The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Jug r 2

Sequence 6580762

Full FASTA alignment

Sequence name:
Query sequence:
RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV
KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRA
TLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVN
NPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQR
EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFG
QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTG
RYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH
PIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSFNM
PREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFAFF

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Jug r 2AAF18269Go!593431.38.6e-122
2Car i 2.0101B3STU4Go!792397.31.9e-111
3Jug n 2AAM54366Go!481336.42.5e-93
4Mac i 1.0201Q9SPL4Go!666191.11.9e-49
5Mac i 1.0101Q9SPL3Go!625188.89.1e-49
6Jug r 6.0101A0A2I4E5L6Go!502158.59.4e-40
7Ses i 3AAK15089Go!585149.36.4e-37
8Gly m 5.0201Q9FZP9Go!559133.53.5e-32
9Gly m conglycininCAA35691Go!605133.24.7e-32
10Gly m 5.0101O22120Go!543127.81.7e-30
11Cor a 11AAL86739Go!448126.43.9e-30
12Pis v 3.0101EF116865Go!519121.01.9e-28
13Pin k 2.0101V9VGU0Go!463119.35.3e-28
14Vig r 2.0101Q198W3Go!453115.29.2e-27
15Gly m conglycininAAB23463Go!439112.75.0e-26
16Ana o 1.0101AAM73730Go!538110.23.4e-25
17Ana o 1.0102AAM73729Go!536110.13.7e-25
18Vig r 2.0201B1NPN8Go!454106.05.6e-24
19Lup an 1.0101ACB05815Go!61186.55.4e-18
20Ara h 1P43237Go!61467.92.2e-12
21Ara h 1P43238Go!62667.52.9e-12
22Gly m conglycininAAB01374Go!63965.71.1e-11
23Len c 1.0101CAD87730Go!41860.03.5e-10
24Len c 1.0102CAD87731Go!41559.64.7e-10
25Gly m conglycininAAA33947Go!21850.01.9e-07
26Pru du 8.0101A0A516F3L2Go!26442.73.7e-05
27Fag e 3.0101A5HIX6Go!13639.81.4e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 100.00 (593/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
Sequence 2 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
Sequence 2 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
           QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
Sequence 2 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ

Sequence 1 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV
           YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV
Sequence 2 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV

Sequence 1 KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRA
           KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRA
Sequence 2 KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRA

Sequence 1 TLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVN
           TLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVN
Sequence 2 TLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVN

Sequence 1 NPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQR
           NPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQR
Sequence 2 NPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQR

Sequence 1 EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFG
           EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFG
Sequence 2 EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFG

Sequence 1 QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTG
           QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTG
Sequence 2 QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTG

Sequence 1 RYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH
           RYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH
Sequence 2 RYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH

Sequence 1 PIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSFNM
           PIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSFNM
Sequence 2 PIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSFNM

Sequence 1 PREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFAFF
           PREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFAFF
Sequence 2 PREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFAFF



Alignment 2
Sequence 1:
Sequence 2: Allergen Car i 2.0101, Sequence: B3STU4
Sequence identity: 92.92 (551/593)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVTKAKIPLFLFLSALFLALVCSSLALETEDLSNELNPHHDPESHRWEFQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCQERCQHEERGQRQAQQCQRRCEEQLREREREREREEIVDPREPRKQYE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCRETCEKQDPRQQPQCERRCERQFQEQQERERRERRRGRDDDDKENPRD

Sequence 1 ----------------------------------------------RGRD
           ----------------------------------------------RGRD
Sequence 2 PREQYRQCEEHCRRQGQGQRQQQQCQSRCEERFEEEQRRQEERERRRGRD

Sequence 1 DDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQRSQE
           -DDEENPRDPREQYRQCQE-CRRQGQGQRQQQQCQ-RCEERLEE-QR-QE
Sequence 2 NDDEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQE

Sequence 1 ERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCEQRRQ
           ERERRRGRD-DDQNPRDPEQRYEQCQQQCERQRRGQEQ-LCRRRCEQ-RQ
Sequence 2 ERERRRGRDEDDQNPRDPEQRYEQCQQQCERQRRGQEQQLCRRRCEQQRQ

Sequence 1 QEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQ
           QEERERQRGRDRQDPQQQYHRCQRRCQ-QEQSPERQRQCQQRCERQYKEQ
Sequence 2 QEERERQRGRDRQDPQQQYHRCQRRCQTQEQSPERQRQCQQRCERQYKEQ

Sequence 1 QGRERGPE-ASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYL
           QGRE-GP--ASPRRESRGREEEQQRHNPYYFHSQ--RSRHES-EGEVKYL
Sequence 2 QGREWGPDQASPRRESRGREEEQQRHNPYYFHSQGLRSRHESGEGEVKYL

Sequence 1 ERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRATLT
           ERFTERTELLRGIENYRVVIL-ANPNT--LP-HKDAESV-VVTRGRATLT
Sequence 2 ERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAESVIVVTRGRATLT

Sequence 1 LVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVNNPG
           -VSQE-RESFNLE-GDVIRVPAGAT-YVINQDSNERLEMVKLLQPVNNPG
Sequence 2 FVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNPG

Sequence 1 QFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGV
           QFREYYAAGA-S---SYLRVFSNDILVAALNTPRDRLERFFDQQEQREGV
Sequence 2 QFREYYAAGAQSTE-SYLRVFSNDILVAALNTPRDRLERFFDQQEQREGV

Sequence 1 IIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFF
           IIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKS---SYSNQFGQFF
Sequence 2 IIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQFF

Sequence 1 EACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYE
           EACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGR-E
Sequence 2 EACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFE

Sequence 1 MACPH-VSSQSYEGQGRREQEEEES-TGRFQKVTARLARGDIFVIPAGHP
           MACPH-VSSQSYE--GRREQEEEES-TG-FQKVTARLARGDIFVIPAGHP
Sequence 2 MACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHP

Sequence 1 IAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSFNMP
           IAITASQNENLRL-GF-ING-NNQR-FLAGQNNIINQLEREAKELSFNMP
Sequence 2 IAITASQNENLRLVGFGINGKNNQRNFLAGQNNIINQLEREAKELSFNMP

Sequence 1 REEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFAFF-
           REEIEEIFE-Q-ESYFVP-ERQSRRGQGRDHPLASILDFA-F-
Sequence 2 REEIEEIFERQVESYFVPMERQSRRGQGRDHPLASILDFAGFF



Alignment 3
Sequence 1:
Sequence 2: Allergen Jug n 2, Sequence: AAM54366
Sequence identity: 78.92 (468/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
           ------------GRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
Sequence 2 ------------GRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ

Sequence 1 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV
           YKEQQGRERGPEASPRRES-GREEEQQRHNPYYFHSQSIRSRHESEEGEV
Sequence 2 YKEQQGRERGPEASPRRESKGREEEQQRHNPYYFHSQSIRSRHESEEGEV

Sequence 1 KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRA
           KYLERF-ERTELLRGIENYRVVILDANPNT-MLPHHKDAESV-VVTRGRA
Sequence 2 KYLERFAERTELLRGIENYRVVILDANPNTFMLPHHKDAESVIVVTRGRA

Sequence 1 TLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVN
           TLTLVSQETRESFNLECGDVIRVPAGAT-YVINQDSNERLEMVKLLQPVN
Sequence 2 TLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMVKLLQPVN

Sequence 1 NPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQR
           NPGQ-REYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQR
Sequence 2 NPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQR

Sequence 1 EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFG
           EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSE-PSYSNQFG
Sequence 2 EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFG

Sequence 1 QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTG
           QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTG
Sequence 2 QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTG

Sequence 1 RYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH
           RYEMACPHVSSQS-E-QGRREQEEEESTGRFQKVTARLARGDIFVIPAGH
Sequence 2 RYEMACPHVSSQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH

Sequence 1 PIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSFNM
           PIAITASQNENLRLLGF-INGENNQR-FLAGQN-IINQLEREAKELSFNM
Sequence 2 PIAITASQNENLRLLGFGINGENNQRNFLAGQNSIINQLEREAKELSFNM

Sequence 1 PREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFAFF
           PREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASIL-FAFF
Sequence 2 PREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILGFAFF



Alignment 4
Sequence 1:
Sequence 2: Allergen Mac i 1.0201, Sequence: Q9SPL4
Sequence identity: 46.04 (273/593)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAINTSNLCSLLFLLSLFLLSTTVSLAESEFDRQEYEECKRQCMQLETSG

Sequence 1 --------------RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQ
           -----------------D-----N--DP-----QCQ--CR-Q--G-RQQQ
Sequence 2 QMRRCVSQCDKRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQ

Sequence 1 QCQIRCEERLEEDQRSQEERE-RRRGRDVDDQNPR-DPEQRYEQ-CQQQC
           -CQ-RC-E--EE-------R--------------R---E-R--Q-CQQ-C
Sequence 2 YCQRRCKEICEEEEEYNRQRDPQQQYEQCQERCQRHETEPRHMQTCQQRC

Sequence 1 ERQRRGQEQTLCRRRCEQRRQQEER--ERQRGRD-RQDPQQ-QYHRCQRR
           ER-----------R--EQ-R--EE---ER----D---DPQQ--Y--C-RR
Sequence 2 ERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKRDPQQREYEDCRRR

Sequence 1 CQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESRGREEE---Q
           C--QE--P--Q-QCQ-RC-R----Q-GR--G----P-R---GR-EE----
Sequence 2 CEQQE--PRQQYQCQRRC-REQQRQHGRG-GDLINPQRGGSGRYEEGEEK

Sequence 1 QRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDA
           Q--NPYYF---S---R---EEG----LE-F--R--LLR---NYR-V-L-A
Sequence 2 QSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEA

Sequence 1 NPNTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAG
           NPN---LP-H-DA-----VT-GR--L-------RES-NLECGDVIR-PAG
Sequence 2 NPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAG

Sequence 1 ATVYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSN
           -T-Y-IN-D-NERL---K-LQ----PGQ--E---AG---P---YL--FS-
Sequence 2 TTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEP-YLSTFSK

Sequence 1 DILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRP
           -IL-AALNT---RL-----QQ--REGVII-ASQE--R-L---------R-
Sequence 2 EILEAALNTQAERLRGVLGQQ--REGVIISASQEQIRELTRD--DSESRR

Sequence 1 W----GRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNY
           W----G--SS-GP--L----P-YSN--GQ--E--PE--RQLQ-MDV-V--
Sequence 2 WHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFI

Sequence 1 AEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQ
           A-I--G-MM-P--N---T-VV-V--G----EMACPH-S-------G----
Sequence 2 ANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRH

Sequence 1 EEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGE
           EEEE-------V-ARL------V-P-GHP-----S-NENL-L--F-IN--
Sequence 2 EEEEDV-HYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQ

Sequence 1 NNQRDFLAG-QNNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTE
           NN---FLAG---N---Q-E--A-EL-F--PR-E-EE-F-SQ-ES-F-P--
Sequence 2 NNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGP

Sequence 1 RQ----SRRGQGRDHPLASILDFAFF
           RQ----S-R------PL-SILDF--F
Sequence 2 RQHQQQSSRSTKQQQPLVSILDFVGF



Alignment 5
Sequence 1:
Sequence 2: Allergen Mac i 1.0101, Sequence: Q9SPL3
Sequence identity: 46.37 (275/593)
Sequence 1 -----------------------RGRDDDDEENPRDPREQYRQCQEYCRR
           --------------------------D-----N--DP-----QCQ--CR-
Sequence 2 QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQEDPQTECQQCQRRCRQ

Sequence 1 QGQGQRQQQQCQIRCEERLEEDQRSQEERERRRGRDVDDQNPRDPEQRYE
           Q----RQQQ-CQ-RC-E--EE-----EE--R-R----------DP-Q-YE
Sequence 2 QESDPRQQQYCQRRCKEICEEE----EEYNRQR----------DPQQQYE

Sequence 1 QCQQQCER-QRRGQEQTLCRRRCEQRRQQEERERQR--------------
           QCQ--C-R----------C--RCE-R---E-R--Q---------------
Sequence 2 QCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQQKRYEEQQREDEEKYE

Sequence 1 -----GRDRQDPQQ-QYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQG
           -----G----DPQQ--Y--C-R-C--QE--P--Q-QCQ-RC--Q---Q-G
Sequence 2 ERMKEGDNKRDPQQREYEDCRRHCEQQE--PRLQYQCQRRCQEQQR-QHG

Sequence 1 RERGPEASPRRESRGREEE---QQRHNPYYFHSQSIRSRHESEEGEVKYL
           R--G----P-R---GR-EE----Q--NPYYF---S---R---EEG----L
Sequence 2 RG-GDLMNPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVL

Sequence 1 ERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRATLT
           E-F--R--LLR---NYR-V-L-ANPN---LP-H-DA-----V--GR--L-
Sequence 2 ENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVIGGRGALK

Sequence 1 LVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVNNPG
           ------RES-NLECGDVIR-PAG-T-Y-IN-D-NERL---K-LQ----PG
Sequence 2 MIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPG

Sequence 1 QFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGV
           Q--E---AG---P---YL--FS--IL-AALNT---RL-----QQ--REGV
Sequence 2 QYKEFFPAGGQNPEP-YLSTFSKEILEAALNTQTERLRGVLGQQ--REGV

Sequence 1 IIRASQEKLRALSQHAMSAGQRPW----GRRSSGGPISLKSESPSYSNQF
           IIRASQE--R-L---------R-W----G--SS-GP--L----P-YSN--
Sequence 2 IIRASQEQIRELTRD--DSESRRWHIRRGGESSRGPYNLFNKRPLYSNKY

Sequence 1 GQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGT
           GQ--E--PE--RQLQ-MDV-V--A-I--G-MM-P--N---T-VV-V--G-
Sequence 2 GQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGE

Sequence 1 GRYEMACPHVSSQ-SYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPA
           ---EMACPH-S------G-G-R--EEEE-------V-ARL------V--A
Sequence 2 ADVEMACPHLSGRHGGRGGGKRHEEEEEV--HYEQVRARLSKREAIVVLA

Sequence 1 GHPIAITASQNENLRLLGFDINGENNQRDFLAG-QNNIINQLEREAKELS
           GHP-----S-NENL-L--F-IN--NN---FLAG---N---Q-E--A-EL-
Sequence 2 GHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELA

Sequence 1 FNMPREEIEEIFESQMESYFVPTERQ----SRRGQGRDHPLASILDFAFF
           F---R-E-EE-F-SQ-ES-F-P--RQ----S-R------PL-SILDF--F
Sequence 2 FAASRKEVEELFNSQDESIFFPGPRQHQQQSPRSTKQQQPLVSILDFVGF



Alignment 6
Sequence 1:
Sequence 2: Allergen Jug r 6.0101, Sequence: A0A2I4E5L6
Sequence identity: 36.42 (216/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------MAFKPKIPIALL

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQ-CQQRCER
           ----------------QDP------C---C--Q-Q--E-----CQ--C--
Sequence 2 LLTSLLAICAGLALAMQDPELK--QCKHQCRHQRQFDEQEKEHCQRSCDE

Sequence 1 QYKEQQGRERGP-----EASPRRESRGREE---EQQRHNPYYFHSQSIRS
           ---E---RER-------E-S-R-E----EE---E----NPY-F-------
Sequence 2 YHIEKKARERAERRRSEEGSSREEGYEEEELGGEREEENPYVFEDEDFET

Sequence 1 RHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAES
           R----EG----LE-FT-R--LLRGIEN-RV-IL-ANP-T---P-H-DAE-
Sequence 2 RVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQTFISPAHFDAEL

Sequence 1 VAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLE
           V--V--GRAT-T-V--E-RE-FN-E-GD--R-PAG--VY-IN-D-NE-L-
Sequence 2 VVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDENEKLY

Sequence 1 MVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLE
           -VK-L-PV--PG-F------G---P--S--R-FS---L-AAL-T-RD-LE
Sequence 2 IVKILRPVSVPGHFEAFHGSGGEDPE-SFYRAFSWEVLEAALKTRRDQLE

Sequence 1 RFFDQQEQREGVIIRASQEKLRALSQHAMSAGQ-RPWGRRSSGGPISLKS
           --F--Q-Q--GVII-AS-E--R--S-H--------P-G--S---P--L--
Sequence 2 KLFGKQTQ--GVIIKASKEQIRSMSKHEETTPRIWPFGGDSTH-PFNLFH

Sequence 1 ESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKAT
           --PS-SNQFG--FE--P-E--QLQ--D--V--A-I--G-M--P-YNS-AT
Sequence 2 KRPSQSNQFGRLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRAT

Sequence 1 VVVYVVEGTGRYEMACPHVSSQSYEGQ--GRREQEEEESTG-RFQKVTAR
           ----V-EG-G--EMACPH-SS----GQ--G----------G---Q----R
Sequence 2 KISVVIEGEGYFEMACPHLSSSGSRGQREGSGSSRRRSRSGPSYQQIRGR

Sequence 1 LARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQNNIIN
           L--G--FV-PAGHP-A--AS-N-NL--L-FD-N---N-R--LAG-NNI-N
Sequence 2 LRPGMVFVAPAGHPVAVIASRNKNLQVLCFDVNAQGNIRFPLAGKNNIVN

Sequence 1 QLEREAKELSFNMPREEIEEIFESQMESYFVP-TERQSRRGQGRDHPLAS
           --E-EAKEL-FN-P--E-E-IF--Q----F-P---RQ---G-GR------
Sequence 2 EFEKEAKELAFNFPAREVEKIFRNQDQEFFFPGPSRQPEEG-GRAFE---

Sequence 1 ILDFAFF
           -------
Sequence 2 -------



Alignment 7
Sequence 1:
Sequence 2: Allergen Ses i 3, Sequence: AAK15089
Sequence identity: 42.33 (251/593)
Sequence 1 --------------RGRDDDDEENPRDPREQYRQCQEYCRRQGQ-GQRQQ
           --------------------------DP-----QC---C--Q-Q----Q-
Sequence 2 MSCGGRLCLVLFALLLASAVVASESKDP--ELKQCKHQCKAQQQISKEQK

Sequence 1 QQCQIRCEERLEEDQRSQEERERRRGRDVDDQ--NPRDPEQRYEQCQQQC
           --C---C-E-----Q--Q-E--R--G--------N---P--R---C---C
Sequence 2 EACIQACKEYIR--QKHQGEHGRGGGDILEEEVWNRKSPIERLRECSRGC

Sequence 1 ERQRRGQEQTLCRRRCEQRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQ
           E-Q--G-----C-RRC-Q---Q-E--RQ------DP--QY--C---C--Q
Sequence 2 EQQH-GEQREECLRRC-QEEYQREKGRQDDDNPTDPEKQYQQCRLQCRRQ

Sequence 1 -EQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESRGREEEQQRHN--
           -E--------C--R-E--Y-EQQGRE-G-------E-R-REEEQ------
Sequence 2 GEGGGFSREHCERRREEKYREQQGREGG--RGEMYEGREREEEQEEQGRG

Sequence 1 --PYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANP
           --PY-F--Q----------G----L--FT-R-ELLRGIENYRV-IL-A-P
Sequence 2 RIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEP

Sequence 1 NTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGAT
           -T---P-H-DAESV--V--GR-T--LV-Q--RES-N---GD-----AG-T
Sequence 2 QTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTT

Sequence 1 VYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDI
           -Y-IN-D-NERL---KLLQPV--PG-F-----AG---P--S----FS--I
Sequence 2 AYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPE-SFFKSFSDEI

Sequence 1 LVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWG
           L-AA-NT-RDRL-R-F-QQ--R-GVI--AS-E--RA-S-H----G--P-G
Sequence 2 LEAAFNTRRDRLQRIFGQQ--RQGVIVKASEEQVRAMSRHE-EGGIWPFG

Sequence 1 RRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRG
           --S-G--I------P--SNQ-GQ--E------RQL---D--V--A-I--G
Sequence 2 GESKG-TINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQG

Sequence 1 AMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEEST
           AM--PHYNSKAT----VV-G-G--EMACPH-S------QG-------E--
Sequence 2 AMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQG-------ETR

Sequence 1 GR--FQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQR
           GR---Q-V--RL-RG----IPAGHP----AS-N-NL--L-F--N--NN--
Sequence 2 GRPSYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEK

Sequence 1 DFLAGQNNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRR
           --LAG--N--NQLEREAKEL-F-MP--E-EE---SQ-E--F----RQ---
Sequence 2 FPLAGRRNVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQ

Sequence 1 GQGRDHPLASILDFAFF
           G----------------
Sequence 2 GRADA------------



Alignment 8
Sequence 1:
Sequence 2: Allergen Gly m 5.0201, Sequence: Q9FZP9
Sequence identity: 34.74 (206/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           ----------------------E-C---GQ--R---Q------ER-----
Sequence 2 ------------------VEEEEECE-EGQIPRPRPQHP----ERERQQH

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           ---EE-E----R------PR-P-Q--E--Q-------R--E--------E
Sequence 2 GEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEE

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQ-RRCQIQEQSPERQRQCQQRCER
           ----Q-ERE--R-----------H--Q------Q----E-----Q---E-
Sequence 2 E---QDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEE

Sequence 1 QYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGE
           Q-KE-Q--E-G-E----RE-R---------NP--F-S-----------G-
Sequence 2 QDKESQESE-GSES--QREPR----RHKNKNPFHFNSKRFQTLFKNQYGH

Sequence 1 VKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGR
           V--L-RF--R---L-----YR-------PNT--LPHH-DA----V---G-
Sequence 2 VRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGT

Sequence 1 ATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPV
           A-LTLV----R-S-NL--GD--RVPAG-T-YV-N-D--E-L-M--L--PV
Sequence 2 AILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPV

Sequence 1 NNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF-----
           N-PG-F------------QSYL--FS--IL-A---T--------------
Sequence 2 NKPGRFESFFLSSTQA-QQSYLQGFSKNILEASYDTKFEEINKVLFGREE

Sequence 1 --DQQEQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKS
           ---Q-E-R--E-VI---S----R-LS-HA-S---------S---P--L-S
Sequence 2 GQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTIS--SEDKPFNLRS

Sequence 1 ESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKAT
           --P-YSN--G--FE--PE---QL---DV---------GA---PH-NSKA-
Sequence 2 RDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAI

Sequence 1 VVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLAR
           VV----EG----E-------------Q--R-Q-EE-------K--A-L--
Sequence 2 VVLVINEGEANIELV-------GIKEQQQRQQQEEQPL-EVRKYRAELSE

Sequence 1 GDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG-QNNIINQL
           -DIFVIPAG-P----A----N-----F-IN-ENNQR-FLAG---N-I-Q-
Sequence 2 QDIFVIPAGYPVVVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQI

Sequence 1 EREAKELSFNMPREEIEEIFESQMESYFVPTERQSRR--GQGRDHPLASI
           -----EL-F------IE----SQ-ESYFV----Q-------GR--PL-SI
Sequence 2 PSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSI

Sequence 1 LDFAFF
           L--AF-
Sequence 2 LR-AFY



Alignment 9
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: CAA35691
Sequence identity: 34.23 (203/593)
Sequence 1 ----------------------RGRDDDDEENPRDPREQYRQCQEYCRRQ
           -----------------------G------ENP---------C---C---
Sequence 2 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPK-----HNKCLQSCNSE

Sequence 1 GQGQRQQQQCQIRCEERLEEDQRSQEERERRRGRDVDDQNPRDPEQRYEQ
           ----R-Q--C--RC---L-------EE-E--R-R-------R-P-Q--E-
Sequence 2 RDSYRNQA-CHARCNL-LKVEKEECEEGEIPRPRPRPQHPEREPQQPGEK

Sequence 1 CQQQCERQRRGQEQTLCRRRCEQRRQQEERERQRGRDRQDPQQQYHRCQR
           -----E--R---------R--E---Q-EE-E--R----------------
Sequence 2 EEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDED

Sequence 1 RCQIQEQSPERQ----RQCQQRCERQYKEQQGRERGPEASPRRESRGREE
           -----E---ERQ----R---Q--ER---E----E---E------S--R--
Sequence 2 E---DEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRH

Sequence 1 EQQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVIL
           -----NP--F-S-----------G----L-RF--R---L-----YR----
Sequence 2 KNK--NPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEF

Sequence 1 DANPNTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVP
           ---PNT--LP-H-DA----V---G-A-L-LV----R-S--L--GD--RVP
Sequence 2 NSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVP

Sequence 1 AGATVYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVF
           -G-T-YV-N-D-NE-L----L--PVN-PG-F------------QSYL--F
Sequence 2 SGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEA-QQSYLQGF

Sequence 1 SNDILVAALNTPRDRLERFF-------DQQEQR--EGVIIRASQEKLRAL
           S--IL-A---T-----------------Q-EQR--E-VI---S-E--RAL
Sequence 2 SRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRAL

Sequence 1 SQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQE
           S--A-S---------S---P--L-S--P-YSN--G-FFE--PE---QL--
Sequence 2 SKRAKSSSRKTIS--SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRD

Sequence 1 MDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYE
           -D----------GA---PH-NSKA-V-----EG----E--------Q---
Sequence 2 LDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ---

Sequence 1 GQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLL
           -----EQ--EE------K--A-L---DIFVIPAG-P----A--N-N----
Sequence 2 -----EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAI

Sequence 1 GFDINGENNQRDFLAG-QNNIINQLEREAKELSFNMPREEIEEIFESQME
           G--IN-ENNQR-FLAG-Q-N-I-Q------EL-F-------E-----Q-E
Sequence 2 G--INAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRE

Sequence 1 SYFVPTE-RQSRRG-QGRDHPLASILDFAFF
           SYFV---------G--GR--PL-SIL--AF-
Sequence 2 SYFVDAQPKKKEEGNKGRKGPLSSILR-AFY



Alignment 10
Sequence 1:
Sequence 2: Allergen Gly m 5.0101, Sequence: O22120
Sequence identity: 32.21 (191/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 -----------------------------------------------VEK

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           ---EE-E--R-R-------R-P-Q--E------E--R---------R--E
Sequence 2 EECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEE

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQ----RQCQQR
           ---Q-EE-E--R---------------------E---ERQ----R---Q-
Sequence 2 EHEQREEQEWPRKEEKRGEKGSEEEDEDE---DEEQDERQFPFPRPPHQK

Sequence 1 CERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESE
           -ER---E----E---E------S--R-------NP--F-S----------
Sequence 2 EERKQEEDEDEEQQRESEESEDSELRRHKNK--NPFLFGSNRFETLFKNQ

Sequence 1 EGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVT
           -G----L-RF--R---L-----YR-------PNT--LP-H-DA----V--
Sequence 2 YGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVIL

Sequence 1 RGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLL
           -G-A-L-LV----R-S--L--GD--RVP-G-T-YV-N-D-NE-L----L-
Sequence 2 NGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLA

Sequence 1 QPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF--
           -PVN-PG-F------------QSYL--FS--IL-A---T-----------
Sequence 2 IPVNKPGRFESFFLSSTEA-QQSYLQGFSRNILEASYDTKFEEINKVLFS

Sequence 1 -----DQQEQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPIS
           ------Q-EQR--E-VI---S-E--RALS--A-S---------S---P--
Sequence 2 REEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS--SEDKPFN

Sequence 1 LKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNS
           L-S--P-YSN--G-FFE--PE---QL---D----------GA---PH-NS
Sequence 2 LRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNS

Sequence 1 KATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTAR
           KA-V-----EG----E--------Q--------EQ--EE------K--A-
Sequence 2 KAIVILVINEGDANIELVGLKEQQQ--------EQQQEEQPLEVRKYRAE

Sequence 1 LARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG-QNNII
           L---DIFVIPAG-P----A--N-N----G--IN-ENNQR-FLAG-Q-N-I
Sequence 2 LSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAENNQRNFLAGSQDNVI

Sequence 1 NQLEREAKELSFNMPREEIEEIFESQMESYFVPTE-RQSRRG-QGRDHPL
           -Q------EL-F-------E-----Q-ESYFV---------G--GR--PL
Sequence 2 SQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPL

Sequence 1 ASILDFAFF
           -SIL--AF-
Sequence 2 SSILR-AFY



Alignment 11
Sequence 1:
Sequence 2: Allergen Cor a 11, Sequence: AAL86739
Sequence identity: 37.27 (221/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQ-CQQRCER
           -----------------DP------C---C----Q--E-QR----Q-CE-
Sequence 2 ------------MLPKEDPELK--KCKHKCRDERQFDEQQRRDGKQICEE

Sequence 1 QYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGE
           ---E-Q--E-G-------ES-G-E-E----NPY-F------SR---EEG-
Sequence 2 KARERQ-QEEG---NSSEESYGKEQEE---NPYVFQDEHFESRVKTEEGR

Sequence 1 VKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGR
           V--LE-FT-R--LL-GIEN-R--IL-ANP-T---P-H-DAE-V--V--GR
Sequence 2 VQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVLFVAKGR

Sequence 1 ATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPV
           AT-T-V--E-RESFN-E-GD-IR-PAG--VY-IN-D-NE-L--VK-LQPV
Sequence 2 ATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPV

Sequence 1 NNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQ
           --PG-F---Y-AG---P--S--R-FS---L-AAL---R--LE--F---EQ
Sequence 2 SAPGHFEAFYGAGGEDPE-SFYRAFSWEVLEAALKVRREQLEKVFG--EQ

Sequence 1 REGVIIRASQEKLRALSQHAMSAGQ-RPWGRRSSGGPISLKSESPSYSNQ
           --G-I--AS-EK-RALSQH--------P-G--SSG-PI-L----PS-SNQ
Sequence 2 SKGSIVKASREKIRALSQHEEGPPRIWPFGGESSG-PINLLHKHPSQSNQ

Sequence 1 FGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEG
           FG---EA-P--H-QLQ--D--V--A-I--G-M--P-YNS-AT----VVEG
Sequence 2 FGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEG

Sequence 1 TGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPA
           -G--EMACPH-SS---------------S-G--QK--ARL-RG--FV-PA
Sequence 2 EGFFEMACPHLSS---------------SSGSYQKISARLRRGVVFVAPA

Sequence 1 GHPIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSF
           GHP-A--ASQN-NL--L-F--N---N-R--LAG--NI-N--ER-AKEL-F
Sequence 2 GHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAF

Sequence 1 NMPREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFAFF
           N-P--E-E-IF--Q----F-P---------GR-------------
Sequence 2 NLPSREVERIFKNQDQAFFFPGPNKQQEEGGRGGRAFE-------



Alignment 12
Sequence 1:
Sequence 2: Allergen Pis v 3.0101, Sequence: EF116865
Sequence identity: 36.93 (219/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQ-GQRQQQQCQIRCEERLEED
           ------------DP-----QC---C--Q-Q----Q--QC---CE----E-
Sequence 2 ----------KTDP--ELKQCKHQCKVQRQYDEEQKEQCAKGCEKYYKEK

Sequence 1 Q-RSQEERERR-----RGRDVDDQNPRDP-EQRYEQCQQQCERQRRGQEQ
           --R-QEE-E-------RGR--D------P-E-R--QC--QCERQ--GQ--
Sequence 2 KGREQEEEEEEEWGSGRGRG-DEFSTHEPGEKRLSQCMKQCERQDGGQQK

Sequence 1 TLCRRRCEQRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQ
           -LCR-RC------E-RE----RD---------------------------
Sequence 2 QLCRFRCQEKYKKERREHSYSRDEEE------------------------

Sequence 1 CQQRCERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSR
           ----------E--G-E--------------E-E----NPY-F-------R
Sequence 2 ----------EEEGDE--------------EQEEEDENPYVFEDEHFTTR

Sequence 1 HESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESV
           ---E-G-V--L--FT-R--LLRG-E-YR---L-ANP-----P-H-DA-S-
Sequence 2 VKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDADSI

Sequence 1 AVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEM
           --V--GR-T-T------RES-N---GD-IR--AG---Y--N-D-NE-L--
Sequence 2 FFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYI

Sequence 1 VKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER
           VKLLQPVN-PG--------G---P--S--R-FS---L-AAL-TPRD-LE-
Sequence 2 VKLLQPVNLPGHYEVFHGPGGENPE-SFYRAFSREVLEAALKTPRDKLEK

Sequence 1 FFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSES
           -F--Q---EG-I--AS-E--RA-S---------P----S-G----L----
Sequence 2 LFEKQD--EGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTG-TFNLFKKD

Sequence 1 PSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVV
           PS-SN--GQ-FE--------LQE-D--V-Y--I--G-M--P-YNS-AT--
Sequence 2 PSQSNNYGQLFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKI

Sequence 1 VYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGD
           --VV-G-GR-E-ACPH-SS----GQ-------E-S-----K---------
Sequence 2 AIVVSGEGRLEIACPHLSSSKNSGQ-------EKSGPSYKKLSSSIRTDS

Sequence 1 IFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLERE
           -FV-PAGHP----AS-N-NL--L-F--N-E-N-R--LAG--NII---E-E
Sequence 2 VFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKKNIIEVMEKE

Sequence 1 AKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFAF
           AKEL-F----EE----F--Q-E--F----------QGR------------
Sequence 2 AKELAFKTKGEEVDKVFGKQDEEFFFQGPKWRQHQQGRADE---------

Sequence 1 F
           -
Sequence 2 -



Alignment 13
Sequence 1:
Sequence 2: Allergen Pin k 2.0101, Sequence: V9VGU0
Sequence identity: 29.17 (173/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
           --------------------------------------------------
Sequence 2 ------------------MAFVSLLTILLAISSSSVALTEPVASMADQGV

Sequence 1 YKEQQGR-ERG--PEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEE
           --EQ-GR---G--PE---R---RG--EE----NPY-FHS---R-R--SE-
Sequence 2 FPEQHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEA

Sequence 1 GEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTR
           GE---L--F-E--ELL-GI--YRV------PNT-MLPH--DA-----VT-
Sequence 2 GEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTG

Sequence 1 GRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQ
           GR-----V-Q-------LE-GDV--VP-G-T-Y--N-D----L----LL-
Sequence 2 GRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR

Sequence 1 PVNNP-GQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQ
           ------G-----Y-AG---P---Y---FS-D-L-AA-NT----LE--F--
Sequence 2 TESTMRGEYEPFYVAGGRNPETVY-SAFSDDVLEAAFNTDVQKLEHIFGA

Sequence 1 QEQREGVIIRASQEKLRAL------SQHAMSAGQRPWGRRSSGGPISLKS
           ---R-GVI--A--E--R--------S----SA---P--------P--L--
Sequence 2 H--RRGVIFYANEEQIREMMRRGGFSAESTSASEQP-------KPFNLRN

Sequence 1 ESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKAT
           --P---N--G-F--A-P-----L---DV-V-------G-M--P--N-KAT
Sequence 2 QKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKAT

Sequence 1 VVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLAR
           ----V-EG-GR-EMACPH---Q-------RE------------V-ARL--
Sequence 2 SIAIVMEGEGRIEMACPHLG-QEHGWSSPRERGHQDIN--YERVRARLRT

Sequence 1 GDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLE
           G---V-PAGHPI---AS-N--L--L-FDIN---N-R-FLAG-NN----LE
Sequence 2 GTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLE

Sequence 1 REAKELSFNMPR-EEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILD
           -E---LSFN-PR-EEIEE----Q------------RR---R---------
Sequence 2 KEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS------

Sequence 1 FAFF
           ----
Sequence 2 ----



Alignment 14
Sequence 1:
Sequence 2: Allergen Vig r 2.0101, Sequence: Q198W3
Sequence identity: 27.49 (163/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
           --------------------------------------------------
Sequence 2 ---------------------------------------MVRARVQLLLG

Sequence 1 YKEQQGRERGPEASPRRESRGREEEQQR--HNPYYFHS-QSIRSRHESEE
           ---------------R------EE---R---NP-YF-S------------
Sequence 2 ILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQY

Sequence 1 GEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTR
           G------RF--R-------ENYRVV-----PNT--LPHH-DA----VV--
Sequence 2 GHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLN

Sequence 1 GRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQ
           GRA-LTLV----R-S--LE-G-----PAG-T----N---N--L---KL--
Sequence 2 GRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAI

Sequence 1 PVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFD-
           PVNNP--F------------QSYLR-FS--IL-A----------R--F--
Sequence 2 PVNNPHRFQNFFLSSTEA-QQSYLRGFSKNILEASFDSDFKEIDRVLFGE

Sequence 1 --QQE-----QREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISL
           --QQ------Q-EGVI-----E--R-L--HA-S---------S---P--L
Sequence 2 ERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS--SQDEPFNL

Sequence 1 KSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSK
           ----P-YSN-FG---E--PE---QL---DV-------K-G----PHYNSK
Sequence 2 RNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSK

Sequence 1 ATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARL
           A-V-----EG----E---P--S-Q---------Q---ES----Q---A-L
Sequence 2 AIVILVINEGEAKIELVGP--SDQ---------QQQDESL-EVQRYRAEL

Sequence 1 ARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ-NNIIN
           ---D-FVIPA--P-AI-A--N-N-----F-IN-ENNQR-FLAG---N---
Sequence 2 SEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVMS

Sequence 1 QLEREAKELSFNMPREEIEEIFESQMESYFV---PTERQSRRG-QGRDHP
           ----E----SF-------E-----Q-ES-FV---P---Q---G--GR---
Sequence 2 EIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGS

Sequence 1 LASILDFAFF
           L-SIL-----
Sequence 2 LSSILGSLY-



Alignment 15
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB23463
Sequence identity: 27.99 (166/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
           --------------------------------------------------
Sequence 2 ---------------------------------------------MMRVR

Sequence 1 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQ-SIRSRHESEEGE
           ------------AS-------RE-E----NP-YF-S--S-----E-----
Sequence 2 FPLLVLLGTVFLASVCVSLKVREDE---NNPFYFRSSNSFQTLFENQNVR

Sequence 1 VKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGR
           ---L-RF--R---L-----YR-V-----PNT--LPHH-DA-----V--GR
Sequence 2 IRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGR

Sequence 1 ATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPV
           A-LTLV----R-S-NL--GD--R-PAG-T-Y--N------L---KL--PV
Sequence 2 AILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPV

Sequence 1 NNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER--FFDQQ
           N-PG--------------QSYL--FS--IL------------R--F----
Sequence 2 NKPGRYDDFFLSSTQA-QQSYLQGFSHNILETSFHSEFEEINRVLFGEEE

Sequence 1 EQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSY
           EQR--EGVI---S-E--R-LS--A-S---------S---P--L-S--P-Y
Sequence 2 EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTIS--SEDEPFNLRSRNPIY

Sequence 1 SNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYV
           SN-FG-FFE--PE---QL---D-------I--GA---PH-NSKA-V----
Sequence 2 SNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVI

Sequence 1 VEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFV
           -EG----E-----------E-Q----QEEE------Q---A-L---D-FV
Sequence 2 NEGDANIELVGIK------EQQQKQKQEEEPL--EVQRYRAELSEDDVFV

Sequence 1 IPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ-NNIINQLEREAK
           IPA--P----A--N-N---L-F-IN-ENNQR-FLAG---N---Q-ER---
Sequence 2 IPAAYPFVVNATSNLNF--LAFGINAENNQRNFLAGEKDNVVRQIERQVQ

Sequence 1 ELSFNMPREEIEEIFESQMESYFVPTERQSRR--GQGRDHPLASILDFAF
           EL-F-------E-----Q-ESYFV----Q-------GR--P--SIL----
Sequence 2 ELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY

Sequence 1 F
           -
Sequence 2 -



Alignment 16
Sequence 1:
Sequence 2: Allergen Ana o 1.0101, Sequence: AAM73730
Sequence identity: 33.22 (197/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 ------------------------------------------MGPPTKFS

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQT--LCRRR
           -S------------------DPE----QC--QC--QR---EQ----C---
Sequence 2 FSLFLVSVLVLCLGFALAKIDPELK--QCKHQCKVQRQYDEQQKEQCVKE

Sequence 1 CEQ--------RRQQEERERQRGR------DRQDPQQQY-HRCQRRCQIQ
           CE----------R--EE-E---G-----------P-------C-R-C--Q
Sequence 2 CEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQ

Sequence 1 EQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYY
           E-----Q--C--RC---YK---G-----------E-----EE----NPY-
Sequence 2 EGGQQKQ-LCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEEDE-NPYV

Sequence 1 FHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSML
           F-----------E-G-V--L--FT----LL---E-YR---L-ANP-----
Sequence 2 FEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVV

Sequence 1 PHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVIN
           P-H-DA-S---V--GR-T-T------RES-N---GD------G---Y--N
Sequence 2 PSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIAN

Sequence 1 QDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAAL
           -D-NE-L--V--L-PVN-PG-F------G---P--S--R-FS--IL-AAL
Sequence 2 NDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPE-SFYRAFSWEILEAAL

Sequence 1 NTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWG-RRSS
           -T--D-LE--F--Q-Q--G-I--AS-E--RA-S------G---W-----S
Sequence 2 KTSKDTLEKLFEKQDQ--GTIMKASKEQIRAMSRRG--EGPKIWPFTEES

Sequence 1 GGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMV
           -G---L----PS-SN--GQ-FEA-------L---D--V-YA-I--G-M-V
Sequence 2 TGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSV

Sequence 1 PHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQ
           P-YNS-AT----VV-G-G--E-ACPH-SS---------------S-----
Sequence 2 PFYNSRATKIAIVVSGEGCVEIACPHLSSS------------KSSHPSYK

Sequence 1 KVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ
           K--AR------F--PAGHP-A--AS-NENL----F--N-E-N-R--LAG-
Sequence 2 KLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGK

Sequence 1 NNIINQLEREAKELSFNMPREEIEEIFESQMESYFV--PTERQSRRGQGR
           -NII---E-EAKEL-F-M--EE----F--Q-E--F---P--R----G---
Sequence 2 KNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRAD

Sequence 1 DHPLASILDFAFF
           -------------
Sequence 2 E------------



Alignment 17
Sequence 1:
Sequence 2: Allergen Ana o 1.0102, Sequence: AAM73729
Sequence identity: 33.22 (197/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------PPTKFS

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQT--LCRRR
           -S------------------DPE----QC--QC--QR---EQ----C---
Sequence 2 FSLFLVSVLVLCLGFALAKIDPELK--QCKHQCKVQRQYDEQQKEQCVKE

Sequence 1 CEQ--------RRQQEERERQRGR------DRQDPQQQY-HRCQRRCQIQ
           CE----------R--EE-E---G-----------P-------C-R-C--Q
Sequence 2 CEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQ

Sequence 1 EQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYY
           E-----Q--C--RC---YK---G-----------E-----EE----NPY-
Sequence 2 EGGQQKQ-LCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEEDE-NPYV

Sequence 1 FHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSML
           F-----------E-G-V--L--FT----LL---E-YR---L-ANP-----
Sequence 2 FEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVV

Sequence 1 PHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVIN
           P-H-DA-S---V--GR-T-T------RES-N---GD------G---Y--N
Sequence 2 PSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIAN

Sequence 1 QDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAAL
           -D-NE-L--V--L-PVN-PG-F------G---P--S--R-FS--IL-AAL
Sequence 2 NDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPE-SFYRAFSWEILEAAL

Sequence 1 NTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWG-RRSS
           -T--D-LE--F--Q-Q--G-I--AS-E--RA-S------G---W-----S
Sequence 2 KTSKDTLEKLFEKQDQ--GTIMKASKEQVRAMSRRG--EGPKIWPFTEES

Sequence 1 GGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMV
           -G---L----PS-SN--GQ-FEA-------L---D--V-YA-I--G-M-V
Sequence 2 TGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSV

Sequence 1 PHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQ
           P-YNS-AT----VV-G-G--E-ACPH-SS---------------S-----
Sequence 2 PFYNSRATKIAIVVSGEGCVEIACPHLSSS------------KSSHPSYK

Sequence 1 KVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ
           K--AR------F--PAGHP-A--AS-NENL----F--N-E-N-R--LAG-
Sequence 2 KLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGK

Sequence 1 NNIINQLEREAKELSFNMPREEIEEIFESQMESYFV--PTERQSRRGQGR
           -NII---E-EAKEL-F-M--EE----F--Q-E--F---P--R----G---
Sequence 2 KNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRAD

Sequence 1 DHPLASILDFAFF
           -------------
Sequence 2 E------------



Alignment 18
Sequence 1:
Sequence 2: Allergen Vig r 2.0201, Sequence: B1NPN8
Sequence identity: 25.80 (153/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
           --------------------------------------------------
Sequence 2 -----------------------------------MVRARIPLLLLLGIL

Sequence 1 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQS-IRSRHESEEGE
           ---------G-------------------NP-YF-S------------G-
Sequence 2 FLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFRNQFGH

Sequence 1 VKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGR
           ---L-RF--R-------ENYRVV-L---PNT--LPHH-DA----VV--GR
Sequence 2 LRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGR

Sequence 1 ATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPV
           A-LTLV----R-S--LE-G-----PAG-T----N-D-NE-L---KL--PV
Sequence 2 AVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPV

Sequence 1 NNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF-----
           NNP--F------------QSYL--FS--IL-A----------R-------
Sequence 2 NNPHRFQDFFLSSTEA-QQSYLQGFSKNILEASFDSDIKEISRVLFGEEG

Sequence 1 -----DQQEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLK
           ------Q--Q-EGVI-----E--R-L--HA-S---------S---P--L-
Sequence 2 QQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKKSLS--SEDQPFNLR

Sequence 1 SESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKA
           ---P-YSN--G--FE--PE---QL---D--------K-G----PHYNSKA
Sequence 2 NQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKA

Sequence 1 TVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLA
           -V-----EG----E-----------E-Q----QEE-E-----Q---A-L-
Sequence 2 IVILVINEGKANIELV------GQREQQ--KQQEEQEESWEVQRYRAELS

Sequence 1 RGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ-NNIINQ
           --D-F-IPA--P-AI-A--N-N-----F-IN-ENNQR-FLAG---N-I--
Sequence 2 EDDVFIIPATYPVAINATSNLNF--FAFGINAENNQRNFLAGEKDNVISE

Sequence 1 LEREAKELSFNMPREEIEEIFESQMESYFVPTE-RQSRRGQGRDHPLASI
           ---E-----F----E--------Q-ES-FV-----Q--R---R-------
Sequence 2 IPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEARKGGKGPF

Sequence 1 LDFAFF
           ------
Sequence 2 VY----



Alignment 19
Sequence 1:
Sequence 2: Allergen Lup an 1.0101, Sequence: ACB05815
Sequence identity: 37.44 (222/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           ----------------------------------------------E-D-
Sequence 2 ----------------MAKMRVRLPMLILLLGVVFLLAASIGIAYGEKDF

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           ------ER--------Q-PR-P-Q--EQ------------E----R---E
Sequence 2 TKNPPKEREEEEHEPRQQPR-PRQQEEQEREHRREEKHDGEPSRGRSQSE

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQ----SPERQRQCQQR
           ---Q-EE-ER-R---R---Q-Q--R-QRR----E------P-RQR----R
Sequence 2 ES-QEEEHERRREHHREREQEQQPRPQRRQEEEEEEEEWQPRRQRPQSRR

Sequence 1 CERQYKEQQ-----GRER--GPEASPRRESR-GREEEQQRH---------
           -ER---EQ------G--R--G-E----RE-R--REE--Q-----------
Sequence 2 EEREEREQEQGSSSGSQRGGGDERRQHRERRVHREEREQEQDSRSDSRRQ

Sequence 1 -NPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANP
           -NPY-F-S-----------G----LERF--RT--L----NYR-------P
Sequence 2 RNPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKP

Sequence 1 NTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGAT
           NT--LP-H-DA----VV--GRAT-T-V----R---NLE-GD--R-PAG-T
Sequence 2 NTLILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTT

Sequence 1 VYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDI
           -Y--N-D-N--L---KL--P-NNPG-----Y----K---QSY---FS---
Sequence 2 SYILNPDDNQNLRVAKLAIPINNPGKLYDFYPSTTKD-QQSYFSGFSKNT

Sequence 1 LVAALNTPRDRLERFF----------------DQQEQREGVIIRASQEKL
           L-A--NT-----ER-------------------Q--Q-EGVI-R-S----
Sequence 2 LEATFNTRYEEIERVLLGDDELQENEKQRRGQEQSHQDEGVIVRVSKKQI

Sequence 1 RALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQ
           --L--HA-S------G--S--GP--L-S--P-YSN-FG-F-E--P----Q
Sequence 2 QELRKHAQSSSGE--GKPSESGPFNLRSNKPIYSNKFGNFYEITPDINPQ

Sequence 1 LQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQ
           -Q---------EI--GA---PHYNSKA---V-V-EG-G-YE--------Q
Sequence 2 FQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELV--GIRDQ

Sequence 1 SYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENL
           ----Q---E-E-E------------L--GD-F-IPAGHP--I-AS-N--L
Sequence 2 QRQ-QDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASSN--L

Sequence 1 RLLGFDINGENNQRDFLAG-QNNIINQLEREAKELSFNMPREEIEEIFES
           RLLGF-IN---NQR-FLAG---N-I-QL-RE-KEL-F----E--E-----
Sequence 2 RLLGFGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKN

Sequence 1 QMESYFV---PTERQSRRGQGRDH---PLASILDFAFF
           Q--SYF----P---Q-R---GR-----P--SIL-----
Sequence 2 QQQSYFANAQPQQQQQREKEGRRGRRGPISSILNALY-



Alignment 20
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43237
Sequence identity: 36.93 (219/593)
Sequence 1 ------------------------RGRDDDDEENPRDPREQYRQCQEYCR
           --------------------------------ENP---R-----C---C-
Sequence 2 MRGRVSPLMLLLGILVLASVSATQAKSPYRKTENPCAQR-----CLQSCQ

Sequence 1 RQGQGQRQQQQCQIRCEERLEEDQRSQEERERRRGRDVDDQNPRDPEQRY
           -------Q---C--RC---LE-D-R-----------D----N-R-P----
Sequence 2 QEPDDLKQKA-CESRCT-KLEYDPRCV--------YDTGATNQRHPPGER

Sequence 1 EQCQQQCERQRRGQEQTLCRRRCEQRR--QQEERERQRGRDRQDPQQQYH
           ----Q---------------RR-E--R----E-RER-R--D---P-----
Sequence 2 TRGRQPGDYDDDRRQP----RREEGGRWGPAEPREREREEDWRQPREDWR

Sequence 1 RCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPE-ASPRRESRGRE
           R---------Q-P---R--------------GRE---E---P--E-R---
Sequence 2 R------PSHQQPRKIRP------------EGREGEQEWGTPGSEVR---

Sequence 1 EEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVI
           EE--R-NP-YF-S-----R-----G----L-RF--R--------N-R-V-
Sequence 2 EETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQ

Sequence 1 LDANPNTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRV
           --A-PNT--LP-H-DA----V---G-AT-T------R-SFNL--G---R-
Sequence 2 IEARPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRI

Sequence 1 PAGATVYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQS-YLR
           P-G---Y--N---N--L---K---PVN-PGQF-----A-----DQS-YL-
Sequence 2 PSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSR--DQSSYLQ

Sequence 1 VFSNDILVAALNTPRDRLERFF------DQQEQR------------EGVI
           -FS---L-AA-N-------R----------QE-R------------EGVI
Sequence 2 GFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRRSTRSSDNEGVI

Sequence 1 IRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFE
           ---S-E----L--HA-S-------------PI-L----P--SN-FG--FE
Sequence 2 VKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPDLSNNFGRLFE

Sequence 1 ACPEEHR-QLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYE
           --P-----QLQ--D------EIK-GA-M-PH-NSKA-V-V-V--GTG--E
Sequence 2 VKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLE

Sequence 1 MACPHVSSQSYEGQGRREQE--------EEESTGR-FQKVTARLARGDIF
           --------Q-----GRREQE--------EEE---R-----TARL--GD-F
Sequence 2 LVAVRKEQQQ---RGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVF

Sequence 1 VIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG-QNNIINQLEREA
           --PA-HP-AI-AS----L-LLGF-IN-ENN-R-FLAG---N-I-Q-E--A
Sequence 2 IMPAAHPVAINASSE--LHLLGFGINAENNHRIFLAGDKDNVIDQIEKQA

Sequence 1 KELSFNMPREEIEEIFESQMESYFV--------PT----ERQSRRGQGRD
           K-L-F----E--E-----Q-ES-FV--------P-----E-Q----QG--
Sequence 2 KDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPSSPEKEDQEEENQGGK

Sequence 1 HPLASILDFAFF
           -PL-SIL-----
Sequence 2 GPLLSILKAFN-



Alignment 21
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43238
Sequence identity: 36.26 (215/593)
Sequence 1 --------------------------RGRDDDDEENPRDPREQYRQCQEY
           ----------------------------------ENP---R-----C---
Sequence 2 MRGRVSPLMLLLGILVLASVSATHAKSSPYQKKTENPCAQR-----CLQS

Sequence 1 CRRQGQGQRQQQQCQIRCEERLEEDQRSQEERERRRGRDVDDQNPRDPEQ
           C--------Q---C--RC---LE-D-R---------G-------P--P--
Sequence 2 CQQEPDDLKQKA-CESRCT-KLEYDPRCVYDPRGHTGT-TNQRSP--PGE

Sequence 1 RYEQCQQQCERQRRGQEQTLCRRRCEQRRQQEE--RERQRGRDRQDPQQQ
           R----Q-------R-Q------RR-E--R------RER-R--D---P---
Sequence 2 RTRGRQPGDYDDDRRQP-----RREEGGRWGPAGPREREREEDWRQPRED

Sequence 1 YHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESRGR
           --R-----------P--Q-----R-E----EQ---E-G---S--RE----
Sequence 2 WRR-----------PSHQQPRKIRPEGREGEQ---EWGTPGSHVRE----

Sequence 1 EEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVV
           --E--R-NP-YF-S-----R-----G----L-RF--R--------N-R-V
Sequence 2 --ETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIV

Sequence 1 ILDANPNTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIR
           ---A-PNT--LP-H-DA----V---G-AT-T------R-SFNL--G---R
Sequence 2 QIEAKPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALR

Sequence 1 VPAGATVYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQS-YL
           -P-G---Y--N---N--L---K---PVN-PGQF-----A-----DQS-YL
Sequence 2 IPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSR--DQSSYL

Sequence 1 RVFSNDILVAALNTPRDRLERFF------DQQEQR-------------EG
           --FS---L-AA-N-------R----------QE-R-------------EG
Sequence 2 QGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRWSTRSSENNEG

Sequence 1 VIIRASQEKLRALSQHAMSAGQRPWGRRSSG---GPISLKSESPSYSNQF
           VI---S-E----L--HA-S------G----G----PI-L----P--SN-F
Sequence 2 VIVKVSKEHVEELTKHAKSVSKK--GSEEEGDITNPINLREGEPDLSNNF

Sequence 1 GQFFEACPEEHR-QLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEG
           G--FE--P-----QLQ--D------EIK-GA-M-PH-NSKA-V-V-V--G
Sequence 2 GKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKG

Sequence 1 TGRYEMACPHVSSQSYEGQGRREQEE-----EESTGR-FQKVTARLARGD
           TG--E--------Q-----GRRE-EE-----EE---R-----TARL--GD
Sequence 2 TGNLELVAVRKEQQQ---RGRREEEEDEDEEEEGSNREVRRYTARLKEGD

Sequence 1 IFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG-QNNIINQLER
           -F--PA-HP-AI-AS----L-LLGF-IN-ENN-R-FLAG---N-I-Q-E-
Sequence 2 VFIMPAAHPVAINASSE--LHLLGFGINAENNHRIFLAGDKDNVIDQIEK

Sequence 1 EAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFA
           -AK-L-F----E--E-----Q-ES-FV----QS---Q----P--------
Sequence 2 QAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQ-SQSPSSPEKESPEKE

Sequence 1 FF-------------------
           ---------------------
Sequence 2 DQEEENQGGKGPLLSILKAFN



Alignment 22
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB01374
Sequence identity: 34.74 (206/593)
Sequence 1 ----------------------RGRDDDDEENPRDPREQYRQCQEYCRRQ
           -----------------------G-------NP---------C---C---
Sequence 2 MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNP-----SHNKCLRSCNSE

Sequence 1 GQGQRQQQQCQIRC-------EERLEEDQ----RSQE-ERERRR-GRDVD
           ----R-Q--C--RC-------EE--EE-Q----R-Q--ERER---G----
Sequence 2 KDSYRNQA-CHARCNLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEE

Sequence 1 DQN--PRD-PEQRYEQCQQQCERQRRGQEQTLCRRRCEQRRQQEERERQR
           D----PR--P--R--Q--Q--E------------R--E--------E-Q-
Sequence 2 DEGEQPRPFPFPRPRQPHQEEEHEQKEEHEW--HRKEEKHGGKGSEEEQD

Sequence 1 GRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPE
           -R----P-Q-----------Q------Q-------E----E---------
Sequence 2 EREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQ

Sequence 1 ASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTEL
           -S---ES----------NP--F-S-----------G-V--L-RF--R---
Sequence 2 ESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ

Sequence 1 LRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRATLTLVSQETRES
           L-----YR-------PNT--LPHH-DA----V---G-A-LTLV----R-S
Sequence 2 LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDS

Sequence 1 FNLECGDVIRVPAGATVYVINQ-------------------DSNERLEMV
           -NL--GD--RVPAG-T-YV-N--------------------D--E-L-M-
Sequence 2 YNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMI

Sequence 1 KLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERF
           -L--PVN-PG-F------------QSYL--FS--IL-A---T--------
Sequence 2 TLAIPVNKPGRFESFFLSSTQA-QQSYLQGFSKNILEASYDTKFEEINKV

Sequence 1 F-------DQQEQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGG
           ---------Q-E-R--E-VI---S----R-LS-HA-S---------S---
Sequence 2 LFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTIS--SEDK

Sequence 1 PISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPH
           P--L-S--P-YSN--G--FE-------QL---DV---------GA---PH
Sequence 2 PFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPH

Sequence 1 YNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKV
           -NSKA-VV----EG----E-------------Q--R-Q-EE-------K-
Sequence 2 FNSKAIVVLVINEGEANIELV-------GIKEQQQRQQQEEQPL-EVRKY

Sequence 1 TARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG-QN
           -A-L---DIFVIPAG-P----A----N-----F-IN-ENNQR-FLAG---
Sequence 2 RAELSEQDIFVIPAGYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKD

Sequence 1 NIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRR--GQGRD
           N-I-Q------EL-F------IE----SQ-ESYFV----Q-------GR-
Sequence 2 NVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRK

Sequence 1 HPLASILDFAFF
           -PL-SIL--AF-
Sequence 2 GPLSSILR-AFY



Alignment 23
Sequence 1:
Sequence 2: Allergen Len c 1.0101, Sequence: CAD87730
Sequence identity: 27.32 (162/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV
           -----------------------------NP--F-S-------E-E-G--
Sequence 2 -----------------------SRSDQENPFIFKSNRFQTIYENENGHI

Sequence 1 KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRA
           --L-RF--R--------NYR-------P-T--LP---DA----VV--G-A
Sequence 2 RLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDADFILVVLSGKA

Sequence 1 TLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVN
           -LT------R-SFNLE-GD-I--PAG---Y--N-D-NE-L----L--PVN
Sequence 2 ILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVN

Sequence 1 NPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQ
           -PGQ-------G------S-L--FS--IL-AA-NT-----E------QEQ
Sequence 2 RPGQLQSFLLSGTQN-QPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQ

Sequence 1 R----------------EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSG
           -----------------E-VI---S-E----LS--A-S---------S--
Sequence 2 KSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE-

Sequence 1 GPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVP
           -P--L-S--P-YSN-FG-FFE--PE---QLQ--D--VN--EIK-G----P
Sequence 2 -PFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLP

Sequence 1 HYNSKATVVVYVVEGTGRYEMACPHVSSQ--SYEGQGRREQEEEESTGRF
           -YNS-A-V-V-V-EG-G--E--------Q----E-----E--EEE-T---
Sequence 2 NYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQV

Sequence 1 QKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG
           Q---ARL--GD--VIPAGHP-AI-AS---NL---GF-IN--NNQR-FLAG
Sequence 2 QRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGINAKNNQRNFLAG

Sequence 1 Q-NNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGR
           ---N-I-Q--R--KEL-F-----E-------Q--S-F-------------
Sequence 2 EEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE----

Sequence 1 DHPLASILDFAFF
           -------------
Sequence 2 -------------



Alignment 24
Sequence 1:
Sequence 2: Allergen Len c 1.0102, Sequence: CAD87731
Sequence identity: 27.32 (162/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV
           -----------------------------NP--F-S-------E-E-G--
Sequence 2 -----------------------SRSDQENPFIFKSNRFQTIYENENGHI

Sequence 1 KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRA
           --L--F--R--------NYR-------P-T--LP---DA----VV--G-A
Sequence 2 RLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTDADFILVVLSGKA

Sequence 1 TLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVN
           -LT------R-SFNLE-GD-I--PAG---Y--N-D-NE-L----L--PVN
Sequence 2 VLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVN

Sequence 1 NPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQ
           NPGQ-------G------S-L--F---IL-AA-NT-----E------QEQ
Sequence 2 NPGQLESFLLSGTQN-QPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQ

Sequence 1 ----------------REGVIIRASQEKLRALSQHAMSAGQRPWGRRSSG
           -----------------E-VI---S-E----LS--A-S---------S--
Sequence 2 EPQHRRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE-

Sequence 1 GPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVP
           -P--L-S--P-YSN-FG-FFE--PE---QLQ--D--VN--EIK-G----P
Sequence 2 -PFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLP

Sequence 1 HYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQK
           -YNS-A-V-V-V-EG-G--E--------Q--E-----EQEEE-ST---Q-
Sequence 2 NYNSRAIVIVTVNEGKGYFELVGQRNENQREENDDEEEQEEETST-QVQR

Sequence 1 VTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ-
           --A-L--GD-FV-PAGHP-AI-AS---NL---GF-IN--NNQR-FLAG--
Sequence 2 YRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGINAKNNQRNFLAGEE

Sequence 1 NNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGRDH
           -N-I-Q--R--KEL-F-----E-------Q--S-F---------------
Sequence 2 DNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE------

Sequence 1 PLASILDFAFF
           -----------
Sequence 2 -----------



Alignment 25
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAA33947
Sequence identity: 14.84 (88/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVN
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFG
           ---------------S--A-S---------S---P--L-S--P-YS---G
Sequence 2 ---------------SKRAKSSSRKTIS--SEDKPFNLGSRDPIYSKKLG

Sequence 1 QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTG
           -FFE--PE---QL---D----------GA---PH-NSKA-V-----EG--
Sequence 2 KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDA

Sequence 1 RYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH
           --E--------Q--------EQ--EE------K--A-L---DIFVIPAG-
Sequence 2 NIELVGLKEQQQ--------EQQQEEQPLEVRKYRAELSEQDIFVIPAGY

Sequence 1 PIAITASQNENLRLLGFDINGENNQRDFLAG-QNNIINQLEREAKELSFN
           P----A--N-N----G--IN-ENNQR-FLAG-Q-N-I-Q------EL-F-
Sequence 2 PVVVNATSNLNFFAIG--INAENNQRNFLAGSQDNVISQIPSQVQELAFP

Sequence 1 MPREEIEEIFESQMESYFV---PTERQSRRGQGRDHPLASILDFAFF
           ------E-----Q-ESYFV---P-E-------GR--PL-SIL--AF-
Sequence 2 GSAQAVEKLLKNQRESYFVDAQPNEKE-EGNKGRKGPLSSILR-AFY



Alignment 26
Sequence 1:
Sequence 2: Allergen Pru du 8.0101, Sequence: A0A516F3L2
Sequence identity: 8.77 (52/593)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MATMTKAELPLLVLFLSTLLLATSVPSVRAQVTCEEGCYSISDQSKVGEC

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LQMCSSHGQSCEDRCMREARWPQQQEQCLRMCRQQEQGHHLPCREQCIRS

Sequence 1 -------------------RGRDDDDEENPRDPREQYRQCQEYC---RRQ
           -------------------R----------RDPRE----C---C-----Q
Sequence 2 PDREMCERACQQQQGQGGGRQCLQRCKMITRDPRERLK-CVRTCTQGQQQ

Sequence 1 G--QGQRQQQQCQIRCEERLEEDQRSQEERERRRGRDVDDQNPRDPEQRY
           G--QGQ-QQQQ----C-------Q--Q-ER--------------DP--R-
Sequence 2 GVFQGQQQQQQVEQQCR------QHCQSER--------------DP-MRQ

Sequence 1 EQCQQQCERQRRGQE-QTLCRRRCEQRRQQEERERQRGRDRQDPQQQYHR
           --CQ--C--Q---QE----CR-RC---R---E---Q----------Q---
Sequence 2 QECQEYCVGQMMQQEYEQQCRSRCQWERPRREQQEQCQEECTEKIRQLEQ

Sequence 1 CQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESRGREEE
           CQ--C-IQ-Q----Q--CQ--C--Q----QG-------------------
Sequence 2 CQEGCKIQGQYGPQQQECQRMCREQFEQGQGIRMVA--------------

Sequence 1 QQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ANPNTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GATVYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NDILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PWGRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RDFLAGQNNIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RGQGRDHPLASILDFAFF
           ------------------
Sequence 2 ------------------



Alignment 27
Sequence 1:
Sequence 2: Allergen Fag e 3.0101, Sequence: A5HIX6
Sequence identity: 7.42 (44/593)
Sequence 1 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ
           ----------P--PR-Q---C---C----QG-R----C---CE-R---D-
Sequence 2 -------GDYPFEPRRQIEHCRQRCQDRSQGFRETRECLETCEKRAGFDD

Sequence 1 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRG-QEQTLCRRRC
           ----E----------D---RDP-Q---QC---C--Q--G---Q--C--RC
Sequence 2 EPSKEVDSY----TTDTRSRDPQQEFRQCRHRCQTQEEGGRQQRKCEQRC

Sequence 1 EQR--RQQEERERQRGRDRQD---PQQQYHRCQRRCQIQEQSPERQRQCQ
           E----RQQ-------G--R-----P---Y--C---C-----SP-----C-
Sequence 2 EKQLERQQGYDDEEFGQGRSNIGAPVRNYDDCTEMCG---GSP----LCA

Sequence 1 QRCERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHE
           --CE----------------------------------------------
Sequence 2 LFCE----------------------------------------------

Sequence 1 SEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVK
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DQQEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAK
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ELSFNMPREEIEEIFESQMESYFVPTERQSRRGQGRDHPLASILDFAFF
           -------------------------------------------------
Sequence 2 -------------------------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.