIKS
           --YL---------KT------E----R---V--PS--D-RS---V--I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQEL-DC---Q---GC-G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQH--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 16
Sequence 1:
Sequence 2: Allergen Der f 1.0110, Sequence: ABL84751
Sequence identity: 27.89 (106/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------L----LL-LS----A------T--E-K-----------
Sequence 2 --------MKFVLAIASLLVLSTVY-ARPASIKTFEEFKKAFN-------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEP---RVGQV-LPSYVDWRSAGAVVDIKS
           --YL---------KT------E----R---V--PS--D-RS---V--I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQEL-DC---Q---GC-G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQH--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIRHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 17
Sequence 1:
Sequence 2: Allergen Der f 1.0102, Sequence: 2428875
Sequence identity: 25.79 (98/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------------------------------------E-------
Sequence 2 ----------------------------------RPASIKTFEEFKKAFN

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEP---RVGQV-LPSYVDWRSAGAVVDIKS
           --YL---------KT------E----R---V--PS--D-RS---V--I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQEL-DC---Q---GC-G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQH--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQRDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 18
Sequence 1:
Sequence 2: Allergen Der f 1.0107, Sequence: 2428875
Sequence identity: 25.79 (98/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------------------------------------E-------
Sequence 2 ----------------------------------RPASIKTFEEFKKAFN

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEP---RVGQV-LPSYVDWRSAGAVVDIKS
           --YL---------KT------E----R---V--PS--D-RS---V--I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQEL-DC---Q---GC-G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQH--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQRC--RRPNSQHYGISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 19
Sequence 1:
Sequence 2: Allergen Der f 1.0108, Sequence: ABL84749
Sequence identity: 27.63 (105/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------L----LL-LS----A------T--E-K-----------
Sequence 2 --------MKFVLAIASLLVLSTVY-ARPASIKTFEEFKKAFN-------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEP---RVGQV-LPSYVDWRSAGAVVDIKS
           --YL---------KT------E----R---V--PS--D-RS------I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTATPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQEL-DC---Q---GC-G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQH--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 20
Sequence 1:
Sequence 2: Allergen Der f 1.0109, Sequence: ABL84750
Sequence identity: 27.63 (105/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------L----LL-LS----A------T--E-K-----------
Sequence 2 --------MKFVLAIASLLVLSTVY-ARPASIKTFEEFKKAFN-------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEP---RVGQV-LPSYVDWRSAGAVVDIKS
           --YL---------KT------E----R---V--PS--D-RS---V--I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQ-L-DC---Q---GC-G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQKLVDCA-SQH--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 21
Sequence 1:
Sequence 2: Allergen Der f 1, Sequence: P16311
Sequence identity: 27.89 (106/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------L----LL-LS----A------T--E-K-----------
Sequence 2 --------MKFVLAIASLLVLSTVY-ARPASIKTFEEFKKAFN-------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEP---RVGQV-LPSYVDWRSAGAVVDIKS
           --YL---------KT------E----R---V--PS--D-RS---V--I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQEL-DC---Q---GC-G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQH--GCHGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQRC--RRPNSQHYGISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGDDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 22
Sequence 1:
Sequence 2: Allergen Der f 1.0104, Sequence: 2428875
Sequence identity: 25.00 (95/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------------------------------------E-------
Sequence 2 ----------------------------------RPASIKTFEEFKKAFN

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E-E-----F-E-L--------------K---N---DL---EF-
Sequence 2 KNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFK

Sequence 1 STYL----GFTSGSNKTKVSNRYEP-RVGQV-LPSYVDWRSAGAVVDIKS
           --YL-----F----------------R---V--PS--D-RS---V--I--
Sequence 2 NRYLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRM

Sequence 1 QGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGG
           QG-CG-CWAFS--A--E------------LSEQEL-DC---Q--R---G-
Sequence 2 QGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQHGR--HGD

Sequence 1 YITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPY
           -I--G---I--NG----E--YPY-A----C-----N-----I--Y-----
Sequence 2 TIPRGIEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYCQIYP

Sequence 1 NNEWALQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HA
           --------A-T------A------D--AF--Y----I-----G-----HA
Sequence 2 PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHA

Sequence 1 VTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPS
           V-IVGYG---G-DYWIV-NSWDTTWG--GY--------------------
Sequence 2 VNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVI

Sequence 1 YPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------------
Sequence 2 M----------------------------------------



Alignment 23
Sequence 1:
Sequence 2: Allergen Der p 1.0124, Sequence: CAQ68250
Sequence identity: 23.95 (91/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------------------------------------E-------
Sequence 2 ----------------------------------RPSSIKTFEEYKKAFN

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           KSY------E-----F-E--------------------N---DL---EF-
Sequence 2 KSYATFEDEEAARKNFLESVKYVQSNGG--------AINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEPRVGQV---LPSYVDWRSAGAVVDIKSQ
           ---L---------KT------E----------P---D-R----V--I--Q
Sequence 2 NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQ

Sequence 1 GECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGY
           G-CG-CWAFS--A--E------------L-EQEL-DC---Q---GCNG--
Sequence 2 GGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCNGDT

Sequence 1 ITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--P
           I--G---I--NG----E--Y-Y-A----C-----N-----I--Y-----P
Sequence 2 IPRGIEYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPP

Sequence 1 YNNEWALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAV
           --N------A-T-----V-------DAF--Y----I-----G-----HAV
Sequence 2 NANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAV

Sequence 1 TIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSY
           -IVGY----G-DYWIV-NSWDT-WG--GY-----N---------------
Sequence 2 NIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL

Sequence 1 PVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           ----------------------------------------
Sequence 2 ----------------------------------------



Alignment 24
Sequence 1:
Sequence 2: Allergen Der p 1.0113, Sequence: ABA39435
Sequence identity: 23.68 (90/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------------------------------------E-------
Sequence 2 ----------------------------------RPSSIKPFEEYKKAFN

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           KSY------E-----F-E--------------------N---DL---EF-
Sequence 2 KSYATFEDEEAARKNFLESVKYVQSNGG--------AINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEPRVGQV---LPSYVDWRSAGAVVDIKSQ
           ---L---------KT------E----------P---D-R----V--I--Q
Sequence 2 NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQ

Sequence 1 GECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGY
           G-CG-CWAFS--A--E------------L-EQEL-DC---Q---GC-G--
Sequence 2 GGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDT

Sequence 1 ITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--P
           I--G---I--NG----E--Y-Y-A----C-----N-----I--Y-----P
Sequence 2 IPRGIEYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPP

Sequence 1 YNNEWALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAV
           --N------A-T-----V-------DAF--Y----I-----G-----HAV
Sequence 2 NANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAV

Sequence 1 TIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSY
           -IVGY----G-DYWIV-NSWDT-WG--GY-----N---------------
Sequence 2 NIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL

Sequence 1 PVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           ----------------------------------------
Sequence 2 ----------------------------------------



Alignment 25
Sequence 1:
Sequence 2: Allergen Blo t 1.0101, Sequence: AAK58415
Sequence identity: 20.00 (76/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---DWR----V--I--QG-CG-
Sequence 2 --------------------------IPANFDWRQKTHVNPIRNQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGR-----TQNTRGCNGGY
           CWAF-A----E----I-----I-LSEQEL-DC-------T----GC--G-
Sequence 2 CWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLYDPTYKCHGCQSGM

Sequence 1 ITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPYN
           ----F------G----E--YPY------C--------Y-----Y----Y-
Sequence 2 SPEAFKYMKQKGLLE-ESHYPYKMKLNQCQANARGTRY-HVSSYNSLRYR

Sequence 1 -NEWALQTAV-TYQPVSVALDAAGDAFKQYSSGIFTGP--CGTAIDHAVT
           ------Q-A-----PV----------F-----GI--G-------IDHAV-
Sequence 2 AGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVV

Sequence 1 IVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYP
           -VG-GT--GIDYWIV--SW-T-WG--GY----R--------GI---P-Y-
Sequence 2 LVGWGTQNGIDYWIVRTSWGTQWGDAGYGFVERH---HNSLGINNYPIYA

Sequence 1 VKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           ---------------------------------------
Sequence 2 SL-------------------------------------



Alignment 26
Sequence 1:
Sequence 2: Allergen Eur m 1.0101, Sequence: CAA42677
Sequence identity: 20.79 (79/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           --------------------------LPS--D-RS---V--I--QG-CG-
Sequence 2 ----------------TYACSINSVSLPSELDLRSLRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---QN--GC-G--I--G-
Sequence 2 CWAFSGVASTESAYLAYRNMSLDLAEQELVDCA-SQN--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--YPY-A----C-----N--------Y-----P--N--
Sequence 2 EYIQQNGVVQ-EHYYPYVAREQSCHRP--NAQRYGLKNYCQISPPDSNKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ------T---V-V--------AF--Y----I-----G-----HAV-IVGY
Sequence 2 RQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           G---G-DYWIV-NSWDTTWG--GY-----N--------------------
Sequence 2 GNTQGVDYWIVRNSWDTTWGDNGYGYFAANINL-----------------

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 27
Sequence 1:
Sequence 2: Allergen Der p 1, Sequence: P08176
Sequence identity: 25.79 (98/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ------------L----LL-LS----A------T--E-K-----------
Sequence 2 --------MKIVLAIASLLALSAVY-ARPSSIKTFEEYKKAFN-------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           KSY------E-----F-E--------------------N---DL---EF-
Sequence 2 KSYATFEDEEAARKNFLESVKYVQSNGG--------AINHLSDLSLDEFK

Sequence 1 STYLGFTSGSN--KTKVSNRYEPRVGQV---LPSYVDWRSAGAVVDIKSQ
           ---L---------KT------E----------P---D-R----V--I--Q
Sequence 2 NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQ

Sequence 1 GECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGY
           G-CG-CWAFS--A--E------------L-EQEL-DC---Q---GC-G--
Sequence 2 GGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDT

Sequence 1 ITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--P
           I--G---I--NG----E--Y-Y-A----C-----N-----I--Y-----P
Sequence 2 IPRGIEYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPP

Sequence 1 YNNEWALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAV
           --N------A-T-----V-------DAF--Y----I-----G-----HAV
Sequence 2 NVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAV

Sequence 1 TIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSY
           -IVGY----G-DYWIV-NSWDT-WG--GY-----N---------------
Sequence 2 NIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL

Sequence 1 PVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           ----------------------------------------
Sequence 2 ----------------------------------------



Alignment 28
Sequence 1:
Sequence 2: Allergen Der f 1, Sequence: CAA46316
Sequence identity: 20.79 (79/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQV-LPSYVDWRSAGAVVDIKSQGECG
           ---------------------R---V--PS--D-RS---V--I--QG-CG
Sequence 2 ----------------ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCG

Sequence 1 GCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDG
           -CWAFS--A--E------------LSEQEL-DC---Q---GC-G--I--G
Sequence 2 SCWAFSGVAATESAYLAYRNTSLDLSEQELVDCA-SQH--GCHGDTIPRG

Sequence 1 FQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPYNNEWA
           ---I--NG----E--YPY-A----C-----N-----I--Y----------
Sequence 2 IEYIQQNGVVE-ERSYPYVAREQQC--RRPNSQHYGISNYCQIYPPDVKQ

Sequence 1 LQTAVTYQPVSVA-LDAAGD--AFKQYSS-GIFTGPCGTAID-HAVTIVG
           ---A-T------A------D--AF--Y----I-----G-----HAV-IVG
Sequence 2 IREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVG

Sequence 1 YGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKY
           YG---G-DYWIV-NSWDTTWG--GY-------------------------
Sequence 2 YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL----------------

Sequence 1 NNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           ------------------------------------
Sequence 2 ------------------------------------



Alignment 29
Sequence 1:
Sequence 2: Allergen Der p 1.0123, Sequence: 6771329
Sequence identity: 19.74 (75/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N-----I--Y-----P--N--
Sequence 2 EYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPPNANKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ----A-T-----V-------DAF--Y----I-----G-----HAV-IVGY
Sequence 2 REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N-------G------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Der p 1.0115, Sequence: 6771329
Sequence identity: 19.47 (74/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N-----I--Y-----P--N--
Sequence 2 EYIQHNGVVQ-ESYYRYVAREQSC--RRPNTQRFGISNYCQIYPPNANKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ----A-T-----V-------DAF--Y----I-----G-----HAV-IVGY
Sequence 2 REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N--------------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 31
Sequence 1:
Sequence 2: Allergen Der p 1.0118, Sequence: 6771329
Sequence identity: 19.47 (74/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQIRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N-----I--Y-----P--N--
Sequence 2 EYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPPNANKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ----A-T-----V-------DAF--Y----I-----G-----HAV-IVGY
Sequence 2 REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N--------------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 32
Sequence 1:
Sequence 2: Allergen Der p 1.0120, Sequence: 6771329
Sequence identity: 19.47 (74/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N-----I--Y-----P--N--
Sequence 2 EYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPPNANKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ----A-T-----V-------DAF--Y----I-----G-----HAV-IVGY
Sequence 2 REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIRRDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N--------------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 33
Sequence 1:
Sequence 2: Allergen Der p 1.0121, Sequence: 6771329
Sequence identity: 19.74 (75/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRSQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N-----I--Y-----P--N--
Sequence 2 EYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPPNVNKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ----A-T-----V-------DAF--Y----I-----G-----HAV-IVGY
Sequence 2 REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N-------G------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 34
Sequence 1:
Sequence 2: Allergen Der p 1.0114, Sequence: 6771329
Sequence identity: 19.47 (74/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N-----I--Y-----P--N--
Sequence 2 AYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPPNANKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ----A-T-----V-------DAF--Y----I-----G-----HAV-IVGY
Sequence 2 REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N--------------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 35
Sequence 1:
Sequence 2: Allergen Der p 1.0117, Sequence: 6771329
Sequence identity: 19.21 (73/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N-----I--Y-----P--N--
Sequence 2 EYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPPNANKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ------T-----V-------DAF--Y----I-----G-----HAV-IVGY
Sequence 2 REALTQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N--------------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 36
Sequence 1:
Sequence 2: Allergen Der p 1.0119, Sequence: 6771329
Sequence identity: 19.47 (74/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N-----I--Y-----P--N--
Sequence 2 GYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPPNVNKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ----A-T-----V-------DAF--Y----I-----G-----HAV-IVGY
Sequence 2 REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N--------------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 37
Sequence 1:
Sequence 2: Allergen Der p 1.0122, Sequence: 6771329
Sequence identity: 19.21 (73/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N--------Y-----P--N--
Sequence 2 EYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGTSNYCQIYPPNANKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAID-HAVTIVGY
           ----A-T-----V-------DAF--Y----I-----G-----HAV-IVGY
Sequence 2 REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N--------------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 38
Sequence 1:
Sequence 2: Allergen Der p 1.0116, Sequence: 6771329
Sequence identity: 19.21 (73/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           ---------------------------P---D-R----V--I--QG-CG-
Sequence 2 -----------------TNACSINGNAPAEIDLRQLRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I--G-
Sequence 2 CWAFSGVAATESAYLAYRNQSLDLAEQELVDCA-SQH--GCHGDTIPRGI

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENV--PYNNEW
           --I--NG----E--Y-Y-A----C-----N-----I--Y-----P--N--
Sequence 2 EYIQHNGVVQ-ESYYRYVAREQSC--RRPNAQRFGISNYCQIYPPNANKI

Sequence 1 ALQTAVTYQPVSVALDAAG-DAFKQYSS-GIFTGPCGTAIDH-AVTIVGY
           ----A-T-----V-------DAF--Y----I-----G------AV-IVGY
Sequence 2 REALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYYAVNIVGY

Sequence 1 GTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYN
           ----G-DYWIV-NSWDT-WG--GY-----N--------------------
Sequence 2 SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL-----

Sequence 1 NQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 39
Sequence 1:
Sequence 2: Allergen Tyr p 1.0101, Sequence: ABM53753
Sequence identity: 30.53 (116/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           ---------M-LLF----L-L---F-------R----V----E----K-G
Sequence 2 ---------MALLFY--ILFLFFTF----IQCRHLEKVPT-WEQYKVKFG

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           K-Y----E---R-------L--I---N---------GLN---D--DEEF-
Sequence 2 KNYLTINEENFRKNNYFNSLTKIVKNNGKNGVT--LGLNDMSDWSDEEFF

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVG-QVLPSYVDWRSAGAVVDIKSQGECG
           S--L---S-S----VS-R----V-----P---DWR---A---I--QG-C-
Sequence 2 S--LNSKSPSS-VFVSARPTSTVNTSPFPKSWDWRNIIAFNSIEQQGRCS

Sequence 1 GCWAFSAIATVEGI-NKIVTGVLISLSEQELIDC-GRTQNTR----GCNG
           -CWAF-A--TVE-------------LS-QEL-DC--RT--------GC-G
Sequence 2 SCWAFAAATTVEAAYAHQKNKHNLHLSRQELVDCTNRTFDQHYLNYGCKG

Sequence 1 GYITDGFQFIINNGGINTEENYPYTAQDGE-CNVE-LQNEK----YVTID
           G--T-----I---G-------Y-YT----E-C--------K-------I-
Sequence 2 GWPTEAYKYIMDHG-VYEDKLYHYTETFNEVCYADKVAHDKGHPVKYYIS

Sequence 1 TYENVPYNN--EWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTG--PCG
           -Y----YN---E------VTY-P--V------D-F--Y--GI-----P--
Sequence 2 NYGRLAYNDTDEAIMAMLVTYGPGTVDIHGTSDTFRFYKGGIMRNVMPNS

Sequence 1 TAIDHAVTIVGYGTEG-GIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTC
           ----H-V--VGYGT---G-DYWI--NSW--TWGE-GY-R--R--------
Sequence 2 AYTNHIVVVVGYGTDSSGVDYWIIRNSWGKTWGEHGYGRLERH---PNLL

Sequence 1 GIATMPSYPVKYNNQNYPEPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           G------YP---------------------------------------
Sequence 2 GFNNKYNYPIL-------------------------------------



Alignment 40
Sequence 1:
Sequence 2: Allergen Der p 1, Sequence: AAA28296
Sequence identity: 7.63 (29/380)
Sequence 1 MGLPKSFVSMSLLFFSTLLILSLAFNAKNLTQRTNDEVKAMYESWLIKYG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFR
           --------------------------------------------------
Sequence 2 -------------------------------------------------M

Sequence 1 STYLGFTSGSNKTKVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGG
           S--------------------------P---D-R----V--I--QG-CG-
Sequence 2 SAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS

Sequence 1 CWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGF
           CWAFS--A--E------------L-EQEL-DC---Q---GC-G--I----
Sequence 2 CWAFSGVAATESAYLAHRNQSLDLAEQELVDCA-SQH--GCHGDTIPR--

Sequence 1 QFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYENVPYNNEWAL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QTAVTYQPVSVALDAAGDAFKQYSSGIFTGPCGTAIDHAVTIVGYGTEGG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNYP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EPYSSLINPPAFSMSKDGPVGVEDGQRYSA
           ------------------------------
Sequence 2 ------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.